Basic Information | |
---|---|
Family ID | F054378 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 140 |
Average Sequence Length | 40 residues |
Representative Sequence | VVMVDAVPMLPSGKHDIVRLRQELLRREQTEAESVTY |
Number of Associated Samples | 130 |
Number of Associated Scaffolds | 140 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 98.57 % |
Associated GOLD sequencing projects | 124 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.35 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (55.714 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (36.429 % of family members) |
Environment Ontology (ENVO) | Unclassified (30.714 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.857 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 29.23% β-sheet: 10.77% Coil/Unstructured: 60.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 140 Family Scaffolds |
---|---|---|
PF03979 | Sigma70_r1_1 | 37.86 |
PF00140 | Sigma70_r1_2 | 15.71 |
PF04542 | Sigma70_r2 | 15.71 |
PF04545 | Sigma70_r4 | 4.29 |
PF02634 | FdhD-NarQ | 1.43 |
COG ID | Name | Functional Category | % Frequency in 140 Family Scaffolds |
---|---|---|---|
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 69.29 |
COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 15.71 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 15.71 |
COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 15.71 |
COG1526 | Formate dehydrogenase assembly factor FdhD, a sulfurtransferase | Energy production and conversion [C] | 1.43 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 55.71 % |
Unclassified | root | N/A | 44.29 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001545|JGI12630J15595_10119790 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 520 | Open in IMG/M |
3300001661|JGI12053J15887_10627193 | Not Available | 511 | Open in IMG/M |
3300003505|JGIcombinedJ51221_10093835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1188 | Open in IMG/M |
3300003505|JGIcombinedJ51221_10369112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 583 | Open in IMG/M |
3300003659|JGI25404J52841_10008157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2225 | Open in IMG/M |
3300004618|Ga0068963_1039665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 503 | Open in IMG/M |
3300005104|Ga0066818_1023650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 526 | Open in IMG/M |
3300005332|Ga0066388_108199886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 521 | Open in IMG/M |
3300005445|Ga0070708_100264707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis | 1616 | Open in IMG/M |
3300005555|Ga0066692_10721641 | Not Available | 617 | Open in IMG/M |
3300005591|Ga0070761_10743198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 616 | Open in IMG/M |
3300005921|Ga0070766_10671981 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 699 | Open in IMG/M |
3300006162|Ga0075030_100900697 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 697 | Open in IMG/M |
3300006163|Ga0070715_10516198 | Not Available | 687 | Open in IMG/M |
3300006173|Ga0070716_100931297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 682 | Open in IMG/M |
3300006354|Ga0075021_10214464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Nocardiopsaceae | 1178 | Open in IMG/M |
3300006871|Ga0075434_101248523 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 754 | Open in IMG/M |
3300009090|Ga0099827_10109616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2207 | Open in IMG/M |
3300009093|Ga0105240_12047886 | Not Available | 594 | Open in IMG/M |
3300009524|Ga0116225_1264135 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 771 | Open in IMG/M |
3300009525|Ga0116220_10300164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 707 | Open in IMG/M |
3300009553|Ga0105249_11619279 | Not Available | 720 | Open in IMG/M |
3300009698|Ga0116216_10659922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 629 | Open in IMG/M |
3300010105|Ga0127470_1099510 | Not Available | 554 | Open in IMG/M |
3300010112|Ga0127458_1010397 | Not Available | 561 | Open in IMG/M |
3300010118|Ga0127465_1137199 | Not Available | 634 | Open in IMG/M |
3300010119|Ga0127452_1153778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 504 | Open in IMG/M |
3300010146|Ga0126320_1144229 | Not Available | 667 | Open in IMG/M |
