Basic Information | |
---|---|
Family ID | F054288 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 140 |
Average Sequence Length | 42 residues |
Representative Sequence | ELVLQAADKALYRAKANGRNRVETATSPRRRTRIKAAGIA |
Number of Associated Samples | 127 |
Number of Associated Scaffolds | 140 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 95.00 % |
Associated GOLD sequencing projects | 123 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.29 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (57.857 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (20.714 % of family members) |
Environment Ontology (ENVO) | Unclassified (21.429 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 22.06% β-sheet: 0.00% Coil/Unstructured: 77.94% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.29 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 140 Family Scaffolds |
---|---|---|
PF00990 | GGDEF | 5.00 |
PF03928 | HbpS-like | 3.57 |
PF01568 | Molydop_binding | 2.86 |
PF13180 | PDZ_2 | 2.14 |
PF07992 | Pyr_redox_2 | 2.14 |
PF13411 | MerR_1 | 2.14 |
PF00072 | Response_reg | 1.43 |
PF14310 | Fn3-like | 1.43 |
PF00188 | CAP | 0.71 |
PF00703 | Glyco_hydro_2 | 0.71 |
PF02538 | Hydantoinase_B | 0.71 |
PF01243 | Putative_PNPOx | 0.71 |
PF02614 | UxaC | 0.71 |
PF02371 | Transposase_20 | 0.71 |
PF13005 | zf-IS66 | 0.71 |
PF00076 | RRM_1 | 0.71 |
PF12849 | PBP_like_2 | 0.71 |
PF05336 | rhaM | 0.71 |
PF05569 | Peptidase_M56 | 0.71 |
PF00218 | IGPS | 0.71 |
PF13365 | Trypsin_2 | 0.71 |
COG ID | Name | Functional Category | % Frequency in 140 Family Scaffolds |
---|---|---|---|
COG0146 | N-methylhydantoinase B/oxoprolinase/acetone carboxylase, alpha subunit | Amino acid transport and metabolism [E] | 1.43 |
COG0134 | Indole-3-glycerol phosphate synthase | Amino acid transport and metabolism [E] | 0.71 |
COG1904 | Glucuronate isomerase | Carbohydrate transport and metabolism [G] | 0.71 |
COG2340 | Spore germination protein YkwD and related proteins with CAP (CSP/antigen 5/PR1) domain | Cell cycle control, cell division, chromosome partitioning [D] | 0.71 |
COG3250 | Beta-galactosidase/beta-glucuronidase | Carbohydrate transport and metabolism [G] | 0.71 |
COG3254 | L-rhamnose mutarotase | Cell wall/membrane/envelope biogenesis [M] | 0.71 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.71 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 57.86 % |
All Organisms | root | All Organisms | 42.14 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000364|INPhiseqgaiiFebDRAFT_101853859 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1588 | Open in IMG/M |
3300001661|JGI12053J15887_10419164 | Not Available | 642 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101078421 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
3300002568|C688J35102_119448184 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 697 | Open in IMG/M |
3300004091|Ga0062387_101798523 | Not Available | 500 | Open in IMG/M |
3300004152|Ga0062386_100021628 | All Organisms → cellular organisms → Bacteria | 4706 | Open in IMG/M |
3300004631|Ga0058899_10115878 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
3300004633|Ga0066395_10342455 | Not Available | 829 | Open in IMG/M |
3300005176|Ga0066679_10761118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Acidithiobacillia → Acidithiobacillales → Thermithiobacillaceae → Thermithiobacillus → Thermithiobacillus tepidarius | 622 | Open in IMG/M |
3300005186|Ga0066676_10590184 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 753 | Open in IMG/M |
3300005537|Ga0070730_10404503 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 883 | Open in IMG/M |
3300005541|Ga0070733_10237399 | All Organisms → cellular organisms → Bacteria | 1197 | Open in IMG/M |
3300005541|Ga0070733_10896684 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300005542|Ga0070732_10856306 | Not Available | 555 | Open in IMG/M |
3300005564|Ga0070664_100137058 | All Organisms → cellular organisms → Bacteria | 2153 | Open in IMG/M |
3300005602|Ga0070762_10039411 | All Organisms → cellular organisms → Bacteria | 2565 | Open in IMG/M |
