NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F053531

Metagenome Family F053531

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F053531
Family Type Metagenome
Number of Sequences 141
Average Sequence Length 48 residues
Representative Sequence VFRQTSRGTAVILTTGICDRATATLSLDDLAKVRAMIQEAKSRLDEIR
Number of Associated Samples 106
Number of Associated Scaffolds 141

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.71 %
% of genes near scaffold ends (potentially truncated) 97.87 %
% of genes from short scaffolds (< 2000 bps) 88.65 %
Associated GOLD sequencing projects 94
AlphaFold2 3D model prediction Yes
3D model pTM-score0.63

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (91.489 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere
(14.184 % of family members)
Environment Ontology (ENVO) Unclassified
(50.355 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(63.830 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 27.63%    β-sheet: 13.16%    Coil/Unstructured: 59.21%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.63
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 141 Family Scaffolds
PF10569Obsolete Pfam Family 9.93
PF07678TED_complement 7.09
PF01476LysM 1.42
PF13365Trypsin_2 1.42
PF13614AAA_31 0.71
PF02119FlgI 0.71
PF10707YrbL-PhoP_reg 0.71
PF04909Amidohydro_2 0.71
PF07687M20_dimer 0.71
PF01230HIT 0.71

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 141 Family Scaffolds
COG1706Flagellar basal body P-ring protein FlgICell motility [N] 0.71

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms91.49 %
UnclassifiedrootN/A8.51 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000891|JGI10214J12806_12748561All Organisms → cellular organisms → Bacteria → Acidobacteria612Open in IMG/M
3300000956|JGI10216J12902_124432060All Organisms → cellular organisms → Bacteria → Acidobacteria613Open in IMG/M
3300003999|Ga0055469_10266151Not Available549Open in IMG/M
3300004114|Ga0062593_101139535All Organisms → cellular organisms → Bacteria → Acidobacteria813Open in IMG/M
3300004114|Ga0062593_102411141All Organisms → cellular organisms → Bacteria → Acidobacteria594Open in IMG/M
3300004157|Ga0062590_102599164All Organisms → cellular organisms → Bacteria → Acidobacteria538Open in IMG/M
3300004643|Ga0062591_100830244All Organisms → cellular organisms → Bacteria → Acidobacteria857Open in IMG/M
3300005290|Ga0065712_10502746All Organisms → cellular organisms → Bacteria → Acidobacteria648Open in IMG/M
3300005331|Ga0070670_100121990All Organisms → cellular organisms → Bacteria → Acidobacteria2248Open in IMG/M
3300005331|Ga0070670_100763529All Organisms → cellular organisms → Bacteria → Acidobacteria872Open in IMG/M
3300005332|Ga0066388_106653209All Organisms → cellular organisms → Bacteria → Acidobacteria582Open in IMG/M
3300005343|Ga0070687_100102948All Organisms → cellular organisms → Bacteria1602Open in IMG/M
3300005365|Ga0070688_101328323All Organisms → cellular organisms → Bacteria → Acidobacteria581Open in IMG/M
3300005434|Ga0070709_10753999All Organisms → cellular organisms → Bacteria761Open in IMG/M
3300005441|Ga0070700_100029670Not Available3263Open in IMG/M
3300005518|Ga0070699_100510087All Organisms → cellular organisms → Bacteria → Acidobacteria1093Open in IMG/M
3300005546|Ga0070696_100673406All Organisms → cellular organisms → Bacteria → Acidobacteria841Open in IMG/M
3300005546|Ga0070696_100801668All Organisms → cellular organisms → Bacteria → Acidobacteria775Open in IMG/M
3300005546|Ga0070696_101180440All Organisms → cellular organisms → Bacteria → Acidobacteria646Open in IMG/M
3300005546|Ga0070696_101607107All Organisms → cellular organisms → Bacteria → Acidobacteria558Open in IMG/M
3300005547|Ga0070693_101162315All Organisms → cellular organisms → Bacteria → Acidobacteria591Open in IMG/M
3300005560|Ga0066670_10167524All Organisms → cellular organisms → Bacteria → Acidobacteria1298Open in IMG/M
3300005564|Ga0070664_100643893All Organisms → cellular organisms → Bacteria → Acidobacteria985Open in IMG/M