3300010343|Ga0074044_10530169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 769 | Open in IMG/M |
3300010366|Ga0126379_11171025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 875 | Open in IMG/M |
3300011066|Ga0138524_1070521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 680 | Open in IMG/M |
3300011080|Ga0138568_1041422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 575 | Open in IMG/M |
3300011087|Ga0138570_1102889 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 750 | Open in IMG/M |
3300011120|Ga0150983_13973716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1616 | Open in IMG/M |
3300011120|Ga0150983_13988188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 757 | Open in IMG/M |
3300011120|Ga0150983_15155462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 762 | Open in IMG/M |
3300012201|Ga0137365_10588612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 816 | Open in IMG/M |
3300012210|Ga0137378_10559607 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1052 | Open in IMG/M |
3300012364|Ga0134027_1075558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 813 | Open in IMG/M |
3300012379|Ga0134058_1076118 | Not Available | 635 | Open in IMG/M |
3300012380|Ga0134047_1210931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 754 | Open in IMG/M |
3300012392|Ga0134043_1140462 | Not Available | 650 | Open in IMG/M |
3300012406|Ga0134053_1196853 | Not Available | 567 | Open in IMG/M |
3300012409|Ga0134045_1342390 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 777 | Open in IMG/M |
3300012500|Ga0157314_1039217 | Not Available | 565 | Open in IMG/M |
3300014501|Ga0182024_11323779 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 834 | Open in IMG/M |
3300017942|Ga0187808_10138185 | Not Available | 1070 | Open in IMG/M |
3300017995|Ga0187816_10113451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1166 | Open in IMG/M |
3300018090|Ga0187770_11175819 | Not Available | 620 | Open in IMG/M |
3300019260|Ga0181506_1033212 | Not Available | 520 | Open in IMG/M |
3300019279|Ga0184642_1080257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1615 | Open in IMG/M |
3300020069|Ga0197907_10197414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1326 | Open in IMG/M |
3300020076|Ga0206355_1321051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1258 | Open in IMG/M |
3300021151|Ga0179584_1330480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 839 | Open in IMG/M |
3300021445|Ga0182009_10588920 | Not Available | 594 | Open in IMG/M |
3300021474|Ga0210390_10936021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 711 | Open in IMG/M |
3300021929|Ga0213845_1195941 | Not Available | 543 | Open in IMG/M |
3300022499|Ga0242641_1044626 | Not Available | 523 | Open in IMG/M |
3300022507|Ga0222729_1057152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 552 | Open in IMG/M |
3300022522|Ga0242659_1005624 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1598 | Open in IMG/M |
3300022527|Ga0242664_1079280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 646 | Open in IMG/M |
3300022709|Ga0222756_1010822 | Not Available | 1043 | Open in IMG/M |
3300022722|Ga0242657_1067621 | Not Available | 822 | Open in IMG/M |
3300024271|Ga0224564_1040695 | Not Available | 893 | Open in IMG/M |
3300024283|Ga0247670_1054612 | Not Available | 721 | Open in IMG/M |
3300024325|Ga0247678_1047125 | Not Available | 693 | Open in IMG/M |
3300025633|Ga0208480_1141540 | Not Available | 549 | Open in IMG/M |
3300025972|Ga0207668_11548837 | Not Available | 598 | Open in IMG/M |
3300026327|Ga0209266_1257259 | Not Available | 559 | Open in IMG/M |
3300027174|Ga0207948_1032675 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 624 | Open in IMG/M |
3300027812|Ga0209656_10178711 | Not Available | 1043 | Open in IMG/M |
3300027894|Ga0209068_10605643 | Not Available | 638 | Open in IMG/M |
3300027903|Ga0209488_10538566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 853 | Open in IMG/M |
3300027915|Ga0209069_10453196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 713 | Open in IMG/M |
3300028138|Ga0247684_1040239 | Not Available | 750 | Open in IMG/M |
3300028145|Ga0247663_1082909 | Not Available | 572 | Open in IMG/M |
3300028717|Ga0307298_10219569 | Not Available | 562 | Open in IMG/M |
3300029944|Ga0311352_10158177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1956 | Open in IMG/M |