3300005602|Ga0070762_10470148 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
3300005712|Ga0070764_10371892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium lusitanum | 839 | Open in IMG/M |
3300005884|Ga0075291_1006619 | All Organisms → cellular organisms → Bacteria | 1252 | Open in IMG/M |
3300006052|Ga0075029_100423074 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 869 | Open in IMG/M |
3300006052|Ga0075029_101306617 | Not Available | 509 | Open in IMG/M |
3300006086|Ga0075019_10083764 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1819 | Open in IMG/M |
3300006173|Ga0070716_100473631 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
3300006174|Ga0075014_100482494 | Not Available | 691 | Open in IMG/M |
3300006893|Ga0073928_10889133 | Not Available | 611 | Open in IMG/M |
3300009521|Ga0116222_1029168 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2452 | Open in IMG/M |
3300009522|Ga0116218_1082681 | Not Available | 1463 | Open in IMG/M |
3300009523|Ga0116221_1156386 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 992 | Open in IMG/M |
3300009636|Ga0116112_1085445 | Not Available | 896 | Open in IMG/M |
3300009641|Ga0116120_1254543 | Not Available | 550 | Open in IMG/M |
3300009764|Ga0116134_1099125 | Not Available | 1056 | Open in IMG/M |
3300010159|Ga0099796_10396560 | Not Available | 604 | Open in IMG/M |
3300010343|Ga0074044_10211613 | All Organisms → cellular organisms → Bacteria | 1286 | Open in IMG/M |
3300011120|Ga0150983_15843080 | Not Available | 510 | Open in IMG/M |
3300011270|Ga0137391_10779799 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 789 | Open in IMG/M |
3300012212|Ga0150985_100844009 | Not Available | 530 | Open in IMG/M |
3300012532|Ga0137373_10730355 | Not Available | 736 | Open in IMG/M |
3300012923|Ga0137359_10872645 | Not Available | 777 | Open in IMG/M |
3300012923|Ga0137359_11555455 | Not Available | 549 | Open in IMG/M |
3300012944|Ga0137410_11291170 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
3300012987|Ga0164307_10870398 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 722 | Open in IMG/M |
3300014201|Ga0181537_10734552 | Not Available | 671 | Open in IMG/M |
3300014501|Ga0182024_10042115 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7468 | Open in IMG/M |
3300014501|Ga0182024_11085835 | Not Available | 946 | Open in IMG/M |
3300014838|Ga0182030_10268839 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Bryocella → Bryocella elongata | 1923 | Open in IMG/M |
3300017822|Ga0187802_10282786 | Not Available | 645 | Open in IMG/M |
3300017927|Ga0187824_10074304 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
3300017933|Ga0187801_10420011 | Not Available | 558 | Open in IMG/M |
3300017937|Ga0187809_10318273 | Not Available | 577 | Open in IMG/M |
3300017955|Ga0187817_10936479 | Not Available | 554 | Open in IMG/M |
3300018009|Ga0187884_10306361 | Not Available | 642 | Open in IMG/M |
3300018057|Ga0187858_10261445 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1107 | Open in IMG/M |
3300018058|Ga0187766_11126680 | Not Available | 565 | Open in IMG/M |
3300019268|Ga0181514_1499090 | Not Available | 807 | Open in IMG/M |
3300019887|Ga0193729_1277453 | Not Available | 511 | Open in IMG/M |
3300020579|Ga0210407_10359720 | Not Available | 1139 | Open in IMG/M |
3300020582|Ga0210395_10503148 | Not Available | 912 | Open in IMG/M |
3300020583|Ga0210401_11580034 | Not Available | 513 | Open in IMG/M |
3300021171|Ga0210405_10239139 | All Organisms → cellular organisms → Bacteria | 1437 | Open in IMG/M |
3300021180|Ga0210396_10459761 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1116 | Open in IMG/M |
3300021402|Ga0210385_11231837 | Not Available | 574 | Open in IMG/M |
3300021404|Ga0210389_10385741 | All Organisms → cellular organisms → Bacteria | 1101 | Open in IMG/M |
3300021407|Ga0210383_11207480 | Not Available | 635 | Open in IMG/M |
3300021474|Ga0210390_10051718 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3377 | Open in IMG/M |
