NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F053736

Metagenome Family F053736

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F053736
Family Type Metagenome
Number of Sequences 140
Average Sequence Length 50 residues
Representative Sequence GSKITSTGLIAKIGKYLLVITEKDEALTEFDYTLIPLRAKVQIRYN
Number of Associated Samples 94
Number of Associated Scaffolds 140

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.71 %
% of genes near scaffold ends (potentially truncated) 96.43 %
% of genes from short scaffolds (< 2000 bps) 92.14 %
Associated GOLD sequencing projects 88
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland
(38.571 % of family members)
Environment Ontology (ENVO) Unclassified
(85.714 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(72.143 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 58.70%    Coil/Unstructured: 41.30%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 140 Family Scaffolds
PF13620CarboxypepD_reg 15.00
PF02635DrsE 15.00
PF07715Plug 1.43
PF03571Peptidase_M49 1.43
PF13487HD_5 0.71
PF11667DUF3267 0.71
PF01966HD 0.71
PF00313CSD 0.71
PF00930DPPIV_N 0.71
PF00324AA_permease 0.71
PF13432TPR_16 0.71
PF00171Aldedh 0.71
PF01293PEPCK_ATP 0.71
PF06964Alpha-L-AF_C 0.71
PF028262-Hacid_dh_C 0.71
PF00326Peptidase_S9 0.71
PF09509Hypoth_Ymh 0.71

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 140 Family Scaffolds
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 0.71
COG0531Serine transporter YbeC, amino acid:H+ symporter familyAmino acid transport and metabolism [E] 0.71
COG0823Periplasmic component TolB of the Tol biopolymer transport systemIntracellular trafficking, secretion, and vesicular transport [U] 0.71
COG0833Amino acid permeaseAmino acid transport and metabolism [E] 0.71
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 0.71
COG1113L-asparagine transporter or related permeaseAmino acid transport and metabolism [E] 0.71
COG1115Na+/alanine symporterAmino acid transport and metabolism [E] 0.71
COG1506Dipeptidyl aminopeptidase/acylaminoacyl peptidaseAmino acid transport and metabolism [E] 0.71
COG1866Phosphoenolpyruvate carboxykinase, ATP-dependentEnergy production and conversion [C] 0.71
COG3534Alpha-L-arabinofuranosidaseCarbohydrate transport and metabolism [G] 0.71
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 0.71

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005836|Ga0074470_11665007All Organisms → cellular organisms → Bacteria → Acidobacteria615Open in IMG/M
3300006102|Ga0075015_100604091All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300009518|Ga0116128_1031034All Organisms → cellular organisms → Bacteria → Acidobacteria1771Open in IMG/M
3300009518|Ga0116128_1068666All Organisms → cellular organisms → Bacteria → Acidobacteria1086Open in IMG/M
3300009547|Ga0116136_1103952All Organisms → cellular organisms → Bacteria → Acidobacteria738Open in IMG/M
3300009547|Ga0116136_1136662All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2624Open in IMG/M
3300009548|Ga0116107_1084474All Organisms → cellular organisms → Bacteria → Acidobacteria977Open in IMG/M
3300009549|Ga0116137_1006652All Organisms → cellular organisms → Bacteria → Acidobacteria5305Open in IMG/M
3300009549|Ga0116137_1220983All Organisms → cellular organisms → Bacteria → Acidobacteria500Open in IMG/M
3300009552|Ga0116138_1032436All Organisms → cellular organisms → Bacteria → Acidobacteria1558Open in IMG/M
3300009615|Ga0116103_1052423All Organisms → cellular organisms → Bacteria → Acidobacteria1144Open in IMG/M
3300009615|Ga0116103_1148375All Organisms → cellular organisms → Bacteria → Acidobacteria569Open in IMG/M
3300009616|Ga0116111_1036809All Organisms → cellular organisms → Bacteria → Acidobacteria1515Open in IMG/M
3300009616|Ga0116111_1059186All Organisms → cellular organisms → Bacteria → Acidobacteria1073Open in IMG/M
3300009617|Ga0116123_1106021All Organisms → cellular organisms → Bacteria → Acidobacteria745Open in IMG/M
3300009618|Ga0116127_1044143All Organisms → cellular organisms → Bacteria → Acidobacteria1304Open in IMG/M
3300009630|Ga0116114_1040074All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1346Open in IMG/M
3300009634|Ga0116124_1019588All Organisms → cellular organisms → Bacteria → Acidobacteria2214Open in IMG/M
3300009636|Ga0116112_1057728All Organisms → cellular organisms → Bacteria → Acidobacteria1136Open in IMG/M
3300009639|Ga0116122_1077665All Organisms → cellular organisms → Bacteria → Acidobacteria1094Open in IMG/M