3300005577|Ga0068857_100672703All Organisms → cellular organisms → Bacteria → Acidobacteria982Open in IMG/M
3300005577|Ga0068857_100688059All Organisms → cellular organisms → Bacteria → Acidobacteria971Open in IMG/M
3300005577|Ga0068857_101060474All Organisms → cellular organisms → Bacteria → Acidobacteria782Open in IMG/M
3300005577|Ga0068857_101304405All Organisms → cellular organisms → Bacteria → Acidobacteria705Open in IMG/M
3300005577|Ga0068857_102033043All Organisms → cellular organisms → Bacteria → Acidobacteria564Open in IMG/M
3300005578|Ga0068854_101802658All Organisms → cellular organisms → Bacteria → Acidobacteria561Open in IMG/M
3300005615|Ga0070702_100902422Not Available692Open in IMG/M
3300005617|Ga0068859_100597789All Organisms → cellular organisms → Bacteria → Acidobacteria1196Open in IMG/M
3300005617|Ga0068859_100898433All Organisms → cellular organisms → Bacteria → Acidobacteria970Open in IMG/M
3300005617|Ga0068859_101093440All Organisms → cellular organisms → Bacteria → Acidobacteria877Open in IMG/M
3300005617|Ga0068859_101486897All Organisms → cellular organisms → Bacteria → Acidobacteria747Open in IMG/M
3300005618|Ga0068864_100781907All Organisms → cellular organisms → Bacteria937Open in IMG/M
3300005618|Ga0068864_101480861All Organisms → cellular organisms → Bacteria → Acidobacteria682Open in IMG/M
3300005618|Ga0068864_101602431All Organisms → cellular organisms → Bacteria → Acidobacteria655Open in IMG/M
3300005618|Ga0068864_101792998Not Available619Open in IMG/M
3300005719|Ga0068861_102303804Not Available540Open in IMG/M
3300005841|Ga0068863_100683113All Organisms → cellular organisms → Bacteria → Acidobacteria1020Open in IMG/M
3300005842|Ga0068858_101779746All Organisms → cellular organisms → Bacteria → Acidobacteria609Open in IMG/M
3300005843|Ga0068860_101672056All Organisms → cellular organisms → Bacteria → Acidobacteria658Open in IMG/M
3300005844|Ga0068862_100350431All Organisms → cellular organisms → Bacteria → Acidobacteria1370Open in IMG/M
3300005844|Ga0068862_101499688All Organisms → cellular organisms → Bacteria → Acidobacteria680Open in IMG/M
3300005844|Ga0068862_101879262All Organisms → cellular organisms → Bacteria → Acidobacteria609Open in IMG/M
3300006169|Ga0082029_1742038All Organisms → cellular organisms → Bacteria → Acidobacteria636Open in IMG/M
3300006755|Ga0079222_12428355All Organisms → cellular organisms → Bacteria → Acidobacteria525Open in IMG/M
3300006794|Ga0066658_10453765All Organisms → cellular organisms → Bacteria → Acidobacteria698Open in IMG/M
3300006806|Ga0079220_10903615All Organisms → cellular organisms → Bacteria → Acidobacteria686Open in IMG/M
3300006852|Ga0075433_10218793All Organisms → cellular organisms → Bacteria → Acidobacteria1692Open in IMG/M
3300006853|Ga0075420_101005207All Organisms → cellular organisms → Bacteria → Acidobacteria717Open in IMG/M
3300006871|Ga0075434_100390954All Organisms → cellular organisms → Bacteria → Acidobacteria1412Open in IMG/M
3300006904|Ga0075424_101172227All Organisms → cellular organisms → Bacteria → Acidobacteria818Open in IMG/M
3300006954|Ga0079219_10862905All Organisms → cellular organisms → Bacteria → Acidobacteria724Open in IMG/M
3300006969|Ga0075419_10243882All Organisms → cellular organisms → Bacteria → Acidobacteria1199Open in IMG/M
3300007004|Ga0079218_10424405All Organisms → cellular organisms → Bacteria → Acidobacteria1143Open in IMG/M
3300009093|Ga0105240_12718872All Organisms → cellular organisms → Bacteria → Acidobacteria510Open in IMG/M
3300009094|Ga0111539_11311864All Organisms → cellular organisms → Bacteria → Acidobacteria840Open in IMG/M
3300009098|Ga0105245_11271390All Organisms → cellular organisms → Bacteria → Acidobacteria785Open in IMG/M
3300009101|Ga0105247_10062844All Organisms → cellular organisms → Bacteria2304Open in IMG/M
3300009101|Ga0105247_11710169All Organisms → cellular organisms → Bacteria → Acidobacteria520Open in IMG/M
3300009147|Ga0114129_11589376All Organisms → cellular organisms → Bacteria → Acidobacteria801Open in IMG/M
3300009147|Ga0114129_11627405All Organisms → cellular organisms → Bacteria → Acidobacteria790Open in IMG/M