3300021474|Ga0210390_11056480 | Not Available | 661 | Open in IMG/M |
3300021474|Ga0210390_11505386 | Not Available | 532 | Open in IMG/M |
3300021478|Ga0210402_12009326 | Not Available | 504 | Open in IMG/M |
3300022502|Ga0242646_1026895 | All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba polyphaga | 574 | Open in IMG/M |
3300022502|Ga0242646_1036046 | Not Available | 524 | Open in IMG/M |
3300022504|Ga0242642_1022347 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
3300022505|Ga0242647_1017650 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 694 | Open in IMG/M |
3300022506|Ga0242648_1070611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Agrobacterium → Agrobacterium rhizogenes | 567 | Open in IMG/M |
3300022528|Ga0242669_1054174 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
3300022532|Ga0242655_10027129 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_1_40CM_3_55_5 | 1279 | Open in IMG/M |
3300022533|Ga0242662_10259208 | Not Available | 567 | Open in IMG/M |
3300022714|Ga0242671_1090418 | Not Available | 569 | Open in IMG/M |
3300022717|Ga0242661_1050332 | Not Available | 776 | Open in IMG/M |
3300022717|Ga0242661_1142041 | Not Available | 533 | Open in IMG/M |
3300022717|Ga0242661_1156338 | Not Available | 515 | Open in IMG/M |
3300022732|Ga0224569_104115 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1115 | Open in IMG/M |
3300022733|Ga0224562_1010850 | Not Available | 724 | Open in IMG/M |
3300022840|Ga0224549_1019199 | Not Available | 949 | Open in IMG/M |
3300023056|Ga0233357_1025451 | Not Available | 717 | Open in IMG/M |
3300023672|Ga0247553_102402 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 864 | Open in IMG/M |
3300025477|Ga0208192_1075070 | Not Available | 631 | Open in IMG/M |
3300025916|Ga0207663_10072437 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2227 | Open in IMG/M |
3300026294|Ga0209839_10039886 | Not Available | 1740 | Open in IMG/M |
3300027565|Ga0209219_1042087 | Not Available | 1138 | Open in IMG/M |
3300027575|Ga0209525_1040255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Agrobacterium → Agrobacterium rhizogenes | 1148 | Open in IMG/M |
3300027576|Ga0209003_1045930 | Not Available | 771 | Open in IMG/M |
3300027576|Ga0209003_1061100 | Not Available | 682 | Open in IMG/M |
3300027591|Ga0209733_1029366 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1481 | Open in IMG/M |
3300027635|Ga0209625_1070100 | Not Available | 784 | Open in IMG/M |
3300027696|Ga0208696_1198818 | Not Available | 635 | Open in IMG/M |
3300027867|Ga0209167_10068199 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1774 | Open in IMG/M |
3300027867|Ga0209167_10776750 | Not Available | 522 | Open in IMG/M |
3300027884|Ga0209275_10904722 | Not Available | 509 | Open in IMG/M |
3300027889|Ga0209380_10692073 | Not Available | 585 | Open in IMG/M |
3300027895|Ga0209624_10664670 | Not Available | 689 | Open in IMG/M |
3300027898|Ga0209067_10067398 | Not Available | 1832 | Open in IMG/M |
3300027908|Ga0209006_11466209 | Not Available | 518 | Open in IMG/M |
3300027911|Ga0209698_10953564 | Not Available | 641 | Open in IMG/M |
3300028016|Ga0265354_1011340 | Not Available | 848 | Open in IMG/M |
3300028565|Ga0302145_10234918 | Not Available | 610 | Open in IMG/M |
3300028766|Ga0302269_1185492 | Not Available | 588 | Open in IMG/M |
3300028780|Ga0302225_10467281 | Not Available | 590 | Open in IMG/M |
3300028806|Ga0302221_10421848 | Not Available | 581 | Open in IMG/M |
3300028906|Ga0308309_11609201 | Not Available | 553 | Open in IMG/M |
3300029916|Ga0302148_1086834 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
3300029919|Ga0302141_1019779 | All Organisms → cellular organisms → Bacteria | 1850 | Open in IMG/M |
3300029939|Ga0311328_10210109 | All Organisms → cellular organisms → Bacteria | 1498 | Open in IMG/M |
3300030051|Ga0302195_10401876 | Not Available | 593 | Open in IMG/M |
3300030054|Ga0302182_10398060 | Not Available | 576 | Open in IMG/M |
3300030507|Ga0302192_10337942 | Not Available | 623 | Open in IMG/M |
3300030520|Ga0311372_12550036 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