3300009643|Ga0116110_1046309All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1574Open in IMG/M
3300009643|Ga0116110_1273050All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2539Open in IMG/M
3300009645|Ga0116106_1059729All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1263Open in IMG/M
3300009645|Ga0116106_1174153All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2686Open in IMG/M
3300009646|Ga0116132_1168093All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300009760|Ga0116131_1050891All Organisms → cellular organisms → Bacteria → Acidobacteria1339Open in IMG/M
3300009764|Ga0116134_1181701All Organisms → cellular organisms → Bacteria → Acidobacteria735Open in IMG/M
3300010343|Ga0074044_10514531All Organisms → cellular organisms → Bacteria → Acidobacteria782Open in IMG/M
3300010379|Ga0136449_100329217All Organisms → cellular organisms → Bacteria2761Open in IMG/M
3300014151|Ga0181539_1124351All Organisms → cellular organisms → Bacteria → Acidobacteria1055Open in IMG/M
3300014151|Ga0181539_1195219All Organisms → cellular organisms → Bacteria → Acidobacteria781Open in IMG/M
3300014153|Ga0181527_1084544All Organisms → cellular organisms → Bacteria → Acidobacteria1543Open in IMG/M
3300014153|Ga0181527_1425136All Organisms → cellular organisms → Bacteria → Acidobacteria505Open in IMG/M
3300014155|Ga0181524_10373178All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2629Open in IMG/M
3300014155|Ga0181524_10438445All Organisms → cellular organisms → Bacteria → Acidobacteria563Open in IMG/M
3300014161|Ga0181529_10678125All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2533Open in IMG/M
3300014165|Ga0181523_10159031All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1325Open in IMG/M
3300014201|Ga0181537_10752198All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2662Open in IMG/M
3300014493|Ga0182016_10680181All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2579Open in IMG/M
3300014498|Ga0182019_10628594All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2756Open in IMG/M
3300014838|Ga0182030_10409548All Organisms → cellular organisms → Bacteria → Acidobacteria1407Open in IMG/M
3300017821|Ga0187812_1229732All Organisms → cellular organisms → Bacteria → Acidobacteria591Open in IMG/M
3300017925|Ga0187856_1320190All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300017929|Ga0187849_1058106All Organisms → cellular organisms → Bacteria → Acidobacteria1771Open in IMG/M
3300017929|Ga0187849_1115309All Organisms → cellular organisms → Bacteria → Acidobacteria1120Open in IMG/M
3300017929|Ga0187849_1130855All Organisms → cellular organisms → Bacteria1030Open in IMG/M
3300017929|Ga0187849_1203385All Organisms → cellular organisms → Bacteria → Acidobacteria772Open in IMG/M
3300017929|Ga0187849_1235845All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2701Open in IMG/M
3300017929|Ga0187849_1351854All Organisms → cellular organisms → Bacteria → Acidobacteria544Open in IMG/M
3300017935|Ga0187848_10053389All Organisms → cellular organisms → Bacteria → Acidobacteria1935Open in IMG/M
3300017935|Ga0187848_10293628All Organisms → cellular organisms → Bacteria679Open in IMG/M
3300017938|Ga0187854_10325026All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2654Open in IMG/M
3300017940|Ga0187853_10091947All Organisms → cellular organisms → Bacteria → Acidobacteria1501Open in IMG/M
3300017940|Ga0187853_10129935All Organisms → cellular organisms → Bacteria → Acidobacteria1219Open in IMG/M
3300017940|Ga0187853_10251720All Organisms → cellular organisms → Bacteria → Acidobacteria811Open in IMG/M
3300017941|Ga0187850_10141737All Organisms → cellular organisms → Bacteria → Acidobacteria1132Open in IMG/M
3300017941|Ga0187850_10204185All Organisms → cellular organisms → Bacteria → Acidobacteria904Open in IMG/M
3300017941|Ga0187850_10315990All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2690Open in IMG/M
3300017946|Ga0187879_10684627All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2571Open in IMG/M
3300017972|Ga0187781_10921582All Organisms → cellular organisms → Bacteria637Open in IMG/M
3300017973|Ga0187780_10766775All Organisms → cellular organisms → Bacteria → Acidobacteria697Open in IMG/M
3300017973|Ga0187780_10994650All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2611Open in IMG/M
3300017988|Ga0181520_10881781All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2598Open in IMG/M
