NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F053280

Metagenome / Metatranscriptome Family F053280

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F053280
Family Type Metagenome / Metatranscriptome
Number of Sequences 141
Average Sequence Length 47 residues
Representative Sequence VEKQIMQQAPWAPWSNRVFPEFFSKKMGCIHIQRLYGIDLARLCRK
Number of Associated Samples 124
Number of Associated Scaffolds 141

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 3.55 %
% of genes near scaffold ends (potentially truncated) 95.74 %
% of genes from short scaffolds (< 2000 bps) 96.45 %
Associated GOLD sequencing projects 122
AlphaFold2 3D model prediction Yes
3D model pTM-score0.15

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (73.050 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(18.440 % of family members)
Environment Ontology (ENVO) Unclassified
(26.241 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(60.284 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 33.78%    β-sheet: 0.00%    Coil/Unstructured: 66.22%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.15
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 141 Family Scaffolds
PF12911OppC_N 91.49
PF00005ABC_tran 2.13
PF00528BPD_transp_1 2.13
PF00496SBP_bac_5 2.13


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms73.05 %
UnclassifiedrootN/A26.95 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459015|G14TP7Y01AJR86All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium551Open in IMG/M
3300000891|JGI10214J12806_11075696All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium2073Open in IMG/M
3300000953|JGI11615J12901_10081109Not Available586Open in IMG/M
3300000956|JGI10216J12902_104608767Not Available634Open in IMG/M
3300000956|JGI10216J12902_107269423Not Available554Open in IMG/M
3300000956|JGI10216J12902_112301216Not Available1283Open in IMG/M
3300000956|JGI10216J12902_123761765All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium582Open in IMG/M
3300002568|C688J35102_118630746All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium579Open in IMG/M
3300004156|Ga0062589_100576301All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium970Open in IMG/M
3300004157|Ga0062590_101513087All Organisms → cellular organisms → Bacteria → Terrabacteria group674Open in IMG/M
3300004463|Ga0063356_102647205All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia771Open in IMG/M
3300004480|Ga0062592_101051363All Organisms → cellular organisms → Bacteria → Terrabacteria group749Open in IMG/M
3300005093|Ga0062594_102491026All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium568Open in IMG/M
3300005172|Ga0066683_10421120All Organisms → cellular organisms → Bacteria → Terrabacteria group823Open in IMG/M
3300005176|Ga0066679_10343293All Organisms → cellular organisms → Bacteria → Terrabacteria group975Open in IMG/M
3300005181|Ga0066678_10636340All Organisms → cellular organisms → Bacteria710Open in IMG/M
3300005184|Ga0066671_10696646All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium657Open in IMG/M
3300005294|Ga0065705_11012297Not Available544Open in IMG/M
3300005329|Ga0070683_100418692All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1278Open in IMG/M
3300005330|Ga0070690_100511857All Organisms → cellular organisms → Bacteria → Terrabacteria group900Open in IMG/M
3300005330|Ga0070690_100604653All Organisms → cellular organisms → Bacteria → Terrabacteria group833Open in IMG/M
3300005336|Ga0070680_101344234All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium618Open in IMG/M
3300005341|Ga0070691_10270898All Organisms → cellular organisms → Bacteria → Terrabacteria group917Open in IMG/M
3300005526|Ga0073909_10650584All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium524Open in IMG/M
3300005556|Ga0066707_10539473All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium754Open in IMG/M
3300005560|Ga0066670_10368016All Organisms → cellular organisms → Bacteria → Terrabacteria group877Open in IMG/M
3300005566|Ga0066693_10225359Not Available737Open in IMG/M