3300029944|Ga0311352_11490934 | Not Available | 506 | Open in IMG/M |
3300030528|Ga0210277_10881961 | Not Available | 636 | Open in IMG/M |
3300030536|Ga0210266_1191398 | Not Available | 608 | Open in IMG/M |
3300030539|Ga0210281_1177131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 561 | Open in IMG/M |
3300030573|Ga0210272_1037397 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 888 | Open in IMG/M |
3300030573|Ga0210272_1295359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 520 | Open in IMG/M |
3300030575|Ga0210288_1196269 | Not Available | 566 | Open in IMG/M |
3300030578|Ga0210275_10032825 | Not Available | 1028 | Open in IMG/M |
3300030578|Ga0210275_10372825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 517 | Open in IMG/M |
3300030583|Ga0210262_1092243 | Not Available | 710 | Open in IMG/M |
3300030586|Ga0265393_1107218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 641 | Open in IMG/M |
3300030588|Ga0210283_1060913 | Not Available | 538 | Open in IMG/M |
3300030594|Ga0210280_1029907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 831 | Open in IMG/M |
3300030596|Ga0210278_1048126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 805 | Open in IMG/M |
3300030597|Ga0210286_1126989 | Not Available | 702 | Open in IMG/M |
3300030623|Ga0265392_1147915 | Not Available | 603 | Open in IMG/M |
3300030625|Ga0210259_11778336 | Not Available | 669 | Open in IMG/M |
3300030626|Ga0210291_10700526 | Not Available | 892 | Open in IMG/M |
3300030627|Ga0210269_10101204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 804 | Open in IMG/M |
3300030627|Ga0210269_10271685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 581 | Open in IMG/M |
3300030627|Ga0210269_10340469 | Not Available | 533 | Open in IMG/M |
3300030629|Ga0210268_1097760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 804 | Open in IMG/M |
3300030632|Ga0210250_10911303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 552 | Open in IMG/M |
3300030707|Ga0310038_10274402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 770 | Open in IMG/M |
3300030730|Ga0307482_1033542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1161 | Open in IMG/M |
3300030738|Ga0265462_10092784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1298 | Open in IMG/M |
3300030741|Ga0265459_11699046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 736 | Open in IMG/M |
3300030743|Ga0265461_10240597 | Not Available | 1178 | Open in IMG/M |
3300030743|Ga0265461_10538232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 979 | Open in IMG/M |
3300030743|Ga0265461_11566740 | Not Available | 718 | Open in IMG/M |
3300030760|Ga0265762_1086084 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 679 | Open in IMG/M |
3300030863|Ga0265766_1007669 | Not Available | 729 | Open in IMG/M |
3300030963|Ga0265768_103777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 827 | Open in IMG/M |
3300030967|Ga0075399_11488935 | Not Available | 623 | Open in IMG/M |
3300031057|Ga0170834_111114432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis | 1558 | Open in IMG/M |
3300031123|Ga0308195_1048936 | Not Available | 608 | Open in IMG/M |
3300031231|Ga0170824_103590392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 708 | Open in IMG/M |
3300031474|Ga0170818_107339892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 829 | Open in IMG/M |
3300031708|Ga0310686_112787332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 690 | Open in IMG/M |
3300031713|Ga0318496_10421893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 737 | Open in IMG/M |
3300031715|Ga0307476_10970911 | Not Available | 626 | Open in IMG/M |
3300031747|Ga0318502_10195748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1168 | Open in IMG/M |
3300031769|Ga0318526_10239980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 741 | Open in IMG/M |
3300031779|Ga0318566_10329609 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 754 | Open in IMG/M |
3300031780|Ga0318508_1259079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 500 | Open in IMG/M |
3300031792|Ga0318529_10300396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 747 | Open in IMG/M |
3300031798|Ga0318523_10196546 | Not Available | 1007 | Open in IMG/M |
3300031866|Ga0316049_121065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 530 | Open in IMG/M |
