Basic Information | |
---|---|
Family ID | F054751 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 139 |
Average Sequence Length | 39 residues |
Representative Sequence | MPEVSSTGHEAETEALTSDELLVEEVSIDGMCGVY |
Number of Associated Samples | 118 |
Number of Associated Scaffolds | 139 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 57.55 % |
% of genes near scaffold ends (potentially truncated) | 33.09 % |
% of genes from short scaffolds (< 2000 bps) | 85.61 % |
Associated GOLD sequencing projects | 112 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.16 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (83.453 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (21.583 % of family members) |
Environment Ontology (ENVO) | Unclassified (28.777 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.043 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 11.11% β-sheet: 0.00% Coil/Unstructured: 88.89% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.16 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 139 Family Scaffolds |
---|---|---|
PF00440 | TetR_N | 34.53 |
PF04055 | Radical_SAM | 26.62 |
PF13186 | SPASM | 2.16 |
PF00535 | Glycos_transf_2 | 0.72 |
PF02633 | Creatininase | 0.72 |
PF00152 | tRNA-synt_2 | 0.72 |
PF00309 | Sigma54_AID | 0.72 |
PF13188 | PAS_8 | 0.72 |
PF02566 | OsmC | 0.72 |
PF01494 | FAD_binding_3 | 0.72 |
PF02773 | S-AdoMet_synt_C | 0.72 |
PF02219 | MTHFR | 0.72 |
PF00903 | Glyoxalase | 0.72 |
PF00561 | Abhydrolase_1 | 0.72 |
PF00717 | Peptidase_S24 | 0.72 |
COG ID | Name | Functional Category | % Frequency in 139 Family Scaffolds |
---|---|---|---|
COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.44 |
COG0017 | Aspartyl/asparaginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.72 |
COG0173 | Aspartyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.72 |
COG0192 | S-adenosylmethionine synthetase | Coenzyme transport and metabolism [H] | 0.72 |
COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.72 |
COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.72 |
COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.72 |
COG0685 | 5,10-methylenetetrahydrofolate reductase | Amino acid transport and metabolism [E] | 0.72 |
COG1190 | Lysyl-tRNA synthetase, class II | Translation, ribosomal structure and biogenesis [J] | 0.72 |
COG1402 | Creatinine amidohydrolase/Fe(II)-dependent FAPy formamide hydrolase (riboflavin and F420 biosynthesis) | Coenzyme transport and metabolism [H] | 0.72 |
COG1508 | DNA-directed RNA polymerase specialized sigma subunit, sigma54 homolog | Transcription [K] | 0.72 |
COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 0.72 |
COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 0.72 |
COG2269 | Elongation factor P--beta-lysine ligase (EF-P beta-lysylation pathway) | Translation, ribosomal structure and biogenesis [J] | 0.72 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 83.45 % |
Unclassified | root | N/A | 16.55 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001661|JGI12053J15887_10285915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | 810 | Open in IMG/M |
3300001867|JGI12627J18819_10259657 | Not Available | 699 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100244253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1684 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100848533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 795 | Open in IMG/M |
3300003505|JGIcombinedJ51221_10146868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 951 | Open in IMG/M |
3300004799|Ga0058863_11918177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 659 | Open in IMG/M |
3300004800|Ga0058861_10022342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 591 | Open in IMG/M |
3300005327|Ga0070658_10099749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2399 | Open in IMG/M |
3300005458|Ga0070681_11671573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 563 | Open in IMG/M |
3300005542|Ga0070732_10586527 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Nocardiopsaceae → Nocardiopsis → Nocardiopsis gilva | 677 | Open in IMG/M |
3300005548|Ga0070665_101127890 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 796 | Open in IMG/M |
3300005577|Ga0068857_100281801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1529 | Open in IMG/M |
3300005610|Ga0070763_10123390 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1330 | Open in IMG/M |
3300005610|Ga0070763_10526488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 679 | Open in IMG/M |
3300005614|Ga0068856_100773591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 980 | Open in IMG/M |