3300005566|Ga0066693_10313765All Organisms → cellular organisms → Bacteria → Terrabacteria group628Open in IMG/M
3300005569|Ga0066705_10511412Not Available751Open in IMG/M
3300005614|Ga0068856_100651792All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1073Open in IMG/M
3300005618|Ga0068864_101592856Not Available657Open in IMG/M
3300005713|Ga0066905_100236698All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium1393Open in IMG/M
3300005719|Ga0068861_101669530All Organisms → cellular organisms → Bacteria → Terrabacteria group629Open in IMG/M
3300005764|Ga0066903_100549530All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1980Open in IMG/M
3300005764|Ga0066903_102828841All Organisms → cellular organisms → Bacteria → Terrabacteria group941Open in IMG/M
3300006034|Ga0066656_10806509All Organisms → cellular organisms → Bacteria → Terrabacteria group601Open in IMG/M
3300006046|Ga0066652_100923882All Organisms → cellular organisms → Bacteria → Terrabacteria group832Open in IMG/M
3300006046|Ga0066652_100975696All Organisms → cellular organisms → Bacteria → Terrabacteria group805Open in IMG/M
3300006048|Ga0075363_100996952Not Available516Open in IMG/M
3300006575|Ga0074053_11924101Not Available559Open in IMG/M
3300006806|Ga0079220_10517659All Organisms → cellular organisms → Bacteria → Terrabacteria group821Open in IMG/M
3300006806|Ga0079220_12125453All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium503Open in IMG/M
3300006852|Ga0075433_10102626All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2533Open in IMG/M
3300006954|Ga0079219_11229913Not Available652Open in IMG/M
3300009012|Ga0066710_100562844All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1726Open in IMG/M
3300009098|Ga0105245_10425644Not Available1331Open in IMG/M
3300009101|Ga0105247_10934787All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia672Open in IMG/M
3300009553|Ga0105249_12198859All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium624Open in IMG/M
3300010044|Ga0126310_10041962All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2486Open in IMG/M
3300010047|Ga0126382_11459779All Organisms → cellular organisms → Bacteria → Terrabacteria group627Open in IMG/M
3300010147|Ga0126319_1212339All Organisms → cellular organisms → Bacteria → Terrabacteria group628Open in IMG/M
3300010147|Ga0126319_1492756All Organisms → cellular organisms → Bacteria2784Open in IMG/M
3300010322|Ga0134084_10454432Not Available511Open in IMG/M
3300010326|Ga0134065_10318772All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium601Open in IMG/M
3300010336|Ga0134071_10557238Not Available596Open in IMG/M
3300010362|Ga0126377_10116472All Organisms → cellular organisms → Bacteria → Terrabacteria group2462Open in IMG/M
3300010364|Ga0134066_10219005All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium642Open in IMG/M
3300010366|Ga0126379_10564935All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1219Open in IMG/M
3300010366|Ga0126379_12583298All Organisms → cellular organisms → Bacteria → Terrabacteria group606Open in IMG/M
3300010398|Ga0126383_10417683Not Available1382Open in IMG/M
3300010999|Ga0138505_100050537Not Available599Open in IMG/M
3300011106|Ga0151489_1166641Not Available694Open in IMG/M
3300011119|Ga0105246_10236500Not Available1441Open in IMG/M
3300012014|Ga0120159_1117393All Organisms → cellular organisms → Bacteria → Terrabacteria group749Open in IMG/M
3300012200|Ga0137382_10818232All Organisms → cellular organisms → Bacteria → Terrabacteria group671Open in IMG/M
3300012200|Ga0137382_11077225All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium575Open in IMG/M
3300012200|Ga0137382_11083601Not Available573Open in IMG/M
3300012285|Ga0137370_10847834Not Available566Open in IMG/M
3300012349|Ga0137387_10628462Not Available778Open in IMG/M
3300012354|Ga0137366_11004304All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium580Open in IMG/M
3300012378|Ga0134025_1183911All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium644Open in IMG/M
3300012390|Ga0134054_1202903All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1656Open in IMG/M
3300012400|Ga0134048_1115334Not Available587Open in IMG/M