3300017996|Ga0187891_1055606All Organisms → cellular organisms → Bacteria → Acidobacteria1637Open in IMG/M
3300017996|Ga0187891_1064388All Organisms → cellular organisms → Bacteria → Acidobacteria1483Open in IMG/M
3300017996|Ga0187891_1309420All Organisms → cellular organisms → Bacteria → Acidobacteria514Open in IMG/M
3300017998|Ga0187870_1256176All Organisms → cellular organisms → Bacteria → Acidobacteria598Open in IMG/M
3300018001|Ga0187815_10346473All Organisms → cellular organisms → Bacteria → Acidobacteria631Open in IMG/M
3300018002|Ga0187868_1006039All Organisms → cellular organisms → Bacteria → Acidobacteria6889Open in IMG/M
3300018003|Ga0187876_1212848All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300018004|Ga0187865_1011432All Organisms → cellular organisms → Bacteria → Acidobacteria4808Open in IMG/M
3300018004|Ga0187865_1043012All Organisms → cellular organisms → Bacteria → Acidobacteria1864Open in IMG/M
3300018005|Ga0187878_1079074All Organisms → cellular organisms → Bacteria → Acidobacteria1390Open in IMG/M
3300018005|Ga0187878_1267783All Organisms → cellular organisms → Bacteria → Acidobacteria618Open in IMG/M
3300018005|Ga0187878_1290186All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2587Open in IMG/M
3300018008|Ga0187888_1235530All Organisms → cellular organisms → Bacteria716Open in IMG/M
3300018008|Ga0187888_1268975All Organisms → cellular organisms → Bacteria → Acidobacteria660Open in IMG/M
3300018009|Ga0187884_10050148All Organisms → cellular organisms → Bacteria → Acidobacteria1954Open in IMG/M
3300018013|Ga0187873_1086473All Organisms → cellular organisms → Bacteria → Acidobacteria1262Open in IMG/M
3300018013|Ga0187873_1123786All Organisms → cellular organisms → Bacteria1004Open in IMG/M
3300018013|Ga0187873_1288036All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2604Open in IMG/M
3300018014|Ga0187860_1348082All Organisms → cellular organisms → Bacteria → Acidobacteria564Open in IMG/M
3300018015|Ga0187866_1137231All Organisms → cellular organisms → Bacteria965Open in IMG/M
3300018016|Ga0187880_1326747All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2655Open in IMG/M
3300018017|Ga0187872_10101484All Organisms → cellular organisms → Bacteria → Acidobacteria1439Open in IMG/M
3300018020|Ga0187861_10042045All Organisms → cellular organisms → Bacteria → Acidobacteria2455Open in IMG/M
3300018020|Ga0187861_10362581All Organisms → cellular organisms → Bacteria → Acidobacteria611Open in IMG/M
3300018021|Ga0187882_1096403All Organisms → cellular organisms → Bacteria → Acidobacteria1271Open in IMG/M
3300018021|Ga0187882_1423866All Organisms → cellular organisms → Bacteria → Acidobacteria504Open in IMG/M
3300018022|Ga0187864_10188644All Organisms → cellular organisms → Bacteria → Acidobacteria986Open in IMG/M
3300018024|Ga0187881_10009500All Organisms → cellular organisms → Bacteria6346Open in IMG/M
3300018024|Ga0187881_10064588All Organisms → cellular organisms → Bacteria → Acidobacteria1729Open in IMG/M
3300018024|Ga0187881_10315295All Organisms → cellular organisms → Bacteria → Acidobacteria647Open in IMG/M
3300018024|Ga0187881_10477089All Organisms → cellular organisms → Bacteria → Acidobacteria508Open in IMG/M
3300018034|Ga0187863_10799862All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300018038|Ga0187855_10202408All Organisms → cellular organisms → Bacteria1172Open in IMG/M
3300018040|Ga0187862_10019889All Organisms → cellular organisms → Bacteria5291Open in IMG/M
3300018042|Ga0187871_10841150All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300018043|Ga0187887_10206642All Organisms → cellular organisms → Bacteria1167Open in IMG/M
3300018057|Ga0187858_10158676All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1502Open in IMG/M
3300018062|Ga0187784_10359066All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1180Open in IMG/M
3300018062|Ga0187784_10883535All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium712Open in IMG/M
3300018062|Ga0187784_11559481All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2523Open in IMG/M
3300018085|Ga0187772_11107224All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium581Open in IMG/M
3300018086|Ga0187769_10569959All Organisms → cellular organisms → Bacteria → Acidobacteria855Open in IMG/M
3300018086|Ga0187769_10770994All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2727Open in IMG/M
3300018088|Ga0187771_10119452All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia2142Open in IMG/M