3300031891|Ga0316039_119656 | Not Available | 505 | Open in IMG/M |
3300031896|Ga0318551_10191665 | Not Available | 1128 | Open in IMG/M |
3300031939|Ga0308174_11767470 | Not Available | 531 | Open in IMG/M |
3300031942|Ga0310916_10497119 | Not Available | 1039 | Open in IMG/M |
3300031981|Ga0318531_10105449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1244 | Open in IMG/M |
3300032008|Ga0318562_10243307 | Not Available | 1044 | Open in IMG/M |
3300032009|Ga0318563_10352394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 796 | Open in IMG/M |
3300032076|Ga0306924_10674125 | Not Available | 1163 | Open in IMG/M |
3300032119|Ga0316051_1004367 | Not Available | 1014 | Open in IMG/M |
3300032515|Ga0348332_11033000 | Not Available | 1266 | Open in IMG/M |
3300032829|Ga0335070_11855281 | Not Available | 544 | Open in IMG/M |
3300033004|Ga0335084_12120971 | Not Available | 546 | Open in IMG/M |
3300033550|Ga0247829_11820919 | Not Available | 502 | Open in IMG/M |
3300034817|Ga0373948_0045972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 926 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 36.43% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.14% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 7.14% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.71% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.71% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.57% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.86% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.14% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.14% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.43% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.43% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.43% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.43% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.43% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.43% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.43% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.43% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.43% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.71% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.71% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.71% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.71% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.71% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.71% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.71% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.71% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.71% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.71% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.71% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.71% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.71% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.71% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.71% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.71% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.71% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.71% |
Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.71% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.71% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
3300004618 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 55 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005104 | Soil and rhizosphere microbial communities from Laval, Canada - mgHAC | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300010105 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010112 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010118 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010119 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010146 | Soil microbial communities from California, USA to study soil gas exchange rates - JR-CA-SND metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300011066 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 3 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011080 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 53 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011087 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 55 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012379 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012380 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012392 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012406 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012409 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Host-Associated | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300019260 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019279 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) | Environmental | Open in IMG/M |