3300012409|Ga0134045_1275874Not Available511Open in IMG/M
3300012506|Ga0157324_1027446Not Available623Open in IMG/M
3300012896|Ga0157303_10121828All Organisms → cellular organisms → Bacteria → Terrabacteria group662Open in IMG/M
3300012907|Ga0157283_10364979Not Available525Open in IMG/M
3300012951|Ga0164300_11065554All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium525Open in IMG/M
3300012957|Ga0164303_11108820All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium572Open in IMG/M
3300012957|Ga0164303_11448852All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium516Open in IMG/M
3300012971|Ga0126369_10375683All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → unclassified Mycobacterium → Mycobacterium sp.1452Open in IMG/M
3300012972|Ga0134077_10577773All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium506Open in IMG/M
3300012977|Ga0134087_10176331All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium945Open in IMG/M
3300012984|Ga0164309_10437046All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium986Open in IMG/M
3300012986|Ga0164304_11059444Not Available646Open in IMG/M
3300014497|Ga0182008_10480146All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium680Open in IMG/M
3300014968|Ga0157379_10663256All Organisms → cellular organisms → Bacteria → Terrabacteria group977Open in IMG/M
3300015359|Ga0134085_10485066All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium564Open in IMG/M
3300015372|Ga0132256_100816258All Organisms → cellular organisms → Bacteria → Terrabacteria group1049Open in IMG/M
3300015374|Ga0132255_103022796Not Available718Open in IMG/M
3300018031|Ga0184634_10450351Not Available581Open in IMG/M
3300018073|Ga0184624_10234504All Organisms → cellular organisms → Bacteria → Terrabacteria group822Open in IMG/M
3300018076|Ga0184609_10517509Not Available542Open in IMG/M
3300018433|Ga0066667_10222935All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium1406Open in IMG/M
3300018482|Ga0066669_12009869All Organisms → cellular organisms → Bacteria → Terrabacteria group542Open in IMG/M
3300019362|Ga0173479_10020601All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1873Open in IMG/M
3300019887|Ga0193729_1265369All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium532Open in IMG/M
3300020004|Ga0193755_1206160All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium557Open in IMG/M
3300021344|Ga0193719_10237481All Organisms → cellular organisms → Bacteria → Terrabacteria group773Open in IMG/M
3300021951|Ga0222624_1120074All Organisms → cellular organisms → Bacteria → Terrabacteria group833Open in IMG/M
3300022756|Ga0222622_10117641All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1664Open in IMG/M
3300022756|Ga0222622_11258801Not Available544Open in IMG/M
3300024178|Ga0247694_1028146Not Available630Open in IMG/M
3300024232|Ga0247664_1115214All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium625Open in IMG/M
3300024251|Ga0247679_1022519All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1069Open in IMG/M
3300025911|Ga0207654_11003763Not Available607Open in IMG/M
3300025920|Ga0207649_10566219All Organisms → cellular organisms → Bacteria → Terrabacteria group871Open in IMG/M
3300025928|Ga0207700_11650421All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium566Open in IMG/M
3300025929|Ga0207664_10645388All Organisms → cellular organisms → Bacteria → Terrabacteria group951Open in IMG/M
3300025960|Ga0207651_11011060All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia743Open in IMG/M
3300025960|Ga0207651_11291355All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium656Open in IMG/M
3300025972|Ga0207668_10563291All Organisms → cellular organisms → Bacteria → Terrabacteria group988Open in IMG/M
3300026023|Ga0207677_11110161All Organisms → cellular organisms → Bacteria → Terrabacteria group721Open in IMG/M
3300026078|Ga0207702_11307468All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium719Open in IMG/M
3300026088|Ga0207641_11310221All Organisms → cellular organisms → Bacteria → Terrabacteria group725Open in IMG/M