3300018088|Ga0187771_10625622All Organisms → cellular organisms → Bacteria913Open in IMG/M
3300018088|Ga0187771_10816996All Organisms → cellular organisms → Bacteria → Acidobacteria791Open in IMG/M
3300018088|Ga0187771_10894457All Organisms → cellular organisms → Bacteria753Open in IMG/M
3300018088|Ga0187771_10911311All Organisms → cellular organisms → Bacteria → Acidobacteria746Open in IMG/M
3300018088|Ga0187771_10965428All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2723Open in IMG/M
3300018090|Ga0187770_10597866All Organisms → cellular organisms → Bacteria → Acidobacteria877Open in IMG/M
3300019082|Ga0187852_1089306All Organisms → cellular organisms → Bacteria → Acidobacteria1371Open in IMG/M
3300025419|Ga0208036_1072195All Organisms → cellular organisms → Bacteria → Acidobacteria552Open in IMG/M
3300025432|Ga0208821_1058594All Organisms → cellular organisms → Bacteria → Acidobacteria676Open in IMG/M
3300025439|Ga0208323_1030420All Organisms → cellular organisms → Bacteria1077Open in IMG/M
3300025444|Ga0208189_1053928All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium756Open in IMG/M
3300025448|Ga0208037_1002985All Organisms → cellular organisms → Bacteria → Acidobacteria6708Open in IMG/M
3300025448|Ga0208037_1050947All Organisms → cellular organisms → Bacteria → Acidobacteria798Open in IMG/M
3300025460|Ga0208562_1024802All Organisms → cellular organisms → Bacteria → Acidobacteria1413Open in IMG/M
3300025460|Ga0208562_1070478All Organisms → cellular organisms → Bacteria721Open in IMG/M
3300025469|Ga0208687_1071473All Organisms → cellular organisms → Bacteria → Acidobacteria787Open in IMG/M
3300025501|Ga0208563_1115665All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2508Open in IMG/M
3300027911|Ga0209698_10949405All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300029817|Ga0247275_1154000All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2578Open in IMG/M
3300031952|Ga0315294_11487893All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2530Open in IMG/M
3300032156|Ga0315295_10924978All Organisms → cellular organisms → Bacteria869Open in IMG/M
3300032173|Ga0315268_10017204All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi7240Open in IMG/M
3300032805|Ga0335078_12478160All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2536Open in IMG/M
3300032828|Ga0335080_11172360All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2774Open in IMG/M
3300032892|Ga0335081_10690677All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21240Open in IMG/M
3300032892|Ga0335081_11307209All Organisms → cellular organisms → Bacteria818Open in IMG/M
3300032893|Ga0335069_10464808All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1474Open in IMG/M
3300032895|Ga0335074_10714554All Organisms → cellular organisms → Bacteria961Open in IMG/M
3300032895|Ga0335074_11490975All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium539Open in IMG/M
3300033402|Ga0326728_10561662All Organisms → cellular organisms → Bacteria904Open in IMG/M
3300033977|Ga0314861_0250603All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium816Open in IMG/M
3300033982|Ga0371487_0184454All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1011Open in IMG/M
3300034091|Ga0326724_0660319All Organisms → cellular organisms → Bacteria513Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland38.57%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland25.00%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland11.43%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog7.14%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil5.00%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment2.14%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil2.14%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.43%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.43%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog1.43%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.71%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.71%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.71%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.71%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.71%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005836Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBBEnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300009518Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150EnvironmentalOpen in IMG/M