3300009148|Ga0105243_12222855All Organisms → cellular organisms → Bacteria → Acidobacteria585Open in IMG/M
3300009156|Ga0111538_10651347All Organisms → cellular organisms → Bacteria → Acidobacteria1335Open in IMG/M
3300009162|Ga0075423_11224859All Organisms → cellular organisms → Bacteria → Acidobacteria801Open in IMG/M
3300009162|Ga0075423_11340356All Organisms → cellular organisms → Bacteria → Acidobacteria765Open in IMG/M
3300009174|Ga0105241_10959174All Organisms → cellular organisms → Bacteria → Acidobacteria798Open in IMG/M
3300009174|Ga0105241_11247944All Organisms → cellular organisms → Bacteria → Acidobacteria706Open in IMG/M
3300009176|Ga0105242_10146782All Organisms → cellular organisms → Bacteria → Acidobacteria2053Open in IMG/M
3300009176|Ga0105242_11938383All Organisms → cellular organisms → Bacteria → Acidobacteria630Open in IMG/M
3300009176|Ga0105242_12763715All Organisms → cellular organisms → Bacteria → Acidobacteria541Open in IMG/M
3300009551|Ga0105238_10811153All Organisms → cellular organisms → Bacteria → Acidobacteria952Open in IMG/M
3300010038|Ga0126315_10665465Not Available677Open in IMG/M
3300010039|Ga0126309_11016273All Organisms → cellular organisms → Bacteria → Acidobacteria558Open in IMG/M
3300010043|Ga0126380_10635033All Organisms → cellular organisms → Bacteria847Open in IMG/M
3300010044|Ga0126310_10847338All Organisms → cellular organisms → Bacteria → Acidobacteria707Open in IMG/M
3300010044|Ga0126310_11414930All Organisms → cellular organisms → Bacteria → Acidobacteria567Open in IMG/M
3300010045|Ga0126311_10105726All Organisms → cellular organisms → Bacteria → Acidobacteria1940Open in IMG/M
3300010047|Ga0126382_10711797All Organisms → cellular organisms → Bacteria → Acidobacteria844Open in IMG/M
3300010373|Ga0134128_12252613All Organisms → cellular organisms → Bacteria → Acidobacteria600Open in IMG/M
3300010397|Ga0134124_10257907All Organisms → cellular organisms → Bacteria → Acidobacteria1607Open in IMG/M
3300010397|Ga0134124_10580897All Organisms → cellular organisms → Bacteria → Acidobacteria1095Open in IMG/M
3300010397|Ga0134124_10923131All Organisms → cellular organisms → Bacteria → Acidobacteria881Open in IMG/M
3300010397|Ga0134124_11454818All Organisms → cellular organisms → Bacteria → Acidobacteria712Open in IMG/M
3300010397|Ga0134124_12715392All Organisms → cellular organisms → Bacteria → Acidobacteria539Open in IMG/M
3300010399|Ga0134127_10374883All Organisms → cellular organisms → Bacteria → Acidobacteria1398Open in IMG/M
3300010400|Ga0134122_10099923All Organisms → cellular organisms → Bacteria → Acidobacteria2296Open in IMG/M
3300010401|Ga0134121_11545510All Organisms → cellular organisms → Bacteria → Acidobacteria681Open in IMG/M
3300010403|Ga0134123_10108865All Organisms → cellular organisms → Bacteria → Acidobacteria2222Open in IMG/M
3300010403|Ga0134123_10500562All Organisms → cellular organisms → Bacteria → Acidobacteria1143Open in IMG/M
3300010403|Ga0134123_12830308All Organisms → cellular organisms → Bacteria → Acidobacteria554Open in IMG/M
3300011119|Ga0105246_11103372All Organisms → cellular organisms → Bacteria → Acidobacteria725Open in IMG/M
3300012469|Ga0150984_102536330All Organisms → cellular organisms → Bacteria → Acidobacteria610Open in IMG/M
3300012899|Ga0157299_10295384All Organisms → cellular organisms → Bacteria → Acidobacteria534Open in IMG/M
3300012918|Ga0137396_10154485All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1673Open in IMG/M
3300012948|Ga0126375_10036997All Organisms → cellular organisms → Bacteria → Acidobacteria2484Open in IMG/M
3300012948|Ga0126375_12020761All Organisms → cellular organisms → Bacteria → Acidobacteria510Open in IMG/M
3300013100|Ga0157373_10012870Not Available6144Open in IMG/M
3300013306|Ga0163162_11479002All Organisms → cellular organisms → Bacteria → Acidobacteria773Open in IMG/M
3300013308|Ga0157375_11579627All Organisms → cellular organisms → Bacteria → Acidobacteria775Open in IMG/M
3300014326|Ga0157380_11741360All Organisms → cellular organisms → Bacteria → Acidobacteria681Open in IMG/M