3300026300|Ga0209027_1288029All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium529Open in IMG/M
3300026301|Ga0209238_1187862Not Available606Open in IMG/M
3300026552|Ga0209577_10347692All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1092Open in IMG/M
3300026806|Ga0207546_102643Not Available621Open in IMG/M
3300027485|Ga0207635_1000337All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD00821511Open in IMG/M
3300027775|Ga0209177_10049741All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1183Open in IMG/M
3300028716|Ga0307311_10098672All Organisms → cellular organisms → Bacteria → Terrabacteria group814Open in IMG/M
3300028719|Ga0307301_10156482All Organisms → cellular organisms → Bacteria → Terrabacteria group734Open in IMG/M
3300028719|Ga0307301_10158013All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia731Open in IMG/M
3300028771|Ga0307320_10110556All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1049Open in IMG/M
3300028796|Ga0307287_10154509All Organisms → cellular organisms → Bacteria → Terrabacteria group872Open in IMG/M
3300028819|Ga0307296_10171770All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1174Open in IMG/M
3300028828|Ga0307312_10406312All Organisms → cellular organisms → Bacteria → Terrabacteria group895Open in IMG/M
3300028828|Ga0307312_10753095Not Available645Open in IMG/M
3300028875|Ga0307289_10078667All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1335Open in IMG/M
3300028880|Ga0307300_10359222Not Available504Open in IMG/M
3300028889|Ga0247827_10324852All Organisms → cellular organisms → Bacteria → Terrabacteria group908Open in IMG/M
3300031058|Ga0308189_10506079All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium521Open in IMG/M
3300031198|Ga0307500_10165959All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium640Open in IMG/M
3300031421|Ga0308194_10080524All Organisms → cellular organisms → Bacteria → Terrabacteria group900Open in IMG/M
3300031716|Ga0310813_12193607Not Available523Open in IMG/M
3300031938|Ga0308175_102427068All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium587Open in IMG/M
3300032075|Ga0310890_10515106All Organisms → cellular organisms → Bacteria → Terrabacteria group912Open in IMG/M
3300032205|Ga0307472_101263434All Organisms → cellular organisms → Bacteria → Terrabacteria group709Open in IMG/M
3300032783|Ga0335079_10739186All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1024Open in IMG/M
3300033412|Ga0310810_10476205Not Available1253Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil18.44%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil13.48%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil7.80%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.26%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.26%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil4.26%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.55%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.84%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.13%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.13%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.13%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.13%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.13%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.13%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil1.42%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.42%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.42%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.42%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.42%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.42%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.42%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.42%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.71%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.71%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.71%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.71%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.71%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.71