3300021151 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021929 | Metatranscriptome of freshwater microbial communities from pre-fracked creek in Pennsylvania, United States - DR:C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022499 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022507 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022522 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022527 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022709 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
3300024283 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11 | Environmental | Open in IMG/M |
3300024325 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK19 | Environmental | Open in IMG/M |
3300025633 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
3300027174 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF040 (SPAdes) | Environmental | Open in IMG/M |
3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
3300028138 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25 | Environmental | Open in IMG/M |
3300028145 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK04 | Environmental | Open in IMG/M |
3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030528 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO084SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030536 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE043SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030539 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO151-VCO111SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030573 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO143-VCO036SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030575 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO747-VDE050SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030578 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO105-VCO054SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030583 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO145-ARE023SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030586 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE041SO (Eukaryote Community Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300030588 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO740-VDE011SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030594 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO141-VCO089SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030596 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO085SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030597 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO747-VDE046SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030623 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE043SO (Eukaryote Community Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300030625 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO122-ANR120SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030626 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO410-VDE110SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030627 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO153-ARE095SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030629 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO153-ARE093SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030632 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO132-ANR004SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030738 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assembly | Environmental | Open in IMG/M |
3300030741 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assembly | Environmental | Open in IMG/M |
3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030963 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030967 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA11 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031123 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_196 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