3300030528|Ga0210277_10341185 | All Organisms → cellular organisms → Eukaryota | 1152 | Open in IMG/M |
3300030598|Ga0210287_1244241 | Not Available | 510 | Open in IMG/M |
3300030677|Ga0302317_10425295 | Not Available | 584 | Open in IMG/M |
3300030738|Ga0265462_12307750 | Not Available | 532 | Open in IMG/M |
3300030813|Ga0265750_1074583 | Not Available | 555 | Open in IMG/M |
3300030815|Ga0265746_1010760 | Not Available | 1017 | Open in IMG/M |
3300030836|Ga0265767_112041 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 593 | Open in IMG/M |
3300030862|Ga0265753_1137031 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
3300030874|Ga0265742_1011529 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 681 | Open in IMG/M |
3300030878|Ga0265770_1085785 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 622 | Open in IMG/M |
3300030880|Ga0265776_110095 | Not Available | 556 | Open in IMG/M |
3300030940|Ga0265740_1018307 | Not Available | 703 | Open in IMG/M |
3300031028|Ga0302180_10099433 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1668 | Open in IMG/M |
3300031028|Ga0302180_10243832 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 947 | Open in IMG/M |
3300031057|Ga0170834_102703372 | Not Available | 557 | Open in IMG/M |
3300031128|Ga0170823_15167666 | Not Available | 633 | Open in IMG/M |
3300031231|Ga0170824_116507757 | Not Available | 501 | Open in IMG/M |
3300031232|Ga0302323_102976365 | Not Available | 541 | Open in IMG/M |
3300031238|Ga0265332_10394874 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
3300031715|Ga0307476_10820274 | Not Available | 687 | Open in IMG/M |
3300031821|Ga0318567_10386020 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
3300031823|Ga0307478_10947899 | Not Available | 720 | Open in IMG/M |
3300032895|Ga0335074_11258827 | Not Available | 616 | Open in IMG/M |
3300033158|Ga0335077_10494465 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1295 | Open in IMG/M |
3300033475|Ga0310811_10412890 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1469 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 20.71% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.29% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 8.57% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.00% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 5.00% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.29% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.29% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.29% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.29% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.57% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.86% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.86% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.14% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.14% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.14% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.43% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.43% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.43% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.43% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.43% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.43% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.71% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.71% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.71% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.71% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.71% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.71% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.71% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.71% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.71% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.71% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.71% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.71% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.71% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.71% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005884 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_302 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