%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.71%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.71%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.71%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.71%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.71%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.71%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.71%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.71%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.71%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.71%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.71%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.71%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.71%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.71%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.71%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.71%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459015Litter degradation PV4EngineeredOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300000953Soil microbial communities from Great Prairies - Kansas Corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006048Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3Host-AssociatedOpen in IMG/M
3300006575Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010147Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010364Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010999Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t3i015EnvironmentalOpen in IMG/M
3300011106Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012014Permafrost microbial communities from Nunavut, Canada - A10_80cm_6MEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012378Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_16_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012390Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012400Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012409Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012506Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610Host-AssociatedOpen in IMG/M
3300012896Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2EnvironmentalOpen in IMG/M
3300012907Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012972Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300019887Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2EnvironmentalOpen in IMG/M
3300020004Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2EnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300021951Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300024178Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK35EnvironmentalOpen in IMG/M
3300024232Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05EnvironmentalOpen in IMG/M
3300024251Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026300Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300026806Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06A4a-10 (SPAdes)EnvironmentalOpen in IMG/M
3300027485Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05A3w-11 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300028716Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198EnvironmentalOpen in IMG/M
3300028719Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300028880Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181EnvironmentalOpen in IMG/M
3300028889Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2EnvironmentalOpen in IMG/M
3300031058Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031198Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_SEnvironmentalOpen in IMG/M
3300031421Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
4PV_012937402170459015Switchgrass, Maize And Mischanthus LitterVLTPAVNKRWATVEKQIMQQAPWAPWSNRVFPEFFTKKMGCIHIQRLYGVDLMRLCRK
JGI10214J12806_1107569613300000891SoilKVEKQIMQQAPWAPWSNRVFPEFFGKNMSCIHTQLLYGIDLARLCKK*
JGI11615J12901_1008110913300000953SoilIMQQAPWAPWSNRVFPEFFSKNMSCIHTQLLYGIDLARLCKK*
JGI10216J12902_10460876713300000956SoilQAPWAPWSNRVFPEFFSKKMGCIHIQRLYGIDLARLCRK*
JGI10216J12902_10726942323300000956SoilKQIMQQAPWAPWSNRVWPEFFSKKIGCIHLQPLFGVDLLRLCKK*