3300031866 | Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300031891 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLA3 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032119 | Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSE5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12630J15595_101197901 | 3300001545 | Forest Soil | LPRYAAPSRVVMVDAVPMLPTGKHDIVRLRQELLRREQTGAESVT* |
JGI12053J15887_106271932 | 3300001661 | Forest Soil | RYAIPSRVVMVDAVPMLPSGKYDIVRLRQELLRREQTEAESVNY* |
JGIcombinedJ51221_100938351 | 3300003505 | Forest Soil | LPRYAAPSRVVMVDAVPMLPSGKHDLARLRRELLPREQTEAENVTY* |
JGIcombinedJ51221_103691122 | 3300003505 | Forest Soil | PRYAAPSRVVMVDAVPMLPSGKHDLARLRRELLWREQSEAENVTY* |
JGI25404J52841_100081573 | 3300003659 | Tabebuia Heterophylla Rhizosphere | LPRYAIPSRVVMVDAVPMLPSGKYDLVRLRQELLRREQTEAESVTY* |
Ga0068963_10396652 | 3300004618 | Peatlands Soil | RLPRYAAPSRVVMVDAVPMLPSGKHDIVRLRQELLRREQTEAENVTY* |
Ga0066818_10236502 | 3300005104 | Soil | PRYAIPSRVVMVGAVPMLPSGKHDIVRLRQELLRREQTEAESVIY* |
Ga0066388_1081998861 | 3300005332 | Tropical Forest Soil | ERLPRYAIPSRVVMIDAVPMLPSGKHDTVRLRRELLRREQTEAESVNY* |
Ga0070708_1002647071 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | SRVVMVDAVPMLPSGKHDIVRLRQELLRREQTEVESVIY* |
Ga0066692_107216412 | 3300005555 | Soil | MVDAVPMLPSGKHDIVRLRQELLRREQTEAESVTY* |
Ga0070761_107431982 | 3300005591 | Soil | PSRVVIVDAVPMLPSGKHDIARLKLELLRREQTEAENVS* |
Ga0070766_106719811 | 3300005921 | Soil | APSRVVIVDAVPMLPSGKHDIARLKLELLRREQTAAENVS* |
Ga0075030_1009006972 | 3300006162 | Watersheds | APSRVVMVDAVPMLPSGKHDIVRLRQELLRREQTEAENVT* |
Ga0070715_105161981 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | VVMVDAVPMLPSGKHDIVRLRRELLRREQTEAESVT* |
Ga0070716_1009312972 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | AAPSRVVMVDAVPMLPSGKHDIVRLRQELLRREQTEAENVT* |
Ga0075021_102144641 | 3300006354 | Watersheds | LELLRLHVRQRLPYYAAPSKIVMVDAVPMLPSGKHDLARLRRELLRREQTAAENVTY* |
Ga0075434_1012485231 | 3300006871 | Populus Rhizosphere | VVMVDAVPMLPSGKYDIVRLRQELLRREQTEAESVIY* |
Ga0099827_101096161 | 3300009090 | Vadose Zone Soil | SRVVTVDACPMLPSGKHDIVRLRLELLRREQTEAENVIL* |
Ga0105240_120478861 | 3300009093 | Corn Rhizosphere | SRVVMVDAVPMLPSGKYDIVRLRQELLRREQTEAESVTY* |
Ga0116225_12641352 | 3300009524 | Peatlands Soil | VDAVPMLPSGKHDLARLRRELLRREQTEAENVSN* |
Ga0116220_103001642 | 3300009525 | Peatlands Soil | VVMVDAVPMLPSGKHDIVRLRQELLRREQTEAENVT* |
Ga0105249_116192792 | 3300009553 | Switchgrass Rhizosphere | PRYAIPSRVVMVDAVPMLPSGKYDIVRLRQELLRREQTEAESVIY* |
Ga0116216_106599221 | 3300009698 | Peatlands Soil | RLPRYAAPSRVVMVDAVPMLPSGKHDLARLRRELPRREQTEAENVTN* |
Ga0127470_10995102 | 3300010105 | Grasslands Soil | VDAVPMLPSGKYDIVRLRQELLRREQTKAESVIY* |
Ga0127458_10103971 | 3300010112 | Grasslands Soil | VEAVPMLPSGKHDIVRLRQELLRREQTEAESVTN* |
Ga0127465_11371992 | 3300010118 | Grasslands Soil | VDAVPMLPSGKHDIVRLRQELLRREQTEAESVTY* |
Ga0127452_11537781 | 3300010119 | Grasslands Soil | VDAVPMLLSGKHDIVRLRQELLRREQTEAESVTN* |
Ga0126320_11442291 | 3300010146 | Soil | TVDAVPMLPSGKYDIVRLRQELLRREQTEAESVIY* |
Ga0074044_105301692 | 3300010343 | Bog Forest Soil | LLSMPVRARLPRYAPPSRVVMVDAVPMLLSGKHDIVRLRQELLRREQTEAENVT* |
Ga0126379_111710251 | 3300010366 | Tropical Forest Soil | RLPRYAAPSRVVMVDAVPLLPSGKHDLARLRRELLRREQTESESVTN* |
Ga0138524_10705212 | 3300011066 | Peatlands Soil | VFVDAVPLLPSGKQDIAGLRRELLRREQTEAESVTY* |
Ga0138568_10414222 | 3300011080 | Peatlands Soil | FVDAIPLLPSGKHDIAGLRRELLRREQTEAESVSY* |
Ga0138570_11028892 | 3300011087 | Peatlands Soil | FVDAVPLLPSGKQDIAGLRRELLRREQTEAESVTY* |
Ga0150983_139737162 | 3300011120 | Forest Soil | VVDAVPMLPSGKHDIARLKLELLRREQTEVENVS* |
Ga0150983_139881882 | 3300011120 | Forest Soil | VDAIPMLPSGKHDIARLRQELLRREQTEAENVNY* |
Ga0150983_151554622 | 3300011120 | Forest Soil | VEVDAIPMLPSGKHDIARLRQELLRREQTEAENVNY* |
Ga0137365_105886122 | 3300012201 | Vadose Zone Soil | VMVGAVPMLPSGKHDIVRLRQELLRREQTEAESVTY* |
Ga0137378_105596072 | 3300012210 | Vadose Zone Soil | VMVDAVPMLPSGKHDIVRLRQELLRREQTEAESVT* |
Ga0134027_10755582 | 3300012364 | Grasslands Soil | VDAVPMLPSGKYDIVWLRQELLRREQTEAESVTY* |
Ga0134058_10761182 | 3300012379 | Grasslands Soil | VDAVPMLPSGKHDIVRLRQELLRREQTEAESGTY* |
Ga0134047_12109312 | 3300012380 | Grasslands Soil | VDSVPMLPSGKHDIVRLRLELLRREQTEAESVIY* |