3300009547Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40EnvironmentalOpen in IMG/M
3300009548Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100EnvironmentalOpen in IMG/M
3300009549Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100EnvironmentalOpen in IMG/M
3300009552Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150EnvironmentalOpen in IMG/M
3300009615Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_100EnvironmentalOpen in IMG/M
3300009616Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100EnvironmentalOpen in IMG/M
3300009617Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100EnvironmentalOpen in IMG/M
3300009618Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100EnvironmentalOpen in IMG/M
3300009630Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40EnvironmentalOpen in IMG/M
3300009634Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150EnvironmentalOpen in IMG/M
3300009636Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150EnvironmentalOpen in IMG/M
3300009639Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40EnvironmentalOpen in IMG/M
3300009643Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40EnvironmentalOpen in IMG/M
3300009645Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40EnvironmentalOpen in IMG/M
3300009646Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150EnvironmentalOpen in IMG/M
3300009760Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_100EnvironmentalOpen in IMG/M
3300009764Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300014151Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaGEnvironmentalOpen in IMG/M
3300014153Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaGEnvironmentalOpen in IMG/M
3300014155Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaGEnvironmentalOpen in IMG/M
3300014161Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaGEnvironmentalOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300014493Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaGEnvironmentalOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300017821Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2EnvironmentalOpen in IMG/M
3300017925Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40EnvironmentalOpen in IMG/M
3300017929Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017938Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017941Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300017996Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40EnvironmentalOpen in IMG/M
3300017998Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150EnvironmentalOpen in IMG/M
3300018001Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5EnvironmentalOpen in IMG/M
3300018002Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40EnvironmentalOpen in IMG/M
3300018003Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40EnvironmentalOpen in IMG/M
3300018004Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100EnvironmentalOpen in IMG/M
3300018005Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_150EnvironmentalOpen in IMG/M
3300018008Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40EnvironmentalOpen in IMG/M
3300018009Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40EnvironmentalOpen in IMG/M
3300018013Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100EnvironmentalOpen in IMG/M
3300018014Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40EnvironmentalOpen in IMG/M
3300018015Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150EnvironmentalOpen in IMG/M
3300018016Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40EnvironmentalOpen in IMG/M
3300018017Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40EnvironmentalOpen in IMG/M
3300018020Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100EnvironmentalOpen in IMG/M
3300018021Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150EnvironmentalOpen in IMG/M
3300018022Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40EnvironmentalOpen in IMG/M
3300018024Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300019082Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40EnvironmentalOpen in IMG/M
3300025419Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025432Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025439Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025444Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025448Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025460Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025469Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025501Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300029817Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Bog25EnvironmentalOpen in IMG/M