JGI10216J12902_11230121623300000956SoilWAPWSNRVFPEFFTKKIGCIHNQRLYGIDWMRLCRK*
JGI10216J12902_12376176523300000956SoilARWAKVEKQIMQQAPWAPWSNRVFPEFFNKNMSCIHVQLLYGIDLARLCKK*
C688J35102_11863074623300002568SoilRWAKVEKEIMSQAPWAPWSNRVFPEFFSKKMGCIHIQRLYGIDLARLCKK*
Ga0062589_10057630113300004156SoilQIMQQAPWAPWSNRVFPEFFSKKMGCIHIQRLYGIDLARLCRK*
Ga0062590_10151308713300004157SoilVEKQIMQQAPWAPWSNRVFPEFFSKKMGCIHIQRLYGIDLARLCRK*
Ga0063356_10264720513300004463Arabidopsis Thaliana RhizosphereQIMQQAPWAPWSNRVFPEFFSKKMGCIHIQRLYGVDLMRLCRK*
Ga0062592_10105136313300004480SoilWASVEQTIMKDAPWAPWSNRVFPEFFTKKMGCIHVQLLYGIDLARLCKK*
Ga0062594_10249102613300005093SoilAVNARWAKVEKQIMQQAPWAPWSNRVFPEFFNKNMSCIHVQLLYGIDLARLCKK*
Ga0066683_1042112013300005172SoilWAKVEKQIMQQAPWAPWSNRVFPEFFKKKIGCIHTQRLYGIDWMRLCRK*
Ga0066679_1034329313300005176SoilALTPAVNARWANVEKLIMQQAPWVPWSNRTFPEFFSKQMGCIGIQRLYGVDFMRLCRK*
Ga0066678_1063634013300005181SoilPAVNSKWAKVEKQIMRQAPWAPWSNRVFPEFFKKKIGCIHTQRLYGIDWMRLCRK*
Ga0066671_1069664623300005184SoilPPALTPAVNKRWANVEKLIMQQAPWAPWSNRTFPEFFSKNMGCISIQRLYGIDFMKACRK
Ga0065705_1101229713300005294Switchgrass RhizospherePILTPAVNARWAKVEKQIMQQAPWAPWSNRVFPEFFGKNMSCIHTQLLYGIDLARLCKK*
Ga0070683_10041869213300005329Corn RhizosphereRWAKVEKQIMQQAPWAPWSNRVFPEFFSKKMGCIHTQRLYGIDALRLCKK*
Ga0070690_10051185713300005330Switchgrass RhizosphereVEKQIMQQAPWAPWSNRVFPEFFSKKIGCIHVQRLYGIDALRLCRK*
Ga0070690_10060465313300005330Switchgrass RhizosphereQAPWAPWSNRVFPEFFSKKMGCIHTQRLYGIDALRLCKK*
Ga0070680_10134423413300005336Corn RhizosphereWATVEKQIMAQAPWAPWSNRVFPEYFSKKMGCIHVQRLYGIDALRLCRK*
Ga0070691_1027089813300005341Corn, Switchgrass And Miscanthus RhizosphereEKQIMAQAPWAPWSNRVFPEYFSKKMGCIHVQRLYGIDLARLCKK*
Ga0073909_1065058423300005526Surface SoilQAPWAPWSNRVFPEFFSKKMGCIHVQRLYGIDALRLCKK*
Ga0066707_1053947323300005556SoilEKQIMQQAPWAPWSNRVFPEFFTKQIGCIHIQRLYGIDLARLCRK*
Ga0066670_1036801613300005560SoilWAKVEKQIMMQAPWAPWSNRVFPEFFNKSIPAKCIHVQRLYGIDLARLCK*
Ga0066693_1022535923300005566SoilVEKQIMQQAPWAPWSNRVFPEFFTKKIGCIHTQRLYGIDWMRLCRK*
Ga0066693_1031376523300005566SoilNARWAKVEKQIMQQAPWAPWSNRVFPEFFNKSVPAKCIHVQRLYGIDLARLCK*
Ga0066705_1051141223300005569SoilPWSNRVFPEFFTKQIGCIHIQRLYGIDLARLCRK*
Ga0068856_10065179213300005614Corn RhizospherePWSNRVFPEFFSKKIGCIHVQRLYGIDALRLCRK*
Ga0068864_10159285623300005618Switchgrass RhizospherePWSNRVFPEFFSKKMGCIHTQRLYGIDALRLCKK*
Ga0066905_10023669813300005713Tropical Forest SoilVEKQIMQQAPWAPWSNRVFPEYFTKQIGCIHIQRLYGIDLARLCRK*
Ga0068861_10166953013300005719Switchgrass RhizospherePWSNRVFPEFFSKKMGCIHTQRLYGIDALRLCRK*
Ga0066903_10054953013300005764Tropical Forest SoilVEKQIMQQAPWAPWSNRVFPEFFGKNMSCIHVQLLYGIDLARLCKK*
Ga0066903_10282884123300005764Tropical Forest SoilPWSNRVFPEFFSRNMSCIHIQLLYGIDLARLCKK*
Ga0066656_1080650923300006034SoilQAPWAPWSNRVFPEFFKKKIGCIHTQRLYGIDWMRLCRK*
Ga0066652_10092388213300006046SoilRWAKVEKQIMQQAPWAPWSNRVFPEFFNKSIPAKCIHVQRLYGIDLARLCK*
Ga0066652_10097569623300006046SoilPVLTPAVNARWAKVEKQIMQQAPWAPWSNRVFPEFFTKKIGCIHTQRLYGIDWMRLCRK*
Ga0075363_10099695213300006048Populus EndosphereKQIMQQAPWAPWSNRVFPEFFSKKMGCIHIQRLYGVDLMRLCRK*
Ga0074053_1192410123300006575SoilPWSNRVFPEFFGKNMSCIHTQLLYGIDLARLCKK*
Ga0079220_1051765923300006806Agricultural SoilWAPWSNRVFPEYFSKKMGCIHVQRLYGIDLARLCKK*
Ga0079220_1212545313300006806Agricultural SoilPWAPWSNRVFPEFFSKKIGCIHIQRLYGIDLARLCRK*
Ga0075433_1010262613300006852Populus RhizosphereLTPAVNKRWATVEKQIMQQAPWAPWSNRVFPEFFSKKMGCIHIQRLYGVDLMRLCRK*
Ga0079219_1122991313300006954Agricultural SoilKSQVLTPAVNARWAKVEKEIMAQAPWAPWSNRVFPEFFSKKMGCIHVQRLYGIDLARLCKK*
Ga0066710_10056284433300009012Grasslands SoilPWAPWSNRVFPEFFSKSMGCIHTQRLYGIDLARLCKH
Ga0105245_1042564413300009098Miscanthus RhizosphereQVLTPAVNKKWATVEKQIMQQAPWAPWSNRVFPEYFSKKMGCIHVQRLYGIDALRLCRK*
Ga0105247_1093478723300009101Switchgrass RhizosphereAPWAPWSNRVFPEYFSKKMGCIHVQRLYGIDALRLCRK*
Ga0105249_1219885923300009553Switchgrass RhizosphereMQQAPWAPWSNRVFPEFFTKKMGCIHVQRLYGIDLMRLCKK*
Ga0126310_1004196213300010044Serpentine SoilVEKQIMQQAPWAPWSNRVFPEFFSKKMGCIHVQRLYGIDALRLCRK*
Ga0126382_1145977923300010047Tropical Forest SoilLTPAVNARWAKVEKQIMQQAPWAPWSNRVFPEFFSKSMSCIHTQALYGIDFARLCKK*