3300005921|Ga0070766_10915718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 601 | Open in IMG/M |
3300006755|Ga0079222_12431503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 525 | Open in IMG/M |
3300006804|Ga0079221_10274249 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 973 | Open in IMG/M |
3300007982|Ga0102924_1048550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2515 | Open in IMG/M |
3300007982|Ga0102924_1067142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1973 | Open in IMG/M |
3300009093|Ga0105240_12121814 | Not Available | 583 | Open in IMG/M |
3300009792|Ga0126374_11022764 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 650 | Open in IMG/M |
3300009826|Ga0123355_11072194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 843 | Open in IMG/M |
3300009826|Ga0123355_11900261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 557 | Open in IMG/M |
3300010049|Ga0123356_10284021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1752 | Open in IMG/M |
3300010143|Ga0126322_1049915 | Not Available | 555 | Open in IMG/M |
3300010162|Ga0131853_10614145 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 931 | Open in IMG/M |
3300010358|Ga0126370_11973402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 570 | Open in IMG/M |
3300010373|Ga0134128_11842984 | Not Available | 666 | Open in IMG/M |
3300010376|Ga0126381_102747532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 703 | Open in IMG/M |
3300010396|Ga0134126_10516653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1374 | Open in IMG/M |
3300010866|Ga0126344_1222070 | Not Available | 677 | Open in IMG/M |
3300010876|Ga0126361_11175747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 882 | Open in IMG/M |
3300011120|Ga0150983_10325438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 735 | Open in IMG/M |
3300011120|Ga0150983_14558763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 644 | Open in IMG/M |
3300011271|Ga0137393_10240108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1536 | Open in IMG/M |
3300012202|Ga0137363_10539339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 982 | Open in IMG/M |
3300012359|Ga0137385_11059286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 668 | Open in IMG/M |
3300012924|Ga0137413_10282734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1152 | Open in IMG/M |
3300012957|Ga0164303_11330083 | Not Available | 533 | Open in IMG/M |
3300014168|Ga0181534_10484130 | Not Available | 697 | Open in IMG/M |
3300014169|Ga0181531_10043844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2603 | Open in IMG/M |
3300014968|Ga0157379_10605196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1023 | Open in IMG/M |
3300017937|Ga0187809_10053904 | All Organisms → cellular organisms → Bacteria | 1301 | Open in IMG/M |
3300019268|Ga0181514_1446638 | Not Available | 577 | Open in IMG/M |
3300020069|Ga0197907_10787512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1975 | Open in IMG/M |
3300020070|Ga0206356_10030268 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1218 | Open in IMG/M |
3300020070|Ga0206356_10812605 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1366 | Open in IMG/M |
3300020075|Ga0206349_1669227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 543 | Open in IMG/M |
3300020075|Ga0206349_1845491 | Not Available | 534 | Open in IMG/M |
3300020076|Ga0206355_1113179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 569 | Open in IMG/M |
3300020077|Ga0206351_10671832 | Not Available | 1920 | Open in IMG/M |
3300020078|Ga0206352_10075029 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1128 | Open in IMG/M |
3300020078|Ga0206352_10202628 | Not Available | 538 | Open in IMG/M |
3300020080|Ga0206350_11335457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 815 | Open in IMG/M |
3300020081|Ga0206354_11559547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae | 1064 | Open in IMG/M |
3300020082|Ga0206353_10531470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae | 1470 | Open in IMG/M |
3300020199|Ga0179592_10212625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 875 | Open in IMG/M |
3300020580|Ga0210403_10323684 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1263 | Open in IMG/M |
3300020582|Ga0210395_10657658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 785 | Open in IMG/M |
3300020583|Ga0210401_10052110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3862 | Open in IMG/M |
3300020610|Ga0154015_1019780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Frondihabitans → unclassified Frondihabitans → Frondihabitans sp. PAMC 28766 | 718 | Open in IMG/M |
3300021151|Ga0179584_1280033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 693 | Open in IMG/M |