3300014745|Ga0157377_10473236All Organisms → cellular organisms → Bacteria → Acidobacteria870Open in IMG/M
3300014968|Ga0157379_10033289All Organisms → cellular organisms → Bacteria4597Open in IMG/M
3300014968|Ga0157379_10621861All Organisms → cellular organisms → Bacteria → Acidobacteria1009Open in IMG/M
3300015372|Ga0132256_100426525Not Available1430Open in IMG/M
3300018081|Ga0184625_10116887All Organisms → cellular organisms → Bacteria → Acidobacteria1384Open in IMG/M
3300025735|Ga0207713_1188747All Organisms → cellular organisms → Bacteria → Acidobacteria639Open in IMG/M
3300025918|Ga0207662_11314583All Organisms → cellular organisms → Bacteria → Acidobacteria514Open in IMG/M
3300025923|Ga0207681_11165574All Organisms → cellular organisms → Bacteria → Acidobacteria647Open in IMG/M
3300025925|Ga0207650_10035828All Organisms → cellular organisms → Bacteria3606Open in IMG/M
3300025925|Ga0207650_10490067All Organisms → cellular organisms → Bacteria → Acidobacteria1026Open in IMG/M
3300025926|Ga0207659_11066757All Organisms → cellular organisms → Bacteria → Acidobacteria695Open in IMG/M
3300025931|Ga0207644_10900177All Organisms → cellular organisms → Bacteria → Acidobacteria742Open in IMG/M
3300025934|Ga0207686_10373046All Organisms → cellular organisms → Bacteria → Acidobacteria1080Open in IMG/M
3300025934|Ga0207686_11075992All Organisms → cellular organisms → Bacteria → Acidobacteria655Open in IMG/M
3300025938|Ga0207704_10269917All Organisms → cellular organisms → Bacteria1287Open in IMG/M
3300025941|Ga0207711_11260034All Organisms → cellular organisms → Bacteria681Open in IMG/M
3300025960|Ga0207651_10065245All Organisms → cellular organisms → Bacteria2553Open in IMG/M
3300025961|Ga0207712_10003711All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes9637Open in IMG/M
3300026035|Ga0207703_11663174All Organisms → cellular organisms → Bacteria → Acidobacteria614Open in IMG/M
3300026075|Ga0207708_10080175All Organisms → cellular organisms → Bacteria2508Open in IMG/M
3300026095|Ga0207676_11293015All Organisms → cellular organisms → Bacteria → Acidobacteria724Open in IMG/M
3300026095|Ga0207676_11590446Not Available651Open in IMG/M
3300027775|Ga0209177_10245529All Organisms → cellular organisms → Bacteria → Acidobacteria659Open in IMG/M
3300027787|Ga0209074_10252621All Organisms → cellular organisms → Bacteria → Acidobacteria686Open in IMG/M
3300027886|Ga0209486_10970497Not Available569Open in IMG/M
3300027909|Ga0209382_10911928All Organisms → cellular organisms → Bacteria → Acidobacteria924Open in IMG/M
3300028380|Ga0268265_10217552All Organisms → cellular organisms → Bacteria → Acidobacteria1669Open in IMG/M
3300028381|Ga0268264_11927521All Organisms → cellular organisms → Bacteria → Acidobacteria600Open in IMG/M
3300030510|Ga0268243_1185284All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium514Open in IMG/M
3300031548|Ga0307408_102481968All Organisms → cellular organisms → Bacteria → Acidobacteria504Open in IMG/M
3300031716|Ga0310813_11159206All Organisms → cellular organisms → Bacteria → Acidobacteria710Open in IMG/M
3300031731|Ga0307405_10531668All Organisms → cellular organisms → Bacteria → Acidobacteria948Open in IMG/M
3300031852|Ga0307410_11352232All Organisms → cellular organisms → Bacteria → Acidobacteria624Open in IMG/M
3300031908|Ga0310900_10020334All Organisms → cellular organisms → Bacteria3492Open in IMG/M
3300032000|Ga0310903_10630764All Organisms → cellular organisms → Bacteria → Acidobacteria573Open in IMG/M
3300032004|Ga0307414_12149244All Organisms → cellular organisms → Bacteria → Acidobacteria521Open in IMG/M
3300032075|Ga0310890_10032484Not Available2828Open in IMG/M