3300009636 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 | Environmental | Open in IMG/M |
3300009641 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 | Environmental | Open in IMG/M |
3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300019268 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300022502 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022504 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022505 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022506 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-26-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022528 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022714 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022717 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU1 | Host-Associated | Open in IMG/M |
3300022733 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU3 | Environmental | Open in IMG/M |
3300022840 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 1-5 | Environmental | Open in IMG/M |
3300023056 | Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS2 | Environmental | Open in IMG/M |
3300023672 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025477 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027576 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Host-Associated | Open in IMG/M |
3300028565 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_3 | Environmental | Open in IMG/M |
3300028766 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_2 | Environmental | Open in IMG/M |
3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
3300028806 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029916 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_1 | Environmental | Open in IMG/M |
3300029919 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_2 | Environmental | Open in IMG/M |
3300029939 | I_Bog_E3 coassembly | Environmental | Open in IMG/M |
3300030051 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_2 | Environmental | Open in IMG/M |
3300030054 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1 | Environmental | Open in IMG/M |
3300030507 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_2 | Environmental | Open in IMG/M |
3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300030528 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO084SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030598 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO747-VDE048SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030677 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_3 | Environmental | Open in IMG/M |
3300030738 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assembly | Environmental | Open in IMG/M |
3300030813 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030815 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030836 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030862 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030874 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030880 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030940 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Host-Associated | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
INPhiseqgaiiFebDRAFT_1018538591 | 3300000364 | Soil | TAATERSSPETVLESADKALYRAKANGRNRVETATSAPRRMRTKTAGIA* |
JGI12053J15887_104191642 | 3300001661 | Forest Soil | PDVEEVVQAADKALYRAKAAGRNRVESAVSPRRRVRAQTAGIA* |
JGIcombinedJ26739_1010784211 | 3300002245 | Forest Soil | QAADKALYRAKSAGRNRIETEAAPRRAVRTRAAGIA* |
C688J35102_1194481841 | 3300002568 | Soil | SDPDAVLQAADKALYRAKANGRNRVETATPPRKAGAKAAGIA* |
Ga0062387_1017985231 | 3300004091 | Bog Forest Soil | SAREDSDPELVLQAADKALYRAKANGRNRVETATAPRRRTRIKAVGIA* |
Ga0062386_1000216283 | 3300004152 | Bog Forest Soil | ASSSNEGLSTDEVVQAADKALYRAKAGGRNRIETASSPRRRSRSKAAGG* |