Ga0126319_121233923300010147SoilWAAVEKQIMQQAPWAPWSNRVFPEFFNKSIPAKCIHVQRLYGIDLARLCK*
Ga0126319_149275613300010147SoilAPWAPWSNRVFPEFFSKKMGCIHVQRLYGIDLARLCRK*
Ga0134084_1045443213300010322Grasslands SoilNAKWAKVEKQIMQQAPWAPWSNRVFPEFFKKKIGCIHTQRLYGIDWMRLCRK*
Ga0134065_1031877223300010326Grasslands SoilVNKKWATVEKKIMQQAPWAPWSNRVFPEFFTKQIGCIHIQRLYGIDLARLCRK*
Ga0134071_1055723823300010336Grasslands SoilTPAVNARWTKVEKQIMQKAPWAPWSNRVFPEFFSRNMSCIHIQLLYGIDLARLCKK*
Ga0126377_1011647213300010362Tropical Forest SoilPILTPAVNARWAKTEKQIMQQAPWAPWSNRVFPEFFSRNMSCIHIQLLYGIDLARLCKK*
Ga0134066_1021900523300010364Grasslands SoilMMQAPWAPWSNRVFPEFFNKSIPAKCIHVQRLYGIDLARLCK*
Ga0126379_1056493513300010366Tropical Forest SoilWATVEKQIMQQAPWAPWSNRVFPEFFSKKMGCIHIQRLYGVDLMRLCRK*
Ga0126379_1258329823300010366Tropical Forest SoilEKQIMANAPWAPWSNRVFPEFFSKKIGCIHVQRLYGIDFSRLCRK*
Ga0126383_1041768313300010398Tropical Forest SoilIMQQAPWAPWSNRVFPEFFSRSMGCIHIQLLYGIDLARLCKK*
Ga0138505_10005053713300010999SoilTTPATAPWAPWSNRVFPEYFTKKMGCIHIQLLYGIDWTRLCRK*
Ga0151489_116664113300011106SoilMAQAPWAPWSNRVFPEYFSKKMGCIHVQRLYGIDALRLCRK*
Ga0105246_1023650013300011119Miscanthus RhizosphereQAPWAPWSNRVFPEFFSKKIGCIHVQRLYGIDALRLCRK*
Ga0120159_111739323300012014PermafrostLKTEPNLTPAVNARWTKVEKEIMQQAPWAPWSNRVFPEFFTKQMGCIHMQALYGFDLARVCRK*
Ga0137382_1081823223300012200Vadose Zone SoilWSNRVFPEFFNKSIPAKCIHVQRLYGIDLARLCKK*
Ga0137382_1107722513300012200Vadose Zone SoilEKSIMQDAPWAPWSNRVFPEYFTKKMGCIHIQLLYGIDWTRLCRK*
Ga0137382_1108360113300012200Vadose Zone SoilRWAKVEKQIMQQAPWAPWSNRVFPEFFTHQMGCIHMQALYGFDLSRVCRK*
Ga0137370_1084783423300012285Vadose Zone SoilQAPWAPWSNRVFPEFFTHQMGCIHMQALYGFDWARVCRK*
Ga0137387_1062846213300012349Vadose Zone SoilQAPWAPWSNRVFPEFFTKQIGCIHTQRLYGIDFARLCRK*
Ga0137366_1100430423300012354Vadose Zone SoilEKQIMQQAPWAPWSNRVFPEYFAKSMGCIHTQRLYGIDWTRLCKK*
Ga0134025_118391123300012378Grasslands SoilVLTPAVNARWAKVEKQIMQQAPWAPWSNRVFPEFFSKKMGCIHNQRLFGIDLMRLCKK*
Ga0134054_120290323300012390Grasslands SoilVNARWTKVEKQIMQKAPWAPWSNRVFPEFFTKQMGCIHMQALYGFDLSRVCRK*
Ga0134048_111533413300012400Grasslands SoilQAPWAPWSNRVFPEFFTKKMGCIHVQRLYGIDLARLCKK*
Ga0134045_127587423300012409Grasslands SoilPAVNARWAKVEKQIMQQAPWAPWSNRVFPEFFGKNMSCIHTQLLYGIDLARLCKK*
Ga0157324_102744623300012506Arabidopsis RhizospherePAVNARWASVEQTIMKDAPWAPWSNRVFPEFFSKKMGCIHVQLLYGIDLTRLCKK*
Ga0157303_1012182813300012896SoilIMAQAPWAPWSNRVFPEYFSKKMGCIHVQRLYGIDALRLCKK*
Ga0157283_1036497913300012907SoilPWSNRVFPEFFSKKMGCIHIQRLYGIDLARLCRK*
Ga0164300_1106555413300012951SoilMQQAPWAPWSNRVFPEFFSKKIGCIHVQRLYGIDALRLCRK*
Ga0164303_1110882013300012957SoilQAPWAPWSNRVFPEYFSKKMGCIHVQRLYGIDALRLCKK*
Ga0164303_1144885213300012957SoilKSQVLTPAVNARWAKVEKEIMSAAPWAPWSNRVMPEFFSKKMGCIHIQRLYGIDLARLCRK*
Ga0126369_1037568333300012971Tropical Forest SoilLTPAVNARWAKTEKQIMQQAPWAPWSNRVFPEFFSKNMSCIHIQLLYGIDLARLCKK*
Ga0134077_1057777313300012972Grasslands SoilPAVNAKWATVEKQIMQQAPWAPWSNRVFPEFFTKQIGCIHIQRLYGIDLARLCRK*
Ga0134087_1017633113300012977Grasslands SoilAPWAPWSNRVFPEFFSKSMGCIHIQRLYGIDLARLCKK*
Ga0164309_1043704623300012984SoilVEKQIMAQAPWAPWSNRVFPEFFSKKMGCIHVQRLYGIDLARLCRK*
Ga0164304_1105944423300012986SoilVNARWAKVEKQIMQQAPWAPWSNRVFPEFFSKNMSCIHVQLLYGIDLARLCKK*
Ga0182008_1048014613300014497RhizospherePAVNARWAKVEKEIMAQAPWAPWSNRVFPEYFSKKMGCIHVQRLYGIDLARLCRK*
Ga0157379_1066325623300014968Switchgrass RhizospherePAVNQRWASVEKSIMQDAPWAPWSNRVFPEFFTKKMGCIHTQRLYGIDALRLCKK*
Ga0134085_1048506623300015359Grasslands SoilAPWAPWSNRVFPEFFNRAIPKKCIHVQRLYGIDLARLCK*
Ga0132256_10081625823300015372Arabidopsis RhizosphereVNARWATVEKQIMAQAPWAPWSNRVFPEYFSKKMGCIHVQRLYGIDLARLCKK*
Ga0132255_10302279613300015374Arabidopsis RhizosphereVNKRWATVEKQIMQQAPWAPWSNRVFPEFFTKKMGCIHIQRLYGVDLARLCRK*
Ga0184634_1045035113300018031Groundwater SedimentKKAPVLTPAVNQRWASVEKSIMQDAPWAPWSNRVFPEFFTKKMGCIHIQLLYGIDLARLCKK
Ga0184624_1023450413300018073Groundwater SedimentRWAKVEKQIMQQAPWAPWSNRVFPEFFTKKMGCIHTQRLYGIDALRLCRK
Ga0184609_1051750913300018076Groundwater SedimentQQAPWAPWSNRVFPEFFGKNMSCIHTQLLYGIDLARLCKK
Ga0066667_1022293533300018433Grasslands SoilQAPWAPWSNRVFPEFFNKSIPAKCIHVQRLYGIDLARLCK