3300033412|Ga0310810_10338179All Organisms → cellular organisms → Bacteria → Acidobacteria1592Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere14.18%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil8.51%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere8.51%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.09%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere5.67%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil4.96%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere4.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere4.96%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil3.55%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere3.55%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.84%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere2.84%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.13%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.13%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere2.13%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.13%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.42%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.71%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.71%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.71%
Termite NestEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest0.71%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.71%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.71%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.71%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.71%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.71%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.71%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.71%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.71%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.71%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300003999Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005290Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006169Termite nest microbial communities from Madurai, IndiaEnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2EnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300025735Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300030510Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG (v2)EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031852Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3Host-AssociatedOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300032000Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3EnvironmentalOpen in IMG/M
3300032004Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3Host-AssociatedOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10214J12806_1274856123300000891SoilMSTGICNRATTSLSLDDLAKVRAMIQEAKARLDEIR*
JGI10216J12902_12443206023300000956SoilFRQTRSGNAVIMSTGICNRATTAMTLDDLAKVKAMIQEAKARLDELR*
Ga0055469_1026615113300003999Natural And Restored WetlandsLELGVFRQTRRGTAAMMTTGICDRASQLLTLDELAKVKAMIQEAKMRLDELR*
Ga0062593_10113953523300004114SoilTGTAVIMSTGICDRATATLSLDDLGKVRAMIQEAKSRLDEIR*
Ga0062593_10241114123300004114SoilAVILTTGICDRATATLSLDDLAKVRALIQEAKARLDEIR*
Ga0062590_10259916413300004157SoilIGVFRQTRSGTAVVIQTGICDRTTQTLSLDDLAKVKAIIQEAKSRLDDIK*
Ga0062591_10083024423300004643SoilTRSGTAVMIRSGICDRTTQTLSLDDLAKVKAMIQEAKSRLDDIK*
Ga0065712_1050274623300005290Miscanthus RhizosphereRSGTAVSIQTGICEPAIQGISLDDLAKVKAMIQEAKTRLDDLR*
Ga0070670_10012199013300005331Switchgrass RhizosphereYKTQGDLEIGVFRQTRSGTAVIMQTGICDRATGTLTLDDLAKVKAMIQEAKARLDEIR*
Ga0070670_10076352923300005331Switchgrass RhizosphereQTSRGTAVVLSTGICDRATTSLSLDDLAKVRAMIQEAKARLDEIR*
Ga0066388_10665320913300005332Tropical Forest SoilAVTLSTGICDRVTGTLTLDDLAKVRAMIQEAKSRLDELGR*
Ga0070687_10010294823300005343Switchgrass RhizosphereLGDLELNVFKQTRSGTAVIVTTGICDHAKANLSLDDLAKIKAMIQEAKQRLDEIR*
Ga0070688_10132832323300005365Switchgrass RhizosphereIGVFRQTRRGAAALMTTGICDRASQLLTLDELAKVKAMIQEAKMRLDELR*
Ga0070709_1075399923300005434Corn, Switchgrass And Miscanthus RhizosphereKTLGDLEIGIFRQTRSGTAVALTTGICERPTQAMTLDDLAKVKAMIQEAKSRLDEIR*
Ga0070700_10002967013300005441Corn, Switchgrass And Miscanthus RhizosphereVAVFRQTRSGNAVIISTGICDRATQTLSLDDLAKVKAMIQEAKSRLDEIR*
Ga0070699_10051008713300005518Corn, Switchgrass And Miscanthus RhizosphereKTLGDLEIGVFRQTRSGTAVILTTGICERATQTMSLDDLAKVKAMLQEAKSRLDELK*
Ga0070696_10067340623300005546Corn, Switchgrass And Miscanthus RhizosphereVFRQTRSGTAVILTTGICDRATQTMTLDDLAKVKAMIQEAKTRLDELK*