Ga0058899_101158783 | 3300004631 | Forest Soil | NPSAEEVVRAADKALYRAKAAGRNRVESASAPRRRVRSKAAGIA* |
Ga0066395_103424551 | 3300004633 | Tropical Forest Soil | DTESVLKAADKALYRAKENGRNRVETTSPVRRTRSKTAGIA* |
Ga0066679_107611181 | 3300005176 | Soil | EEVIQAADKALYRAKAGGRNRIETASAPRRRMRAKSAGIA* |
Ga0066676_105901842 | 3300005186 | Soil | PHSVLQAADKALYRAKANGRNRVETAAITRKAGAKTAGIA* |
Ga0070730_104045031 | 3300005537 | Surface Soil | DHVLQAADKALYRAKENGRNRVEIASSTRRKTRVKAAGIA* |
Ga0070733_102373991 | 3300005541 | Surface Soil | VASSFPEKSNPDFVLQAADKALYRAKANGRNRLEASPASRQREDRGKAAGIA* |
Ga0070733_108966842 | 3300005541 | Surface Soil | EEVIQAADKALYRAKAGGRNRVETGGAARRRRSRGKAADIA* |
Ga0070732_108563062 | 3300005542 | Surface Soil | ANPEQVLQAADKALYRAKANGRNRVETAASVRRRPRVKAAGIA* |
Ga0070664_1001370584 | 3300005564 | Corn Rhizosphere | PDAVLQAADKALYRAKANGRNRVETATPPRKAGAKAAGIA* |
Ga0070762_100394114 | 3300005602 | Soil | SDDTRPEDVIESADKALYRAKANGRNRVELAPSPRQPNRAKAAGIA* |
Ga0070762_104701483 | 3300005602 | Soil | DAVPEAVIQAADKALYRAKSAGRNRIETETAPRRAVRTRAAGIA* |
Ga0070764_103718921 | 3300005712 | Soil | EHVLQAADKALYRAKANGRNRVETASAARKRPRVKAAGIA* |
Ga0075291_10066194 | 3300005884 | Rice Paddy Soil | GKRRSDPQAVLQAADKALYRAKANGRNRVESSSTPRKTGAKAAGIA* |
Ga0075029_1004230741 | 3300006052 | Watersheds | ADKALYRAKANGRNRVEISISARRRSRVKAEGIA* |
Ga0075029_1013066172 | 3300006052 | Watersheds | LHPDGVLEAADKALYRAKDNGRNRVETAASARRRRAKAAGIA* |
Ga0075019_100837643 | 3300006086 | Watersheds | VLRAADQALYRAKGAGRNRVETASSLDRRTRTASIA* |
Ga0070716_1004736313 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | TSHESSDTESVVKSADKALYRAKEAGRNRVETASPVRRVRSKTAGIA* |
Ga0075014_1004824941 | 3300006174 | Watersheds | KQKPSPELVLQSADKALYRAKANGRNRVETATAGRRSRVKAAGIA* |
Ga0073928_108891331 | 3300006893 | Iron-Sulfur Acid Spring | IQAADKALYRAKAAGRNRVETAAAPHRRTRTKAAGIA* |
Ga0116222_10291681 | 3300009521 | Peatlands Soil | GEDTTESIVQAADRALYRAKAAGRNRVESDALSRRRSRAKAVGIA* |
Ga0116218_10826811 | 3300009522 | Peatlands Soil | ELVLQAADKALYRAKANGRNRVETATSPRRRTRIKAAGIA* |
Ga0116221_11563863 | 3300009523 | Peatlands Soil | AADKALYRAKANGRNRIETAAPARRRRVKAAGIA* |
Ga0116112_10854451 | 3300009636 | Peatland | ADKALYRAKAAGRNRVEIASSARRRTRSKAAGIA* |
Ga0116120_12545431 | 3300009641 | Peatland | ADEVIQAADKALYRAKAAGRNRVEIASSARRRTRSKAAGIA* |
Ga0116134_10991251 | 3300009764 | Peatland | QAADKALYRAKAAGRNRVEIASSARRRTRSKAAGIA* |
Ga0099796_103965602 | 3300010159 | Vadose Zone Soil | EEVIQAADQALYRAKAAGRNRIETASAPRRRIRAKSAGIA* |
Ga0074044_102116131 | 3300010343 | Bog Forest Soil | ATSSKEALRPEAVLQAADQALYRAKGNGRNRVETASSTRRKTRVKAGIA* |
Ga0150983_158430802 | 3300011120 | Forest Soil | VATSRRENPSAEEVVQAADKALYRAKGAGRNRVETAAGPKRRVRTKAAGIA* |
Ga0137391_107797991 | 3300011270 | Vadose Zone Soil | KPAAEEVMQAADKALYRAKAVGRNRIETAAPKRKVRTKAAGIA* |
Ga0150985_1008440091 | 3300012212 | Avena Fatua Rhizosphere | PSMREGHEADQVIRAADKAPYRAKAAGRNRVETTAPPRRGARDKSA* |
Ga0137373_107303551 | 3300012532 | Vadose Zone Soil | PDVVLHAADKALYRAKAGGRNRVETASVARRRSRVKAAGIA* |
Ga0137359_108726451 | 3300012923 | Vadose Zone Soil | AKEGSEPDLVLQAADKALYRAKANGRNRVETASVPRRRSRVKAAGIA* |
Ga0137359_115554551 | 3300012923 | Vadose Zone Soil | ADKALYRAKAAGRNRVETAISPRRRVRAQTAGIA* |
Ga0137410_112911701 | 3300012944 | Vadose Zone Soil | TDLVLQAADKALYRAKDNGRNRVETASAKRGRAKTVEIA* |
Ga0164307_108703981 | 3300012987 | Soil | VLQAADKALYRAKANGRNRVETATPPRKAGAKAAGIA* |
Ga0181537_107345521 | 3300014201 | Bog | TAEEVLQAADKALYRAKAAGRNRIETAESPRRRTRSKAAGIA* |
Ga0182024_100421158 | 3300014501 | Permafrost | SSPDDVVKAADKALYRAKDGGRNRVETALAGRRARSKTSGIA* |
Ga0182024_110858351 | 3300014501 | Permafrost | NSNPDSVLEAADKALYRAKDNGRNRVETAPARRRSRARAAGIA* |
Ga0182030_102688393 | 3300014838 | Bog | QAADQALYRAKGNGRNRVETASSTRRKTRVKAGIA* |
Ga0187802_102827862 | 3300017822 | Freshwater Sediment | VVLKAADKALYRAKANGRNRLETASPVRGARVKTAGIA |
Ga0187824_100743041 | 3300017927 | Freshwater Sediment | EMVLQDADKALYRAKENGRNRLETTATTRRTGTRLNAARA |
Ga0187801_104200112 | 3300017933 | Freshwater Sediment | VQSADKALYRAKAGGRNRIETATSARRRRTRAKAAGSA |
Ga0187809_103182731 | 3300017937 | Freshwater Sediment | APEETVQAADKALYRAKAAGRNRVETASAFPSRRPRAKAAGIA |