Ga0134043_11404622 | 3300012392 | Grasslands Soil | VDAVPMLLSGKHDIVRLRQELLRREQTEAESVTY* |
Ga0134053_11968532 | 3300012406 | Grasslands Soil | VMVDAVPMLPSGKHDIVRLRQELLRREQTEAESVIY* |
Ga0134045_13423902 | 3300012409 | Grasslands Soil | VMVDAVPMLPSGKHDIVRLRQELLRREQTEAASVIY* |
Ga0157314_10392171 | 3300012500 | Arabidopsis Rhizosphere | RLPRYAIPSRVVMVDAVPMLPSGKHDIVRLRRELLRREQTEAENVT* |
Ga0182024_113237791 | 3300014501 | Permafrost | IVDAVPMLPSGKHDIARLKLELLRREQTEAENVT* |
Ga0187808_101381851 | 3300017942 | Freshwater Sediment | LPRYAAPGRVVMVDAVPMLPSGKHDLARLRRELLRREQTEAESVTNYCPDNVPR |
Ga0187816_101134512 | 3300017995 | Freshwater Sediment | LPRYAAPSKMVVVDAIPMLPSGKHDIAQLRRELLRREQTGA |
Ga0187770_111758192 | 3300018090 | Tropical Peatland | PRYAAPSKVVMVDAVPMLPSGKHDIVRLRRELLRREQTEAESVS |
Ga0181506_10332121 | 3300019260 | Peatland | RVVIVDDVPVLPSGKHDIARLKLELLPREQTEAENVTY |
Ga0184642_10802571 | 3300019279 | Groundwater Sediment | VMVDAVPMLPSGKYDIVRLRQELLRREQTEAESVIY |
Ga0197907_101974141 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | VMVDAVPMLPSGKYDIVRLRQELLRREQTEAESVTY |
Ga0206355_13210512 | 3300020076 | Corn, Switchgrass And Miscanthus Rhizosphere | MVDAVPMLPSGKYDIVRLRQELLRREQTEAESVTY |
Ga0179584_13304801 | 3300021151 | Vadose Zone Soil | RLPRYAAPSRVVMVDAVPMLSSGKHDIVRLRQELLRREQTEAESVIY |
Ga0182009_105889202 | 3300021445 | Soil | ERLPRYAIPRRVVMVDAVPMLPSGKYDIVRLRQELLRREQTEAESVIY |
Ga0210390_109360212 | 3300021474 | Soil | RVVEVDVIPMLPSGKHDIARLRLELLQREQTEAENVNY |
Ga0213845_11959411 | 3300021929 | Watersheds | MVDAVPMLPSGKHDIVRLRQELLRREQTEAESVTY |
Ga0242641_10446261 | 3300022499 | Soil | PRYASPSKIVMVDAVPMLSSGKHDIARLKLELLRREQNEAGSVS |
Ga0222729_10571522 | 3300022507 | Soil | VVMVDAVPMLPSGKHDIVRLRQELLRREQTEAESVTY |
Ga0242659_10056242 | 3300022522 | Soil | FVDAVPLLPSGKHDIAGLRRELLRREQTEAESVTY |
Ga0242664_10792801 | 3300022527 | Soil | RLPRYAAPSRIVMIDAVPMLPSGKHDLARLRRELLRREQSEAESVTN |
Ga0222756_10108221 | 3300022709 | Soil | LPRYAAPSRVVFVDAVPLLPSGKHDIAGLRRELLRREQTEAESVTY |
Ga0242657_10676211 | 3300022722 | Soil | RLPRYAAPSRVVMVDAVPMLPSGKHDIVRLRQELLRREQTEAESVTY |
Ga0224564_10406951 | 3300024271 | Soil | VMVDAVPMLPSGKHDIVRLRQELLRREQIEAENVT |
Ga0247670_10546122 | 3300024283 | Soil | YAIPSRVVMVDAVPMLPSGKYDIVRLRQELLRREQTEAESVTY |
Ga0247678_10471251 | 3300024325 | Soil | VVMVDAVPMLPSGKYDIVRLRQELLRREQTEAESVTY |
Ga0208480_11415401 | 3300025633 | Arctic Peat Soil | VKERLPRYASPSRVVVVDAVPLLPSGKYDIARLKLELLRREQTEAENVS |
Ga0207668_115488371 | 3300025972 | Switchgrass Rhizosphere | YAIPSRVVMVDAVPMLPSGKYDIARLRQELLRREQTEAESVTY |
Ga0209266_12572592 | 3300026327 | Soil | VRERLPRYAIPSRVVMVDAVPMLLSGKHDIVRLRQELLRREQTEAESVTN |
Ga0207948_10326752 | 3300027174 | Forest Soil | RYAAPSRVVMVDAVPMLPSGKHDLARLRRELLQREQSEAESVTY |
Ga0209656_101787112 | 3300027812 | Bog Forest Soil | APSKIVMVDAVPMLPSGKHDLARLRRELLRREQTAAENVNY |
Ga0209068_106056432 | 3300027894 | Watersheds | YAIPSRVVMVDAVPMLPSGKHDIVRLRQELLRREQTEAESVTY |
Ga0209488_105385661 | 3300027903 | Vadose Zone Soil | ASRVVMVDAVPMLPSGKHDIVRLRQELLRREQTEAESVIY |
Ga0209069_104531962 | 3300027915 | Watersheds | VVMVDAVPMLPSGKHDIVRLRQELLRREQTEAENVT |
Ga0247684_10402392 | 3300028138 | Soil | PRYAIPSRVVMVDAVPMLPSGKYDIVRLRQELLRREQTEAESVTY |
Ga0247663_10829092 | 3300028145 | Soil | LPRYAIPSRVVMVDAVPMLPSGKYDIVRLRQELLRREQTEAESVTY |
Ga0307298_102195691 | 3300028717 | Soil | RVVMVDAVPMLPSGKQDTVRLRQELLRREQTEAESVIY |
Ga0311352_101581771 | 3300029944 | Palsa | VVEAVPMLSSGKHDLPRLRRELLRREQTEAENVNY |
Ga0311352_114909341 | 3300029944 | Palsa | ASPSRVVIVDAVPMLPSGKHDIARLKLELLRREQTEAENVT |
Ga0210277_108819611 | 3300030528 | Soil | VVIIDAVPMLPSGKHDIVRLRQELLRREQTEAENVT |
Ga0210266_11913982 | 3300030536 | Soil | VVIVDAVPMLPSGKHDIARLKLELLLREQTEAENVS |
Ga0210281_11771311 | 3300030539 | Soil | IVMIDAVPMLPSGKHDLARLRRELLRREQSEAESVTY |
Ga0210272_10373971 | 3300030573 | Soil | VVIVDAVPMLPSGKHDIARLKLELLRREQTEAENVT |
Ga0210272_12953591 | 3300030573 | Soil | NRVVEVDAIPMLPSGKHDIARLRQELLQREQTEAENVTY |
Ga0210288_11962691 | 3300030575 | Soil | LRERLPRYAAPSRVVVVDAVPMLPSGKHDITRLKLDLLRREQTEAENVT |
Ga0210275_100328251 | 3300030578 | Soil | VVEVDAIPMLPSGKHDIARLRLELLRREQTEAENVNY |
Ga0210275_103728252 | 3300030578 | Soil | VVMVGAVPMLPSGKHDLVLLKRELLRREQSAAENVTN |
Ga0210262_10922432 | 3300030583 | Soil | QRLPRYAAPSRVVIVDAVPMLPSGKHDIARLKLELLLREQTEAENVS |
Ga0265393_11072181 | 3300030586 | Soil | RERLPRYAAPSRVVLVDAVPMLPSGKHDIARLKLELLRREQTESENVT |