3300031952Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40EnvironmentalOpen in IMG/M
3300032156Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0EnvironmentalOpen in IMG/M
3300032173Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_topEnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033977Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75EnvironmentalOpen in IMG/M
3300033982Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB22AY SIP fractionEnvironmentalOpen in IMG/M
3300034091Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00NEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0074470_1166500713300005836Sediment (Intertidal)KVGKYLVVITEKDEKLSEFDYTLIPLRPRTQIRWA*
Ga0075015_10060409123300006102WatershedsFVGSKITSAGLVAKIGKYLLVITEKDEALEEFDFTLIPLHAKIHLRYH*
Ga0116128_103103423300009518PeatlandQYIGSKITSTGLIAKIGKYLLVITEKDEALTEFDYTLIPLRAKVQIRYN*
Ga0116128_106866613300009518PeatlandQYIGSKITSTGLIAKIGKYLLVITEKDEALTEFDYTLIPLRPKVQIRYN*
Ga0116136_110395223300009547PeatlandRDKLPDFAAMRQGGQYIGSKITSTGLIAKIGKYLLVITEKDEALTEFDYTLIPLYAKVQIRYN*
Ga0116136_113666223300009547PeatlandSTGLIAKIGKYLLVITEKDEALTEFDYTLIPLHAKVQIRYA*
Ga0116107_108447413300009548PeatlandLIARIGKYLLVITEKDEALTEFDYTLIPLRAKVQIRYN*
Ga0116137_100665243300009549PeatlandMRQGGQYVGSRITSTGLIAKIGKYLLVITEKDEALAEFDYTLIPLRAKVQIRYN*
Ga0116137_122098323300009549PeatlandTSTGLIAKIGKYLLVITEKDEALTEFDYTLIPLRAKVQIRYN*
Ga0116138_103243613300009552PeatlandTGLIAKIGKYLLVITEKDEALTEFDYTLIPLRAKVQIRYN*
Ga0116103_105242323300009615PeatlandGSKITSTGLIAKIGKYLLVITEKDEALTEFDYTLIPLRAKVQIRYN*
Ga0116103_114837513300009615PeatlandDWEDAHGASRDKLPDFAAMRQGGQYIGSKITSTGLIARIGKYLLVITEKDEALTEFDYTLIPLRAKVQIRYN*
Ga0116111_103680923300009616PeatlandLIAQIGKYLLVITEKDEALTEFDYTLIPLRAKVQIRYN*
Ga0116111_105918613300009616PeatlandIGKYLLVITEKDEALTEFDYTLIPLRAKVQIRYN*
Ga0116123_110602123300009617PeatlandSTGLIAKIGKYLLVITEKDEALTEFDYTLIPLRAKVQIRYN*
Ga0116127_104414323300009618PeatlandKITSTGLIAKIGKYLLVITEKDEALTEFDYTLIPLRAKVQIRYN*
Ga0116114_104007423300009630PeatlandGGQYIGSKITSNGLIAKIGKYLLVITEKDEALTEFDYTLIPLHAKVQIRYA*
Ga0116124_101958823300009634PeatlandLIAKIGKYLLVITEKDEALTEFDYTLIPLRPKVQIRYN*
Ga0116112_105772823300009636PeatlandQGGQYIGSKITSTGLIARIGKYLLVITEKDEALTEFDYTLIPLRAKVQIRYN*
Ga0116122_107766513300009639PeatlandKITSTGLIAQIGKYLLVITEKDEALTEFDYTLIPLRAKIQIRYN*
Ga0116110_104630923300009643PeatlandDKLPDFDAMRQGGQYIGSKITSTGLIAKIGKYLLVITEKDEGLTEFDYTLIPLHAKVQIRYA*
Ga0116110_127305023300009643PeatlandTRGKLPDFDAMRQGTTFVGSKITSAGLIAKIGKYLLIITEKDEALEEFDFTLIPLHAKIQIRYH*
Ga0116106_105972913300009645PeatlandDAHGASRDKLPDFDAMRQGGQYIGSKITSTGLIAKIGKYLLVITEKDEGLTEFDYTLIPLHAKVQIRYA*
Ga0116106_117415313300009645PeatlandTRGRLPDFDAMREGNTFVGSKITSAGLMAKIGKYLLIVTEKDEALEEFDFTLIPLHAKIQIRYH*
Ga0116132_116809313300009646PeatlandHSTTRGKLPDFDAMRNGNTFVGSKITSAGLLAKIGKYLLVITEKDEALEEFDFTLIPLHAKIQLRYH*
Ga0116131_105089123300009760PeatlandRDKLPDFAAMRQGGQYIGSKITSTGLIAKIGKYLLVITEKDEALTEFDYTLIPLRAKVQIRYN*
Ga0116134_118170113300009764PeatlandGLIAKIGKYLLVITEKDEALTEFDYTLIPLRAKVQIRYN*
Ga0074044_1051453123300010343Bog Forest SoilLIAKIGKYLLVITEKDEALAEFDYTLIPLRPKVQIRYN*
Ga0136449_10032921713300010379Peatlands SoilMRNGNTFVGSKITSAGLIAKIGKYLLVITEKDEPLEEFDFTLIPLHAKIQLRYH*
Ga0181539_112435113300014151BogIAKIGKYLLVITEKDEALTEFDYTLIPLYAKVQIRYN*
Ga0181539_119521913300014151BogGLIAKIGKYLLVITEKDEALAEFDYTLIPLRPKVQIRYN*
Ga0181527_108454423300014153BogIGSKITSTGLIAQIGKYLLVITEKDEALTEFDYTLIPLRAKVQIRYN*
Ga0181527_142513623300014153BogAMRQGGQYIGSKITSAGLIAKIGKYLLVITEKDEALTEFDYTLIPLHAKVQIRYN*
Ga0181524_1037317823300014155BogQYVGSKITSTGLIAKIGKYLLVITEKDEALTEFDYTLIPLRAKVQIRYN*
Ga0181524_1043844523300014155BogWEDAHGASRDKLPDFAAMRQGGQYIGSKITSTGLIAKIGKYLLVITEKDEALTEFDYTLIPLYAKVQIRYN*
Ga0181529_1067812513300014161BogSTGLIAKIGKYLLVITEKDEGLTEFDYTLIPLHAKVQIRYA*
Ga0181523_1015903113300014165BogGLIAKIGKYLLVITEKDEGLTEFDYTLIPLHAKVQIRYA*
Ga0181537_1075219813300014201BogLPDFDAMRAGNSFVGSKITSAGLIAKIGKYLLVITEKDEALEEFDFTLIPLHAKIQLRYH
Ga0182016_1068018123300014493BogSKITSAGLVAKIGKYLLVITEKDEALEEFDFTLIPLHAKIQLRYH*
Ga0182019_1062859413300014498FenEDAHGASRDQLPDFAAMRQGGQYIGSKITSTGLIAKIGTYLLVITEKDEALTEFDYTLIPLRAKVQIRYN*
Ga0182030_1040954843300014838BogDWEDAHSTTRGKLPDFEAMRNANTFVGSKITSAGLVAKIGKYLLVITEKDEPLEEFDFTLIPLHAKIQLRYH*