Ga0187817_109364791 | 3300017955 | Freshwater Sediment | AADKALYRAKANGRNRVEPASSTRRKTRVKAAGIA |
Ga0187884_103063612 | 3300018009 | Peatland | AADKALYRAKSNGRNRVETASVARRRSREKAAGIA |
Ga0187858_102614451 | 3300018057 | Peatland | LQAADKALYRAKANGRNRVETASSANRRTRIKAAGIA |
Ga0187766_111266802 | 3300018058 | Tropical Peatland | TSGKEPSDPDLVLQAADKALYRAKANGRNRLETASSVRSGRAKTAGIA |
Ga0181514_14990901 | 3300019268 | Peatland | ANPSAEDVIQAADRALYRAKAGGRNRIETASASRRRNKAAGIA |
Ga0193729_12774531 | 3300019887 | Soil | EEVILAADKALYRAKAAGRNRIETASPPRRQVRMKSAGIA |
Ga0210407_103597201 | 3300020579 | Soil | GESDPERVLQAADKALYRAKANGRNRVETASSVRLRTRVKTAVIA |
Ga0210395_105031481 | 3300020582 | Soil | LQAADKALYRAKANGRNRVETASAARKRPRVKAAGIA |
Ga0210401_115800341 | 3300020583 | Soil | KGENPSAEEVVRAADKALYRAKAAGRNRVESASAPRRRVRSKAAGIA |
Ga0210405_102391394 | 3300021171 | Soil | SAEEVIQAADRALYRAKAAGRNRIETASASRRRVRSKAAGIA |
Ga0210396_104597611 | 3300021180 | Soil | SAEEVIQAADKALYRAKAAGRNRIETASAPRRRSRAKSAGIA |
Ga0210385_112318371 | 3300021402 | Soil | DSMAKDVIKAADEALYRAKEGGRNRIETSSGRRRRARTKSAGIA |
Ga0210389_103857412 | 3300021404 | Soil | PEDVIESADKALYRAKANGRNRVELAPSPRQPNRAKAAGIA |
Ga0210383_112074801 | 3300021407 | Soil | QAADKALYRAKAAGRNRVETANAPRRRARGKAAAGIA |
Ga0210390_100517181 | 3300021474 | Soil | MDAADKALYRAKGNGRNRVETESAPRRRARVKTAGIA |
Ga0210390_110564802 | 3300021474 | Soil | VATSADEESDPALVLQAADKALYRAKANGRNRVETAASPRRRTRAKTAGIA |
Ga0210390_115053861 | 3300021474 | Soil | VVLEAADKALYRAKNNGRNRVETAASVRRRSSAKTAGIA |
Ga0210402_120093261 | 3300021478 | Soil | DLVLQAADKALYRAKANGRNRVETTSAVRRGRTKAVGIA |
Ga0242646_10268951 | 3300022502 | Soil | AKQEIDPEAVLQAADKALYRAKANGRNRLETAAVPRRRSRFKEAGIA |
Ga0242646_10360461 | 3300022502 | Soil | VVKAADKALYRAKAAGRNRVETASSSRHPARSKSAVTA |
Ga0242642_10223472 | 3300022504 | Soil | AKEESDPELVLQAADKALYRAKANGRNRLETATSPRRRTRIKAAGIA |
Ga0242647_10176502 | 3300022505 | Soil | AVLQAADKALYRAKANGRNRVETAGSSRRKARVEAGIA |
Ga0242648_10706111 | 3300022506 | Soil | SDPEHVLQAADKALYRAKANGRNRVETASAARKRPRVKAAGIA |
Ga0242669_10541742 | 3300022528 | Soil | VATASKKELYPDAVLQAADKALYRAKANGRNRVETAGSSRRKARVEAGIA |
Ga0242655_100271293 | 3300022532 | Soil | KEVIQAADKALYRAKAGGRNRVETTSASRRRVRAKSAGIA |
Ga0242662_102592081 | 3300022533 | Soil | ATSTKEKPDADLVLQAADKALYRAKANGRNRVETTSAVRRGRTKAVGIA |
Ga0242671_10904181 | 3300022714 | Soil | VLQAADKALYRAKANGRNRVETATGPRRRTRAKTAGIA |
Ga0242661_10503321 | 3300022717 | Soil | PALVLQAADKALYRAKANGRNRVETAASPRRRTRAKTAGIA |
Ga0242661_11420412 | 3300022717 | Soil | SDPEDVLQAADKALYRAKGNGRNRVETASSARRRTRVKTAGIA |
Ga0242661_11563381 | 3300022717 | Soil | NQSVEDVIQAADKALYRAKAAGRNRIETAAPGRRRVRNKTAGIA |
Ga0224569_1041152 | 3300022732 | Rhizosphere | PNRIMEAADKALYRAKGNGRNRVETESAPRRRARVKTAGIA |
Ga0224562_10108501 | 3300022733 | Soil | KAADKALYRAKAAGRNRIETAASRRRGVRTKAADIA |
Ga0224549_10191993 | 3300022840 | Soil | SAEEVIQAADKALYRAKAGGRNRIETAASPRRRTRSKAAGIA |
Ga0233357_10254511 | 3300023056 | Soil | AADKALYRAKANGRNRVETASAGRRRPRVKTVEIA |
Ga0247553_1024021 | 3300023672 | Soil | PDPNRIMEAADKALYRAKGNGRNRVETESAPRRRARVKTAGIA |
Ga0208192_10750701 | 3300025477 | Peatland | ASADEVIQAADKALYRAKAAGRNRVEIASSARRRTRSKAAGIA |
Ga0207663_100724373 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | DAVLQAADKALYRAKANGRNRVETATPPRKAGAKAAGIA |
Ga0209839_100398861 | 3300026294 | Soil | TTEKQTVEADLVLQAADKALYRAKANGRNRVETATSSRRRIRVKAAGIA |
Ga0209219_10420871 | 3300027565 | Forest Soil | EVIQAADKALYRAKAAGRNRIETASAARRRVSSKAAGIA |
Ga0209525_10402551 | 3300027575 | Forest Soil | AKEESDPEHVLQAADKALYRAKANGRNRVETASAARKRPRVKAAGIA |
Ga0209003_10459301 | 3300027576 | Forest Soil | LVLKAADKALYRAKANGRNRVETASAKRTRTKAAGIAG |
Ga0209003_10611001 | 3300027576 | Forest Soil | GPETVLESADKALYRAKANGRNRVEAATSSARRTRTRAAGIA |
Ga0209733_10293663 | 3300027591 | Forest Soil | PAEVLEAADKALYRAKANGRNRVETASSPRRRTRVKTAGIA |
Ga0209625_10701002 | 3300027635 | Forest Soil | GVATSATSVRAASDPAEVLEAADKALYRAKANGRNRVETASSSRRRTRVKTAGIA |
Ga0208696_11988181 | 3300027696 | Peatlands Soil | TSSKQELPAEEVLQAADKALYRAKANGRNRVETASSPRRKTRVAAGIA |
Ga0209167_100681991 | 3300027867 | Surface Soil | ESAEDVVKAADKALYRAKEGGRNRVETATSGRRRARSKAATA |