Ga0210283_10609131 | 3300030588 | Soil | VVIVDAVPILPSGKHDIARLKLELLPREQTEAENVS |
Ga0210280_10299072 | 3300030594 | Soil | PSRVVIVDAVPMLPSGKHDIARLKLELLRREQTAAENVS |
Ga0210278_10481262 | 3300030596 | Soil | VVIVDAVPMLPSGKHDIARLKLELLRREQTESENVT |
Ga0210286_11269891 | 3300030597 | Soil | AAPSRVVIVDAVPMLPSGKHDIARLKLELLRREQTEAENVT |
Ga0265392_11479152 | 3300030623 | Soil | VIVDAVPMLPSGKHDIARLKLELLRREQTEAENVT |
Ga0210259_117783361 | 3300030625 | Soil | RVVIVDAVPMLPSGKHDITRLKLDLLRREQTEAENVT |
Ga0210291_107005262 | 3300030626 | Soil | VVMVDAVPMLPNGKHDIARLKLELLRREQTESENVP |
Ga0210269_101012042 | 3300030627 | Soil | VVVVDAVPMLPSGKHDIARLKLELLRREPTEVENVS |
Ga0210269_102716852 | 3300030627 | Soil | VMVDAVPMLPSGKHDLARLRRELLRREQTEAENVNY |
Ga0210269_103404692 | 3300030627 | Soil | PRYASPSRVVIVDAVPMLPSGKHDITRLKLDLLRREQTEAENVT |
Ga0210268_10977602 | 3300030629 | Soil | VVEVDAIPMLPSGKHDIARLRQELLRREQTEAENVNY |
Ga0210250_109113032 | 3300030632 | Soil | RVVVIDVIPMLVSGKHDLAGLRRELLRREQTEADSVPY |
Ga0310038_102744021 | 3300030707 | Peatlands Soil | IVMVDAVPMLPSGKHDLARLRRELLRREQTEAENVSN |
Ga0307482_10335422 | 3300030730 | Hardwood Forest Soil | VDAVPLLPGGKQDLARLRQDLTELGNTTGREQTEPSSVTN |
Ga0265462_100927842 | 3300030738 | Soil | VMVDAIPMLPSGKHDLARLRRELPRREQSEAESVTN |
Ga0265459_116990461 | 3300030741 | Soil | RVVVIDVIPMLVSGKHDLAGLRRELLRREQTEADSVIY |
Ga0265461_102405971 | 3300030743 | Soil | RLHVQQRLPRYAAPNRVVEVDAIPMLPSGKHDIARLRLELLRREQTEAENVNY |
Ga0265461_105382322 | 3300030743 | Soil | LPRYAAPSRVVFVDAVPLLPSGKHDIAGLRRELLRREQTESESVTY |
Ga0265461_115667402 | 3300030743 | Soil | LPRYAAPSRVVLVDAVPMLPSGKHDIARLKGDLLRREQIEA |
Ga0265762_10860842 | 3300030760 | Soil | PMLPSGKHDIARLRLELLQREQTEAENVNYLVPGL |
Ga0265766_10076691 | 3300030863 | Soil | RLPRYAAPSRVVLVDAVPALPNGKHDIARLKLDLLKREQTEAENVT |
Ga0265768_1037772 | 3300030963 | Soil | MVDAVPMLPSGKHDIVRLRQELLRREQTEAKSVIY |
Ga0075399_114889352 | 3300030967 | Soil | VVMVDAVPMLPSGKHDIVRLRQELLRREQTEAESVIY |
Ga0170834_1111144321 | 3300031057 | Forest Soil | RVVMIDAVPMLPSGKHDIARLRQELLRREQTEAENVT |
Ga0308195_10489362 | 3300031123 | Soil | MVDAVPMLPSGKYDIVRLRQELLRREQTEAESVIY |
Ga0170824_1035903922 | 3300031231 | Forest Soil | VMVDAVPMLPSGKHDLARLRRELLRREQSEAESVTN |
Ga0170818_1073398922 | 3300031474 | Forest Soil | VMVDAVPMLPSGKHDIVRLRQELLRREQTEAESVIY |
Ga0310686_1127873322 | 3300031708 | Soil | RLHVQQRLPRYAAPNRVVEVDVIPMLPSGKHDIARLRLELLRREQTEAENVNY |
Ga0318496_104218932 | 3300031713 | Soil | RYAIPSRVVMVDAVPMLPSGKHDIVRLRRELLRREQTEAESVTY |
Ga0307476_109709111 | 3300031715 | Hardwood Forest Soil | VMLDAVPMLPSGKHDIVRLRQELLRREQTEAESVT |
Ga0318502_101957481 | 3300031747 | Soil | RERLPRYAAPSRVVVVDAVPMLPSGKHDIAQIRRELPRREQTGAESVT |
Ga0318526_102399802 | 3300031769 | Soil | VVMVAAVPMLPSGKHDIVRLRQELLRREQTEAESVTY |
Ga0318566_103296091 | 3300031779 | Soil | SRIVMVDAVPMLPSGKHDIVRLRQELLRREQTEAESVTY |
Ga0318508_12590791 | 3300031780 | Soil | AIPSRVVTVDAVPMLPSGKHDIVRLRQELLRREQIEAESVTY |
Ga0318529_103003961 | 3300031792 | Soil | VMVDAVPMLPSGKHDIVRLRQELLRREQTEAESVTY |
Ga0318523_101965461 | 3300031798 | Soil | PSKVVMVDAVPMLPSGKHDLARLRQDLLRREQTEAESVTN |
Ga0316049_1210652 | 3300031866 | Soil | MIDAVPMLPSGKHDLARLRRELLRREQSEAESVTY |
Ga0316039_1196561 | 3300031891 | Soil | AAPSKIVMVDAVPMLSSGKHDIARLKLELLRREQNEAESVS |
Ga0318551_101916651 | 3300031896 | Soil | AIPSRVVMVDAVPVLPSGKHDIIRLREELLRREQTEAESVTY |
Ga0308174_117674701 | 3300031939 | Soil | RYAIPSRVVMVDAVPMLPSGKYDIVRLRQELLRREQTEAESVIY |
Ga0310916_104971192 | 3300031942 | Soil | ERLPRYAIPSTVVMVDAVPMLPSGKHDIVRLRQELLRREQTEAESVTY |
Ga0318531_101054492 | 3300031981 | Soil | VVMVDAVPMLPSGKHDLARLRQDLLRREQTEAESVTN |
Ga0318562_102433072 | 3300032008 | Soil | RYAIPSTVVMVDAVPMLPSGKHDIVRLRQELLRREQTEAESVTY |
Ga0318563_103523942 | 3300032009 | Soil | RYAIPSTVVMVDAVPMLPSGKHDIVRLRQELLQREQTEAESVIY |
Ga0306924_106741252 | 3300032076 | Soil | YAIPSTVVMVDAVPMLPSGKHDIVRLRQELLQREQTEAESVTY |
Ga0316051_10043671 | 3300032119 | Soil | VVFVDAVPLLPSGKHDIAGLRRELLRREQTEAESVTY |
Ga0348332_110330002 | 3300032515 | Plant Litter | PRYAAPSRVVLVDAVPALPNGKHDIARLKLDLLKREQTEAENVT |
Ga0335070_118552812 | 3300032829 | Soil | RIVTVDAVPMLPSGKHDIVRLKQELLRREQTEAESVTY |
Ga0335084_121209711 | 3300033004 | Soil | APSRVVMVDAVPMLPSGKHDTVRLRRELLRREQTEAESVT |
Ga0247829_118209191 | 3300033550 | Soil | YAIPSRVVMVDAVPMLPSGKYDIVRLRQELLRREQTEAESVIY |
Ga0373948_0045972_790_924 | 3300034817 | Rhizosphere Soil | RYAIPSRVVMVDAVPMLPSGKYDIVRLRQELLRREQTEAESVTY |
⦗Top⦘ |