Ga0070696_10080166813300005546Corn, Switchgrass And Miscanthus RhizosphereFEAKYRTLGDLEITVFRQTRSGNAAILTTGACEQARTSLTLDELAKMRAMIQEAKTRLDEIR*
Ga0070696_10118044023300005546Corn, Switchgrass And Miscanthus RhizosphereTQGDLEIGVFRQTSRGTAVVLTTGICDRATTSLSLDDLAKVRAMIQEAKARLDDIR*
Ga0070696_10160710713300005546Corn, Switchgrass And Miscanthus RhizosphereFEATYKTSGDLEIGVFRQTRSGTAVIISTGICDRARQTLTLDDLAKVKAMIQEAKARLDEAK*
Ga0070693_10116231513300005547Corn, Switchgrass And Miscanthus RhizosphereTRSGTAVIISTGICDRATQTLSLDDLAKFKAMVQEAKARLDEIR*
Ga0066670_1016752413300005560SoilMTTGICDHVTATLSLDEFAKVKAMIQEAKARLDEIR*
Ga0070664_10064389313300005564Corn RhizosphereTGICDRATATLSLDDLAKVRAMIQEAKSRLDEIR*
Ga0068857_10067270313300005577Corn RhizosphereARYRTSGDLEIAVFRQTRSGNAVMMSTGICDRVTGTFSLDEFAKIRAMIQEAKTRLDEIR
Ga0068857_10068805923300005577Corn RhizosphereYRTLGDLEITVFRQTRSGNAAILTTGACEQARTSLTLDELAKIRAMIQEAKTRLDEIR*
Ga0068857_10106047413300005577Corn RhizosphereDLEISVFRQTRSGRAVIMRTGICDRATTTLSLDDFAKVKAMIQEAKARLDEIR*
Ga0068857_10130440513300005577Corn RhizosphereRQTRSGTAVTMRTGLCNQATVSMSLDDLAKIKAMIQEAKERLDQIR*
Ga0068857_10203304323300005577Corn RhizosphereGDLEISVFRQTRSGRAVIMRTGICDRATITLSLDDFAKVKAMIQEAKARLDEIR*
Ga0068854_10180265823300005578Corn RhizosphereFEAKYRTLGDLEITVFRQTRSGNAAILTTGACEQARTSLTLDELAKVRAMIQEAKTRLDEIR*
Ga0070702_10090242223300005615Corn, Switchgrass And Miscanthus RhizosphereTLGDFEITVFRQTRTGTAVSLTTGVCNQARVTMSLDDLARVRAMLVDAKTKLDEARQH*
Ga0068859_10059778913300005617Switchgrass RhizosphereIQTGICDRTTQTLSLDDLAKVKAIIQEAKSRLDEIR*
Ga0068859_10089843313300005617Switchgrass RhizosphereVFRQTRSGTAVIISTGICDRAMQTLTLDDLAKVKAQIQEAKMRLDEIR*
Ga0068859_10109344013300005617Switchgrass RhizosphereGVFRQTRSGNAVILSTGICDRATTTITLDELAKVKAMIQEAKARLDEIR*
Ga0068859_10148689713300005617Switchgrass RhizosphereAVTIQTGICTRATESLSLDELAKVRAMILEAKTRLDELR*
Ga0068864_10078190713300005618Switchgrass RhizosphereLGDLEIQVFKQTRSGTAVIVTTGICENARATLSLDDLAKIKAMIQEAKTRLDEIR*
Ga0068864_10148086113300005618Switchgrass RhizosphereVFRQTSRGTAVILTTGICDRATATLSLDDLAKVRAMIQEAKSRLDEIR*
Ga0068864_10160243123300005618Switchgrass RhizosphereGVFRQTRSGTAVSIQTGICDPAIQGISLDDLAKVKAMIQEAKTRLDDLR*
Ga0068864_10179299813300005618Switchgrass RhizosphereVFRQTRSGTAVIILTGICDRARVTLTLDDLAKLRAMIHEAKTRLDELR*
Ga0068861_10230380413300005719Switchgrass RhizosphereVILTTGICDRATATLSLDDLAKVRALIQEAKARLDEIR*
Ga0068863_10068311323300005841Switchgrass RhizosphereTRSGRAVIMRTGICDRATTTLSLDDFAKVKAMIQEAKARLDEIR*
Ga0068858_10177974613300005842Switchgrass RhizosphereRGTAVVLTTGICDRATASLSLDDLAKVRAMVQEAKSRLDEIK*
Ga0068860_10167205613300005843Switchgrass RhizosphereTQRLTAVTIQTGICTRATESLSLDELAKVRAMILEAKTRLDELR*
Ga0068862_10035043123300005844Switchgrass RhizosphereVTMTTGICDLATVSMSLDDLAKVRAMIQEAKERLDQIR*
Ga0068862_10149968823300005844Switchgrass RhizosphereRSGAAVVLTTGICDRATATLSLDDLAKVRALIQEAKARLDEIR*
Ga0068862_10187926213300005844Switchgrass RhizosphereAVILTTGICDRATQTLTLDDLAKVRALILEAKTRLDEIR*
Ga0082029_174203813300006169Termite NestISVFRQTRSGTAVIISTGICDRATTTLSLDDLAKVKAMIQEAKARLEEIR*
Ga0079222_1242835523300006755Agricultural SoilRQTRTGTAVIMSTGICDRATQTLTLDDLAKVKAQIQEAKTRLDEIR*
Ga0066658_1045376523300006794SoilEIGVFRQTRSGNAVVMTTGICDHATTTFSLDEFGKVKTMIQEAKARLDDLR*
Ga0079220_1090361523300006806Agricultural SoilGTAVILTTGICDRATTTVSLDDLAKIRAMIQEAKSRLDEIR*
Ga0075433_1021879323300006852Populus RhizosphereTGFEGRYKTKGDLEITVFRQTRSGNAVIISTGICDRATTSITLDELAKVKAMIQEAKARLDETR*
Ga0075420_10100520723300006853Populus RhizosphereRTLGDLEITVFRQTRSGNAALMTTGVCEQGRTALTLDELAKVRAMIQEAKTRLDEIR*
Ga0075434_10039095413300006871Populus RhizosphereILTTGICDNTRVTLSLDDLAKIKAMIQEAKARLDETR*
Ga0075424_10117222713300006904Populus RhizosphereDLEITVFRQTRSGTAVTMTTGLCDGPTATLTLDELAKVKAMIQEAKTRLDEIR*
Ga0079219_1086290513300006954Agricultural SoilEIGVFRQTSRGTAVILTTGICDRATATLSLDDLAKVRAMIQEAKSRLDEIR*
Ga0075419_1024388213300006969Populus RhizosphereAHYRTQGDLELRVFRQTRSGTAITIQTGICNRATETLTLDELAKVRAMIQEAKGRLEELR
Ga0079218_1042440523300007004Agricultural SoilAVTMSTGICDRVTSALTLDEFAKVKAMIQEAKGRLDEIR*
Ga0105240_1271887223300009093Corn RhizosphereVLTTGICDRATATLSLDDLAKVRALIQEAKARLDEIR*