Ga0066669_1200986913300018482Grasslands SoilWAKVEKQIMMQAPWAPWSNRVFPEFFNKSIPAKCIHVQRLYGIDLARLCK
Ga0173479_1002060133300019362SoilMQQAPWAPWSNRVFPEFFSKKMGCIHIQRLYGVDLMRLCRK
Ga0193729_126536923300019887SoilATVEKQIMQQAPWAPWSNRVFPEFFTKQIGCIHIQRLYGIDLARLCRK
Ga0193755_120616023300020004SoilRWATVEKQIMSQAPWAPWSNRVFPEFFSKKMGCIHVQRLYGIDLARLCRK
Ga0193719_1023748123300021344SoilAKVEKQIMQQAPWAPWSNRVFPEFFGKNMSCIHTQLLYGIDLARLCKK
Ga0222624_112007413300021951Groundwater SedimentKQIMQQAPWAPWSNRVFPEFFGKNMSCIHTQLLYGIDLARLCKK
Ga0222622_1011764133300022756Groundwater SedimentPWAPWSNRVFPEYFSKKMGCIHVQRLYGIDALRLCRK
Ga0222622_1125880123300022756Groundwater SedimentQQAPWAPWSNRVFPEFFNKSIPAKCIHVQRLYGIDLARLCK
Ga0247694_102814613300024178SoilNKRWATVEKQIMQQAPWAPWSNRVFPEFFSKKIGCIHIQRLYGIDALRLCRK
Ga0247664_111521423300024232SoilIMQNAPWAPWSNRVFPEFFSKKIGCIHVQRLYGIDLARLCKK
Ga0247679_102251923300024251SoilPVNKRWATVEKQIMQQAPWAPWSNRVFPEFFSKKIGCIHIQRLYGIDALRLCRK
Ga0207654_1100376313300025911Corn RhizosphereWAPWSNRVFPEFFSKKMGCIHVQRLYGIDLARLCKK
Ga0207649_1056621913300025920Corn RhizosphereVEKQIMQQAPWAPWSNRVFPEFFSKNMSCIHVQLLYGIDLARLCKK
Ga0207700_1165042123300025928Corn, Switchgrass And Miscanthus RhizosphereAPWSNRVFPEFFSKKIGCIHVQRLYGIDALRLCRK
Ga0207664_1064538813300025929Agricultural SoilWATVEKQIMQQAPWAPWSNRVFPEFFSKKIGCIHIQRLYGIDALRLCRK
Ga0207651_1101106023300025960Switchgrass RhizosphereWAPWSNRVFPEFFSKKMGCIHTQRLYGIDALRLCKK
Ga0207651_1129135513300025960Switchgrass RhizosphereWATVEKQIMAQAPWAPWSNRVFPEYFSKKMGCIHVQRLYGIDALRLCRK
Ga0207668_1056329113300025972Switchgrass RhizosphereVEKQVMQAAPWAPWSNRVFPEFFSKKMGCIHVQRLYGIDLARLCKK
Ga0207677_1111016123300026023Miscanthus RhizospherePWAPWSNRVFPEYFSKKMGCIHVQRLYGIDLARLCKK
Ga0207702_1130746813300026078Corn RhizosphereAPWAPWSNRVFPEFFSKKIGCIHVQRLYGIDALRLCRK
Ga0207641_1131022123300026088Switchgrass RhizosphereQIMQQAPWAPWSNRVFPEFFSKKMGCIHTQRLYGIDALRLCKK
Ga0209027_128802913300026300Grasslands SoilPAVNKRWANVEKLIMQQAPWAPWSNRTFPEFFSKNMGCISIQRLYGIDFMKACRK
Ga0209238_118786223300026301Grasslands SoilPWSNRVFPEFFNKSIPAKCIHVQRLYGIDLARLCK
Ga0209577_1034769213300026552SoilKEIVQNAPWAPWSNRVFPEFFSKSMGCIHVQRLYGIDLSRLCKH
Ga0207546_10264323300026806SoilVNKRWATVEKQIMQQAPWAPWSNRVFPEFFSKKMGCIHIQRLYGVDLMRLCRK
Ga0207635_100033733300027485SoilPWAPWSNRVFPEFFSKKMGCIHIQRLYGVDLMRLCRK
Ga0209177_1004974113300027775Agricultural SoilKSQVLTPAVNARWAKVEKEIMAQAPWAPWSNRVFPEFFSKKMGCIHVQRLYGIDLARLCK
Ga0307311_1009867223300028716SoilPVLTPAVNQRWASVEKSIMQDAPWAPWSNRVFPEFFTKKMGCIHIQLLYGIDLARLCKK
Ga0307301_1015648223300028719SoilWAPWSNRVFPEFFTKKMGCIHIQLLYGIDLARLCKK
Ga0307301_1015801323300028719SoilEKQIMQQAPWAPWSNRVFPEFFSKKMGCIHTQRLYGIDAIRLCRK
Ga0307320_1011055613300028771SoilWAKIEKQIMQQAPWAPWSNRVWPEFFSKKMSCIHVQPLFGVDWLRLCKK
Ga0307287_1015450923300028796SoilLTPAVNARWAKVEKQIMQQAPWAPWSNRVFPEFFGKNMSCIHTQLLYGIDLARLCKK
Ga0307296_1017177023300028819SoilVEKQIMQQAPWAPWSNRVFPEFFSKKMGCIHTQRLYGIDAIRLCRK
Ga0307312_1040631223300028828SoilTPAVNLRWTKVEKEIMQQAPWAPWSNRVFPEYFTKQMGCIHMQALYGFDLSRVCRK
Ga0307312_1075309513300028828SoilVEKQIMQQAPWAPWSNRVFPEFFTKQMGCIHMQALYGFDLARVCRK
Ga0307289_1007866723300028875SoilMQAAPWAPWSNRVFPEFFSKKMGCIHVQRLYGIDLA
Ga0307300_1035922213300028880SoilKQIMQQAPWAPWSNRVFPEFFSKKMGCIHTQRLYGIDAIRLCRK
Ga0247827_1032485213300028889SoilQAPWAPWSNRVFPEFFSKSMSCIHTQLLYGIDLARLCKK
Ga0308189_1050607923300031058SoilVNDRWATVEKQIMQQAPWAPWSNRVFPEFFSKKMGCIHTQRLYGIDAIRLCRK
Ga0307500_1016595913300031198SoilRWATVEKQIMAQAPWAPWSNRVFPEFFSKKMGCIHVQRLYGIDALRLCKK
Ga0308194_1008052423300031421SoilWATVEKQIMQQAPWAPWSNRVFPEFFSKKMGCIHTQRLYGIDAIRLCRK
Ga0310813_1219360713300031716SoilPVLTPAVNAKWATVEKQIMQQAPWAPWSNRVFPEFFTKQIGCIHIQRLYGIDLARLCRK
Ga0308175_10242706823300031938SoilQIMAQAPWAPWSNRVFPEFFSKKMGCIHVQRLYGIDTLRLCKK
Ga0310890_1051510623300032075SoilQVLTPPVNKRWATVEKQIMQQAPWAPWSNRVFPEFFSKKIGCIHIQRLYGIDALRLCRK
Ga0307472_10126343423300032205Hardwood Forest SoilQVLTPAVNKRWATVEKQIMQQAPWAPWSNRVFPEFFNKSIPAKCIHVQRLYGIDLARLCK
Ga0335079_1073918623300032783SoilKVEKQIMQQAPWAPWSNRVFPEFFNKSIPLKCIHVQRLYGIDLARLCK
Ga0310810_1047620513300033412SoilWAPWSNRVFPEFFSKSMGCIHVQRLYGIDALRLCKK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.