Ga0187812_122973213300017821Freshwater SedimentTGLIAKIGKYLLVITEKDESLTEFDYTLIPLRAKVQIRYN
Ga0187856_132019023300017925PeatlandALREGNTFVGSKITSAGLLAKIGKYLLIVTEKDEALEEFDLTLIPMHAKVQIRYH
Ga0187849_105810623300017929PeatlandQYIGSKITSTGLIAKIGKYLLVITEKDEALTEFDYTLIPLRAKVQIRYN
Ga0187849_111530923300017929PeatlandGQYIGSKITSTGLIAKIGKYLLVITEKDEALTEFDYTLIPLYAKVQIRYN
Ga0187849_113085523300017929PeatlandSKITSAGLVAKIGKYLLVITEKDEALEEFDYTLIPLHAKIQIRYH
Ga0187849_120338523300017929PeatlandGQYIGSKITSTGLIAKIGKYLLVITEKDEALTEFDYTLIPLRAKVQIRYN
Ga0187849_123584513300017929PeatlandDAHGASRDKLPDFAAMRQGGQYIGSKITSTGLIANIGKYLLVITEKDEMLTEFDYTLIPLRAKVQIRYN
Ga0187849_135185413300017929PeatlandQYIGSKITSTGLIAKIGKYLLVITEKDEALTEFDYTLIPLRPKVQIRYN
Ga0187848_1005338923300017935PeatlandSTGLIAQIGKYLLVITEKDEALTEFDYTLIPLRAKIQIRYN
Ga0187848_1029362823300017935PeatlandDFDAMREGNTFVGSKITSAGLLAKIGKYLLIITEKDEALEEFDYTLIPLHAKIHIRYH
Ga0187854_1032502623300017938PeatlandPDFAAMRQGGQYIGSKITSTGLIAKIGTYLLVITEKDEALTEFDYTLIPLRAKVQIRYN
Ga0187853_1009194723300017940PeatlandKITSTGLIAQIGKYLLVITEKDEALTEFDYTLIPLRAKVQIRYN
Ga0187853_1012993513300017940PeatlandRQGGQYIGSKITSTGLIAKIGKYLLVITEKDEALAEFDYTLIPLRPKVQIRYN
Ga0187853_1025172023300017940PeatlandRDKLPDFAAMRQGGQYIGSKITSTGLIAKIGKYLLVITEKDEALTEFDYTLIPLRAKVQIRYN
Ga0187850_1014173723300017941PeatlandIARIGKYLLVITEKDEALTEFDYTLIPLRAKVQIRYN
Ga0187850_1020418513300017941PeatlandIRDKLPDFAAMRQGGQYIGSKITSTGLIAKIGKYLLVITEKDEALTEFDYTLIPLRAKVQIRYN
Ga0187850_1031599033300017941PeatlandLDKLPYFAAMRQGGQYIVSNITSTGLISKIGKYLLVITEKDEALTEFDYTLIPLRAKVQIRYN
Ga0187879_1068462713300017946PeatlandKITSTGLIAKIGKYLLVITEKDEGLTEFDYTLIPLHAKVQTRYA
Ga0187781_1092158213300017972Tropical PeatlandFVGSKITSAGLIAKIGKYLLVNTEKDEALEEFDFTLIPLRAKTQIRYH
Ga0187780_1076677523300017973Tropical PeatlandDAHGASRDKLPDFEAMRQGGQYIGSKITSTGLIAKIGKYLLVITEQDEALTEFDYTLIPLRAKVQIRYN
Ga0187780_1099465013300017973Tropical PeatlandEDAQSSTREKLPDFEALKQGGQYVGPKITSTGLVAKIGKYLLVITEKDEELTEFDYTLIPQHPKVQIRYH
Ga0181520_1088178113300017988BogEDAHSTTRGKLPDFDAMRQGNTFIGSRITSAGLLAKIGKYLLVVTEKDEGLEEFDLTLIPLHAKIQIRYH
Ga0187891_105560613300017996PeatlandTGLIAQIGKYLLVITEKDEALTEFDYTLIPLRAKVQIRYN
Ga0187891_106438813300017996PeatlandTGLIAQIGKYLLVITEKDEALTEFDYTLIPLRAKIQIRYN
Ga0187891_130942013300017996PeatlandLIAKIGKYLLVITEKDEALTEFDYTLIPLHAKVQIRYN
Ga0187870_125617623300017998PeatlandHGASRDKLPDFAAMRQGGQYIGSKITSTGLIARIGKYLLVITEKDEALTEFDYTLIPLRAKVQIRYN
Ga0187815_1034647313300018001Freshwater SedimentGLIAKIGKYLLVITEKDEMLTEFDYTLIPLRAKVQIRYN
Ga0187868_100603913300018002PeatlandIGSKITSTGLIAQIGKYLLVITEKDEALTEFDYTLIPLRAKVQIRYN
Ga0187876_121284813300018003PeatlandHSTTRGKLPDFDAMREGNTFVGSKITSAVLVAKIGKYLLVITEKDEALEEFDFTLIPLHAKISLRYH
Ga0187865_101143223300018004PeatlandMRQGGQYVGSRITSTGLIAKIGKYLLVITEKDEALAEFDYTLIPLRAKVQIRYN
Ga0187865_104301213300018004PeatlandGLIAQIGKYLLVITEKDEALTEFDYTLIPLRAKVQIRYN
Ga0187878_107907423300018005PeatlandTSTGLIAKIGKYLLVITEKDEALTEFDYTLIPLRAKVQIRYN
Ga0187878_126778313300018005PeatlandDWEDAHGASRDKLPDFAAMRQGGQYIGSKITSTGLIAKIGKYLLVITEKDEALTEFDYTLIPLRPKVQIRYN
Ga0187878_129018613300018005PeatlandTFVGSKITSTGLIAKIGKYLLVITEKDEALEEFDYTLIPLHAKIQIRYH
Ga0187888_123553013300018008PeatlandREGNTFVGSKITSAGLLAKIGKYLLIVTEKDEALEEFDFTLIPMHAKVQIRYH
Ga0187888_126897513300018008PeatlandLIAQIGKYLLVITEKDEALTEFDYTLIPLRAKVQIRYN
Ga0187884_1005014813300018009PeatlandGGQYIGSKITSTGLIAQIGKYLLVITEKDEALTEFDYTLIPLRAKVQIRYN
Ga0187873_108647323300018013PeatlandDAHGASRDKLPDFAAMRQGGQYIGSKITSTGLIARIGKYLLVITEKDEALTEFDYTLIPLRAKVQIRYN
Ga0187873_112378623300018013PeatlandAHSTTRGRLPDFDAMREGNTFVGSKITSAGLMAKIGKYLLIITEKDEALEEFDFTLIPLHAKIQIRYH
Ga0187873_128803623300018013PeatlandGGQYIGSKITSTGLIAKIGKYLLVITEKDEALTEFDYTLIPLRAKVQIRYN
Ga0187860_134808223300018014PeatlandSKITSTGLIAKIGKYLLVITEKDEALTEFDYTLIPLHAKVQIRYN
Ga0187866_113723113300018015PeatlandTGLIAKIGKYLLVITEKDEGLEEFDYTLIPLHAKIQIRYH
Ga0187880_132674723300018016PeatlandGASRDKLPDFDAMRQGGQYIGSKITSTGLIAKIGKYLLVITEKDEALTEFDYTLIPLHAKVQIRYA
Ga0187872_1010148423300018017PeatlandDKLPDFAAMRQGGQYIGSKITSTGLIAKIGKYLLVITEKDEALTEFDYTLIPLHAKVQIRYN
Ga0187861_1004204513300018020PeatlandKITSTGLIAKIGKYLLVITEKDEALTEFDYTLIPLRAKVQIRYN
Ga0187861_1036258123300018020PeatlandDWEDAHGASRDKLPDFAAMRQGGQYIGSKITSTGLIARIGKYLLVITEKDEALTEFDYTLIPLRAKVQIRYN
Ga0187882_109640313300018021PeatlandAKIGKYLLVITEKDEALTEFDYTLIPLRPKVQIRYN
Ga0187882_142386613300018021PeatlandKIGKYLLVITEKDEALTEFDYTLIPLRPKVQIRYN
Ga0187864_1018864423300018022PeatlandLIAKIGKYLLVITEKDEALTEFDYTLIPLRAKVQIRYN
Ga0187881_1000950073300018024PeatlandGLIAKIGKYLLVITEKDEGLEEFDYTLIPLHAKIQIRYH