Ga0209167_107767501 | 3300027867 | Surface Soil | SDPDRVLQAADKALYRAKANGRNRVETASAPRRRNRVKAAGIA |
Ga0209275_109047221 | 3300027884 | Soil | DAVPEAVIQAADKALYRAKSAGRNRIETETAPRRAVRTRAAGIA |
Ga0209380_106920731 | 3300027889 | Soil | DVIESADKALYRAKANGRNRVELAPSPRQPNRAKAAGIA |
Ga0209624_106646702 | 3300027895 | Forest Soil | IQAADKALYRAKSAGRNRIETEAAPRRAVRARAAGIA |
Ga0209067_100673982 | 3300027898 | Watersheds | DPDAVLRAADQALYRAKGAGRNRVETASSLDRRTRTASIA |
Ga0209006_114662091 | 3300027908 | Forest Soil | PQQPHADLVLQAADKALYRAKENGRNRLETATAARRSRTKTAGIA |
Ga0209698_109535641 | 3300027911 | Watersheds | KQTVQTDSVLQAADKALYRAKANGRNRVEISISARRRSRVKAEGIA |
Ga0265354_10113401 | 3300028016 | Rhizosphere | GRENPSAEEVVQAADKALYRAKASGRNRIETASASRRRVRSKAAGIA |
Ga0302145_102349182 | 3300028565 | Bog | TAKGENPSADDVVQAADKALYRAKAGGRNRVETAAAPGRRARGKTAGIA |
Ga0302269_11854921 | 3300028766 | Bog | SAEEVTQAADKALYRAKAAGRNRIETAASPRRRTRSKAAGIA |
Ga0302225_104672811 | 3300028780 | Palsa | AEEVLQAADKALYRAKAAGRNRIEIASAPRRRTRTKAAGIA |
Ga0302221_104218481 | 3300028806 | Palsa | VIQAADKALYRAKAAGRNRIETASAPGRRTRTKAAGIA |
Ga0308309_116092011 | 3300028906 | Soil | ADAAAEAVIEAADRALYRAKSAGRNRVETESAPRRPVRARAAGIA |
Ga0302148_10868342 | 3300029916 | Bog | RNATAEEVIQAADKALYRAKAGGRNRIETESSSRRRVRSKAASTA |
Ga0302141_10197794 | 3300029919 | Bog | TRENPSSEEVIKAADKALYRAKDGGRNRIETASTPRRKARSKTAGIA |
Ga0311328_102101093 | 3300029939 | Bog | TSRQEDSSAEEVTQAADKALYRAKAAGRNRIETAASPRRRTRSKAAGIA |
Ga0302195_104018761 | 3300030051 | Bog | CSAEQIVQAADKALYRAKAAGRNRIETASSPRRRVRTKTAGIA |
Ga0302182_103980601 | 3300030054 | Palsa | PSAEEVIQAADKALYRAKAAGRNRIETASAPGRRTRTKAAGIA |
Ga0302192_103379421 | 3300030507 | Bog | EVTQAADKALYRAKAAGRNRIETAASPRRRTRSKAAGIA |
Ga0311372_125500362 | 3300030520 | Palsa | STEENPDPNRIMDAADKALYRAKGNGRNRVETASAPRRRARVKTAGIA |
Ga0210277_103411851 | 3300030528 | Soil | LQAADKALYRAKANGRNRVETASVPRRRTRVKAAGIA |
Ga0210287_12442411 | 3300030598 | Soil | SRENSSADEVIQAADKALYRAKAGGRNRIETASSPRRRGRSKAVGTG |
Ga0302317_104252951 | 3300030677 | Palsa | AADKALYRAKEGGRNRVETATAGRRRARSKAAATA |
Ga0265462_123077501 | 3300030738 | Soil | TTSAEEVIQAADKALYRAKAAGRNRIETTFAPGRRARATTANSA |
Ga0265750_10745832 | 3300030813 | Soil | AADKALYCAKDNGRNRIETAGSIRRKSRVKAAGIA |
Ga0265746_10107602 | 3300030815 | Soil | AVIQAADKALYRAKSAGRNRIETEAAPRRAVRTRAAGIA |
Ga0265767_1120411 | 3300030836 | Soil | VDDVIQAADKALYRAKAAGRNRIETAAPGRRRVRNKTAGIA |
Ga0265753_11370311 | 3300030862 | Soil | EKPDPTQIMDAADKALYRAKGNGRNRVETASAPRRRVRAKTAGIA |
Ga0265742_10115291 | 3300030874 | Soil | EHVLQAADKALYRAKANGRNRVETASAARKRPRVKAAGIA |
Ga0265770_10857851 | 3300030878 | Soil | AAATQEKPDPTQIMDAADKALYRAKGNGRNRVETASAPRRRVRAKTAGIA |
Ga0265776_1100952 | 3300030880 | Soil | LVLQAADKALYRAKANGRNRVETAVSRRGRMKKTEIA |
Ga0265740_10183071 | 3300030940 | Soil | EKSSTDEVVQAADKALYRAKAGGRNRVETAGAARRRRAKAAVTA |
Ga0302180_100994336 | 3300031028 | Palsa | NDSAEEIIEAADKALYRAKSAGRNRVETVSSPRRRTRSKAASIA |
Ga0302180_102438322 | 3300031028 | Palsa | EKADPNRIMDAADKALYRAKGNGRNRVETASAPRRRARVRTAGIA |
Ga0170834_1027033721 | 3300031057 | Forest Soil | ATSAKDGMDLELVLEAADKALYRAKANGRNRLETASIPARRSRVKTAGIA |
Ga0170823_151676661 | 3300031128 | Forest Soil | DLVLQAADKALYRAKANGRNRVETAAPRRRGRVKAAGIA |
Ga0170824_1165077572 | 3300031231 | Forest Soil | VLHAADKALYRAKAGGRNRVETASVPRRRGRVKAAGIA |
Ga0302323_1029763651 | 3300031232 | Fen | PDRVVQAADKALYRAKASGRNRVETAAASRRKPRVKAAGIA |
Ga0265332_103948741 | 3300031238 | Rhizosphere | EESDPDRVLQAADKALYRAKENGRNRVEIAASPRRKTRVKAAGIA |
Ga0307476_108202741 | 3300031715 | Hardwood Forest Soil | TSRRDNPSAKEVIEAADKALYRAKAAGRNRIETASAPRRRVRAKSADIA |
Ga0318567_103860201 | 3300031821 | Soil | STEESNPDAIVKAADKALYRAKEGGRNRVEVTPSPKRTRMKAAGIA |
Ga0307478_109478992 | 3300031823 | Hardwood Forest Soil | KEKSDPEDVLQAADKALYRAKGNGRNRVETASSARRRTRVKTAGIA |
Ga0335074_112588271 | 3300032895 | Soil | QAADKALYRAKGAGRNRVETASAPRGRLRTTTAGIA |
Ga0335077_104944651 | 3300033158 | Soil | TTEPSDPDRILQAADKALYRAKANGRNRLEVASSTRGPRVKAAGIA |
Ga0310811_104128901 | 3300033475 | Soil | QAADKALYRAKANGRNRVETATPPRKAGAKAAGIA |
⦗Top⦘ |