Ga0111539_1131186423300009094Populus RhizosphereFRQTRSGRAVLIHTGICERATGTLTLDDLAKLRAMIQEAKMRLDEVK*
Ga0105245_1127139023300009098Miscanthus RhizosphereILTTGICDRATATLSLDDLAKVRALIQEAKARLDEIR*
Ga0105247_1006284413300009101Switchgrass RhizosphereSVFRQTRSGRAVIIRTGLCDRATATLSLDDFAKVKAMIQEAKARLDEIR*
Ga0105247_1171016923300009101Switchgrass RhizosphereLTTGICDRATATLSLDDLAKIRAMIQEAKSRLDEIR*
Ga0114129_1158937613300009147Populus RhizosphereTRSGTAVIITTGICENSRATLSLDDLAKIRAMIQEAKQRLDEIR*
Ga0114129_1162740513300009147Populus RhizosphereRQTRSGTAVTLTTGICDLATVSMSLDELAKIRAMIHEAKQRLDEIR*
Ga0105243_1222285523300009148Miscanthus RhizosphereFEIQVFRQTRSGNAVVLQTGICEFATTSLSLDELAKVKALLQEAKTRLDEIR*
Ga0111538_1065134723300009156Populus RhizosphereGDLEIAVFRQTRSGRAVILQTGICDRAAATLTLDDLAKVRAMIQEAKARLDEIR*
Ga0075423_1122485923300009162Populus RhizosphereAFRTNGDLELSVFRQTRRGTAALISTGICERTSVPLSLDDLAKVKAMIQEAKARLDEIR*
Ga0075423_1134035623300009162Populus RhizosphereGDLEIAVFRQTRGGNAVIMRTGICDHATTAMSLDDLAKVRAMIQEAKTRLDELR*
Ga0105241_1095917413300009174Corn RhizosphereVIISTGICDRATATLTLDDLAKVKALIQEAKARLDEIR*
Ga0105241_1124794423300009174Corn RhizosphereEIAVFRQTRSGNAVMMSTGICDRVTGTFSLDEFAKIRAMIQEAKARLDELR*
Ga0105242_1014678223300009176Miscanthus RhizosphereLTAVTIQTGICTRATESLSLDELAKVRAMILEAKTRLDELR*
Ga0105242_1193838313300009176Miscanthus RhizosphereTGICDRATATLSLDDLAKVRALIQEAKARLDEIR*
Ga0105242_1276371523300009176Miscanthus RhizosphereLEVAVFRQTRSGNAVIISTGICDRATQTLSLDDLAKVKAMIQEAKSRLDEIR*
Ga0105238_1081115313300009551Corn RhizosphereLTTGICDRATATLSLDDLAKIRAMIQEAKTRLDEIR*
Ga0126315_1066546513300010038Serpentine SoilAVNMRTGICDRATQTLTLDDLAKVRVMIAEAKTRLDEIR*
Ga0126309_1101627313300010039Serpentine SoilTGICDRATATLSLDELAKVRAMIQEAKARLDEIR*
Ga0126380_1063503313300010043Tropical Forest SoilDLEIKVFRQTRSGTAVTLSSGVCEQTLVTLSLDDLARVKAMILEAKGRLDESK*
Ga0126310_1084733823300010044Serpentine SoilVILTTGICDRATQTLSLDDLGKVKALIQEAKSRLDELR*
Ga0126310_1141493023300010044Serpentine SoilAVIMSTGICDRATQTLSLDDLAKVKAMIQEAKARLDEIR*
Ga0126311_1010572613300010045Serpentine SoilGDFEISVFRQTRSGAAVTLRTGICDDATVTMTLDDLAKVKAMIQEGKTRLDDK*
Ga0126382_1071179713300010047Tropical Forest SoilTAAFIRTGICNRATGTLTLDELAKVRAMIQEAKTRLDEIR*
Ga0134128_1225261323300010373Terrestrial SoilTQGDLEIGVFRQTSRGTAVILTTGFCDRATATLSLDDLAKVRAMIQEAKSRLDEIR*
Ga0134124_1025790713300010397Terrestrial SoilTLGDLEIGVFRQTRSGTAVILTTGICDQATQTLTLDDLAKVRALIQEAKTRLDEIR*
Ga0134124_1058089723300010397Terrestrial SoilGVFRQTRSGAAVVLTTGICDRATATLSLDDLAKVRALIQEAKARLDEIR*
Ga0134124_1092313123300010397Terrestrial SoilVFRQTRSGAAVILTTGICDRATATLSLDDLAKVRALIQEAKARLDEIR*
Ga0134124_1145481813300010397Terrestrial SoilGFEARYKSMGDLEISVFRQTRSGRAVIIRTGLCDRATTTLSLDDFAKVKALIQEAKARLDEIR*
Ga0134124_1271539223300010397Terrestrial SoilFEARYKTLGDLEISVFRQTRSGNAVIVSTGICDRATTTISLDDLAKVKAMIQEAKARLDEIR*
Ga0134127_1037488313300010399Terrestrial SoilRSGTAVIISTGICDRATQTLTLDDLAKFKAMVQEAKARLDEIR*
Ga0134122_1009992323300010400Terrestrial SoilDFEIQVFRQTRSGNAVVLQTGICESATTSLSLDELAKVKALLLEAKARLDEIK*
Ga0134121_1154551013300010401Terrestrial SoilIGVFRQTRSGTAVILTTGICDRATQTMTLDDLAKVKAMIQEAKTRLDENR*
Ga0134123_1010886523300010403Terrestrial SoilRLTAVTIQTGICTRATESLSLDELAKVRAMILEAKTRLDELR*
Ga0134123_1050056223300010403Terrestrial SoilFRQTRSGNAVILSTGICDRATTTITLDELAKVKAMIQEAKARLDEIR*
Ga0134123_1283030813300010403Terrestrial SoilRQTRSGNAVRISIGICEPATVYWTLDDLAKLRAMIKEAKARLDELG*
Ga0105246_1110337213300011119Miscanthus RhizosphereSGAAVTLRTGICDDATVTLTLDDLAKVKAMIQEAKTRLDDK*
Ga0150984_10253633013300012469Avena Fatua RhizosphereLEIGVFRQTSRGTAVVLTTGICDRATASLSLDDLAKVRAMIQEAKARLDEIK*
Ga0157299_1029538423300012899SoilGDFEISVFRQTRSGTAVLLATGLCDRATQTMSLDDLGKVKAMIQEAKTRLDEIR*
Ga0137396_1015448513300012918Vadose Zone SoilLGDLEIAVFRQTRSGMAASLSTGICNRAIAYLTLDELAKVRAMILEAKEKLDQSR*
Ga0126375_1003699733300012948Tropical Forest SoilGDLELRVFRQTRSGTAVTLSSGVCEQVLVTLSLDDLARVKAMILEAKGRLDESK*
Ga0126375_1202076113300012948Tropical Forest SoilMTTGICDHATVTMSLDDLAKIKAMIQEAKARLEEIR*
Ga0157373_1001287023300013100Corn RhizosphereAILTTGACEQARTSLTLDELAKIRAMIQEAKTRLDEIR*