Ga0187881_1006458813300018024PeatlandKIGKYLLVITEKDEALTEFDYTLIPLRAKVQIRYN
Ga0187881_1031529513300018024PeatlandIGSKITSTGLIAKIGKYLLVITEKDEALTEFDYTLIPLRAKVQIRYN
Ga0187881_1047708923300018024PeatlandGQYIGSKITSTGLIARIGKYLLVITEKDEALTEFDYTLIPLRAKVQIRYN
Ga0187863_1079986223300018034PeatlandAHSTTRGKLPDFDAMRNGNTFVGSKITSAGLIAKIGKYLLVITEKDEPLEEFDFTLIPLHAKIQLRYH
Ga0187855_1020240833300018038PeatlandPDFDAMRNGNTFVGSKITSAGLIAKIGKYLLVITEKDEPLEEFDFTLIPLHAKIQLRYH
Ga0187862_1001988943300018040PeatlandTGLIAKIGKYLLVITEKDEGLTEFDYTLIPLHAKVQIRYA
Ga0187871_1084115023300018042PeatlandFVGSKITSAGLLAKIGKYLLIITEKDEALEEFDFTLIPLHAKIQIRYH
Ga0187887_1020664233300018043PeatlandFVGSKITSAGLMAKIGKYLLIVTEKDEALEEFDFTLIPLHAKIQIRYH
Ga0187858_1015867613300018057PeatlandHGASRDKLPDFDAMRQGGQYIGSKITSTGLIAKIGKYLLVITEKDEGLTEFDYTLIPLHAKVQIRYA
Ga0187784_1035906613300018062Tropical PeatlandLPDFDAMRQGGQYVGSKITSTGLIAKIGKYLLVITEKDEALTEFDYTLIPLRAKVQIRYN
Ga0187784_1088353523300018062Tropical PeatlandLPDFDAMRQGGQYIGSKITSTGLIAKIGKYLLVITEKDESLTEFDYTLIPLRAKIQIRYN
Ga0187784_1155948123300018062Tropical PeatlandMRTANTFVGSKITSAGLVAKIGKYLLVITEKDEALEEFDFTLIPLHAKIQLRYH
Ga0187772_1110722413300018085Tropical PeatlandKITSAGLIAKIGKYLLVITEKDEALEEFDFTLIPLHAKIQLRYH
Ga0187769_1056995923300018086Tropical PeatlandGASRDKLPDFDAMRQGGQYVGSKITSTGLIAKIGKYLLVITEKDETLTEFDYTLIPLRAKVQIRYN
Ga0187769_1077099423300018086Tropical PeatlandGSKITSTGLIAKIGKYLLVITEKDEKLTEFDYTLIPLRAKIQIRYT
Ga0187771_1011945223300018088Tropical PeatlandAKIGKYLLVITEQDEALTEFDYTLIPLRAKVQIRYN
Ga0187771_1062562223300018088Tropical PeatlandGSKITSAGLIAKIGKYLLVITEKDEALEEFDFTLIPLRAKTQIRYH
Ga0187771_1081699613300018088Tropical PeatlandKLPDFDAMRQGGQYVGSKITSTGLIAKIGKYLLVITEKDETLTEFDYTLIPLHAKVQIRY
Ga0187771_1089445713300018088Tropical PeatlandLPDFDAMRQGGAFVGSKITSAGLIAKIGKYLLVITEKDEALEEFDFTLIPLRAKTQIRYH
Ga0187771_1091131123300018088Tropical PeatlandIAKIGKYLLVITEQDEALTEFDYTLIPLRAKVQIRFN
Ga0187771_1096542813300018088Tropical PeatlandITSTGLIAKIGKYLLVITEKDETLTEFDYTLIPLRAKVHIRYN
Ga0187770_1059786623300018090Tropical PeatlandYAGSKITSTGRIAKIGKYLLVITEKDEALTEFDYTLIPLRDKVQIRYN
Ga0187852_108930613300019082PeatlandKITSAGLIAKIGKYLLVITEKDEALTEFDYTLIPLHAKVQIRYN
Ga0208036_107219523300025419PeatlandGQYIGSKITSTGLIAKIGKYLLVITEKDEALTEFDYTLIPLRPKVQIRYN
Ga0208821_105859413300025432PeatlandTSTGLIAKIGKYLLVITEKDEALTEFDYTLIPLYAKVQIRYN
Ga0208323_103042023300025439PeatlandKLPDFDAMREGNTFVGSKITSAGLLAKIGKYLLIITEKDEALEEFDFTLIPLHAKIQIRY
Ga0208189_105392813300025444PeatlandAKIGKYLLVITEKDEALTEFDYTLIPLHAKVQIRYA
Ga0208037_100298513300025448PeatlandSTGLIAKIGKYLLVITEKDEALTEFDYTLIPLRAKVQIRYN
Ga0208037_105094723300025448PeatlandQYIGSKITSTGLIARIGKYLLVITEKDEALTEFDYTLIPLRAKVQIRYN
Ga0208562_102480223300025460PeatlandAHGAIRDKLPDFAAMRQGGQYIGSKITSTGLIAKIGKYLLVITEKDEALTEFDYTLIPLYAKVQIRYN
Ga0208562_107047823300025460PeatlandGSKITSAGLLAKIGKYLLIITEKDEALEEFDFTLIPLHAKIQVRYH
Ga0208687_107147323300025469PeatlandYIGSKITSTGLIAKIGKYLLVITEKDEALTEFDYTLIPLRAKVQIRYN
Ga0208563_111566513300025501PeatlandTSTGLIAKIGKYLLVITEKDEGLTEFDYTLIPLHAKVQIRYA
Ga0209698_1094940513300027911WatershedsFDAMRTANTLVGSKITSAGLVAKIGKYLLVITEKDEALEEFDFTLIPLHAKIQLRYH
Ga0247275_115400013300029817SoilIGSKITSTGLIAKIGKYLLVITEKDEMLTEFDYTLIPLRAKVQIRYN
Ga0315294_1148789313300031952SedimentKLPDFEAMRQGRQYIGSKITSAGLIAKIGKYLLVITEKDEALTEFDYTLVPRRAKIQIRY
Ga0315295_1092497813300032156SedimentQYVGPKITSTGLIGRIGRYLLVITETDEALLEFDYTLIPLRAKIQVRYH
Ga0315268_1001720473300032173SedimentGLVGKIGKYLLVITEKDEALTEFDYTLIPLRPVVRIRYM
Ga0335078_1247816013300032805SoilVGSKITSAGLIAKIGKYLPVITEKDEALEEFDFTLIPLHAKISLRYH
Ga0335080_1117236023300032828SoilSFVGSRITSTGLIGKIGKYLLIITEKDEALEEFDYTLIPLHAKIHIRYH
Ga0335081_1069067723300032892SoilMREGNVFVGSKITSTGLIAKIGKYLLIITEKDEALEEFDFTLIPLHAKT
Ga0335081_1130720913300032892SoilRQGNSFVGSKITSAGLVAKIGKYLLVITEKDEPLEEFDYTLIPLHAKIQLRYH
Ga0335069_1046480823300032893SoilKLPDFDAMRQGGQYVGSKITSTGLVAKIGKYLLVITEKDEALTEFDYTLIPLHSKVQIRY
Ga0335074_1071455413300032895SoilVAKIGKYLLVITEKDEALEEFDFTLIPLHAKIQLRYH
Ga0335074_1149097513300032895SoilKLPSFDAMRNGNGFVGSKITSAGLIAKIGKYLLVITEKDEALEEFDFTLIPLHAKIQLRY
Ga0326728_1056166213300033402Peat SoilQGSTFVGSKITSTGLIAKIGKYLLVITEKDEALEEFDYTLIPLHAKIQIRYH
Ga0314861_0250603_637_8013300033977PeatlandMRQGGQYIGSKITSTGLIAKIGKYLLVITEKDETLTEFDYTLIPLHAKVQIRYN
Ga0371487_0184454_891_10103300033982Peat SoilGLIAKIGKYLLVITEKDEGLTEFDYTLIPLRAKVQIRYA
Ga0326724_0660319_399_5123300034091Peat SoilLAKIGKYLLIITEKDEALEEFDFTLIPLQAKIQIRYH

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.