Ga0163162_1147900213300013306Switchgrass RhizosphereLELKVFRQTQRLTAVTIQTGICTRATESLSLDELAKVRAMILEAKTRLDELR*
Ga0157375_1157962713300013308Miscanthus RhizosphereEIDVFRQTRSGTAVVIQTGICDRTTQTLSLDDLAKVKAIIQEAKSRLDDIK*
Ga0157380_1174136023300014326Switchgrass RhizosphereEISVFRQTRSGRAVIMHTGICDRATITLSLDDFAKVKAMIQEAKARLDEIR*
Ga0157377_1047323613300014745Miscanthus RhizosphereTRSGRAVIMRTGICDRATTTLSLDDFAKVKAMIQEAKARLDEAR*
Ga0157379_1003328923300014968Switchgrass RhizosphereNVFKQTRSGTAVIVTTGICDHAKANLSLDDLAKIKAMIQEAKQRLDEIR*
Ga0157379_1062186123300014968Switchgrass RhizosphereTRSGNAVILSTGICDRATTTITLDELAKVKAMIQEAKARLDEIR*
Ga0132256_10042652513300015372Arabidopsis RhizosphereTAVILQTGICDRAAQTLSLDDLSKVKAMIQEAKSRLDDIR*
Ga0184625_1011688713300018081Groundwater SedimentTLGDLEIRVFRQTSRGTAVQLQTGICELATTALTLDDLARFRAMILEAKTRVEDLR
Ga0207713_118874713300025735Switchgrass RhizosphereTQGDLEIGVFRQTRSGAAVIVTTGICDRATATLSLDDLGKVRALIQEAKARLDEIR
Ga0207662_1131458323300025918Switchgrass RhizosphereMRTGICDRATTTLSLDDFAKVKAMIQEAKARLDEIR
Ga0207681_1116557423300025923Switchgrass RhizosphereRTLGDLEVAVFRQTRSGNAVIISTGICDRATQTLSLDDLAKVKAMIQEAKSRLDEIR
Ga0207650_1003582813300025925Switchgrass RhizosphereVIMQTGICDRATGTLTLDDLAKVKAMIQEAKARLDEIR
Ga0207650_1049006713300025925Switchgrass RhizosphereTAGLCDLVTISMSLDDLGKVRAMFQEAKTRLDEIR
Ga0207659_1106675723300025926Miscanthus RhizosphereLTAVTIQTGICTRATESLSLDELAKVRAMILEAKTRLDELR
Ga0207644_1090017713300025931Switchgrass RhizosphereVGDLEISVFRQTRSGRAVIMRTGICDRATTTLSLDDFAKVKAMIQEAKARLDEIR
Ga0207686_1037304623300025934Miscanthus RhizosphereVFRQTQRLTAVTIQTGICTRATESLSLDELAKVRAMILEAKTRLDELR
Ga0207686_1107599213300025934Miscanthus RhizosphereDFEIGVFRQTSRGTAVVLTTGICDRAIATLSLDDLAKIRAMIQEAKSRLDDIK
Ga0207704_1026991723300025938Miscanthus RhizosphereGVFRQTRSGTAVTMTTGICDLATVSMSLDDLAKVRAMIQEAKQRLDEIR
Ga0207711_1126003433300025941Switchgrass RhizosphereEISVFRQTRSGRAVIIRTGLCDRATTTLSLDDFAKVKAMIQEAKARLDEIR
Ga0207651_1006524513300025960Switchgrass RhizosphereITTGICDHAKANLSLDDLAKIKAMIQEAKQRLDEIR
Ga0207712_1000371163300025961Switchgrass RhizosphereAAVILTTGICDRATATLSLDDLAKVRALIQEAKARLDEIR
Ga0207640_1042904913300025981Corn RhizosphereFEARYKTQGDLEIGVFRQTSRGTAVILTTGICDRATATLSLDDLAKVRAMIQEAKSRLDEIR
Ga0207703_1166317413300026035Switchgrass RhizosphereQTRSGRAVIMRTGICDRATTTLSLDDFAKVKAMIQEAKARLDEIR
Ga0207708_1008017513300026075Corn, Switchgrass And Miscanthus RhizosphereQTQRLTAVTIQTGICTRATESLSLDELAKVRAMILEAKTRLDELR
Ga0207676_1129301513300026095Switchgrass RhizosphereGVFRQTRSGTAVSIQTGICDPAIQGISLDDLAKVKAMIQEAKTRLDDLR
Ga0207676_1159044623300026095Switchgrass RhizosphereGDFEVGVFRQTRSGTAVIILTGICDRARVTLTLDDLAKLRAMIHEAKTRLDELR
Ga0209177_1024552923300027775Agricultural SoilGVFRQTSRGTAVVLTTGICDRATTSLSLDDLAKVRAMIQEAKSRLDEIR
Ga0209074_1025262123300027787Agricultural SoilSRGTAVVLTTGICDRATTSLSLDDLAKVRAMIQEAKARLDDIR
Ga0209486_1097049713300027886Agricultural SoilIGVFRQTRRGNAATMATGICDRTSQLLTLDELAKVKAMVQEAKARLDELR
Ga0209382_1091192813300027909Populus RhizosphereALMTTGVCEQGRTALTLDELAKVRAMIQEAKTRLDEIR
Ga0268265_1021755213300028380Switchgrass RhizosphereRSGNAAILTTGACEQARTSLTLDELAKIRAMIQEAKTRLDEIR
Ga0268264_1192752113300028381Switchgrass RhizosphereYKTQGDLEIGVFRQTSRGTAVVISTGICDRATAPLSLDDLAKVRAMIQEAKARLDEIR
Ga0268243_118528413300030510SoilLISTGICDRPQQALSLDDLAKVKAQIQEAKARLDEIR
Ga0307408_10248196823300031548RhizosphereFEARYRTLGDFEVGVFRQTRSGTAVILLTGICERGRSTLSLDELAKLKAMIQEAKTRLDELR
Ga0310813_1115920623300031716SoilAVNMHAGICNRPTINLSLDDLAKVRAMIQEAKTRLDEIR
Ga0307405_1053166813300031731RhizosphereDLEIGVFRQTRSGTAVTMTTGICDLATVNMSLDDLGKIRAMIQEAKQRLDEIR
Ga0307410_1135223213300031852RhizosphereDLEITVFRQTRSGNAAILTTGACEQARTSLTLDELAKIRAMIQEAKTRLDEIR
Ga0310900_1002033413300031908SoilNAVIISTGICDRATQTLSLDDLAKVKAMIQEAKSRLDEIR
Ga0310903_1063076423300032000SoilVAVFRQTRSGNAVIISTGICDRATQTLSLDDLAKVKAMIQEAKSRLDEIR
Ga0307414_1214924413300032004RhizosphereQTQRGTAVTLTTGICDRATQGITFDELAKVKAMIHEAKTRLDEIR
Ga0310890_1003248413300032075SoilEVAVFRQTRSGNAVIISTGICDRATQTLSLDDLAKVKAMIQEAKSRLDEIR
Ga0310810_1033817913300033412SoilSGTAVTLTTGLCERATQTMTLDDLGKVKAMIQEAKTRLDELR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.