3300021171|Ga0210405_11190933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 565 | Open in IMG/M |
3300021178|Ga0210408_10145202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1878 | Open in IMG/M |
3300021180|Ga0210396_10451682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1127 | Open in IMG/M |
3300021401|Ga0210393_10638798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 869 | Open in IMG/M |
3300021402|Ga0210385_10006452 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 7054 | Open in IMG/M |
3300021402|Ga0210385_10292675 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1205 | Open in IMG/M |
3300021404|Ga0210389_10023070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4811 | Open in IMG/M |
3300021405|Ga0210387_10451392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1141 | Open in IMG/M |
3300021406|Ga0210386_10479008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1075 | Open in IMG/M |
3300021407|Ga0210383_10502504 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1047 | Open in IMG/M |
3300021477|Ga0210398_10760206 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 782 | Open in IMG/M |
3300021479|Ga0210410_10450942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1151 | Open in IMG/M |
3300021560|Ga0126371_11376805 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 837 | Open in IMG/M |
3300022467|Ga0224712_10366878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 682 | Open in IMG/M |
3300022513|Ga0242667_1020733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 688 | Open in IMG/M |
3300022523|Ga0242663_1034267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 834 | Open in IMG/M |
3300022525|Ga0242656_1041163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 774 | Open in IMG/M |
3300022528|Ga0242669_1055818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 686 | Open in IMG/M |
3300022557|Ga0212123_10015924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 9278 | Open in IMG/M |
3300022712|Ga0242653_1054916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 655 | Open in IMG/M |
3300022714|Ga0242671_1046158 | Not Available | 710 | Open in IMG/M |
3300022721|Ga0242666_1176737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 535 | Open in IMG/M |
3300022724|Ga0242665_10324517 | Not Available | 545 | Open in IMG/M |
3300022726|Ga0242654_10099140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 913 | Open in IMG/M |
3300022726|Ga0242654_10286546 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 602 | Open in IMG/M |
3300023056|Ga0233357_1008074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1102 | Open in IMG/M |
3300025915|Ga0207693_11246649 | Not Available | 559 | Open in IMG/M |
3300025928|Ga0207700_10235733 | Not Available | 1558 | Open in IMG/M |
3300025928|Ga0207700_10789819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 849 | Open in IMG/M |
3300026067|Ga0207678_10002582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 16509 | Open in IMG/M |
3300026555|Ga0179593_1021952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3115 | Open in IMG/M |
3300026557|Ga0179587_10066882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2107 | Open in IMG/M |
3300027037|Ga0209005_1003064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1933 | Open in IMG/M |
3300027164|Ga0208994_1002045 | Not Available | 2012 | Open in IMG/M |
3300027505|Ga0209218_1046938 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
3300027817|Ga0209112_10348118 | Not Available | 528 | Open in IMG/M |
3300027884|Ga0209275_10122609 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1353 | Open in IMG/M |
3300027895|Ga0209624_10230647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1231 | Open in IMG/M |
3300027905|Ga0209415_10162965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2205 | Open in IMG/M |
3300027905|Ga0209415_10532367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 893 | Open in IMG/M |
3300027908|Ga0209006_10027003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5202 | Open in IMG/M |
3300027908|Ga0209006_10475994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1044 | Open in IMG/M |
3300027908|Ga0209006_11004737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 663 | Open in IMG/M |
3300028047|Ga0209526_10120258 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1845 | Open in IMG/M |
3300028379|Ga0268266_10426834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1257 | Open in IMG/M |
3300028536|Ga0137415_11080162 | Not Available | 615 | Open in IMG/M |
3300028556|Ga0265337_1000033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 60717 | Open in IMG/M |
3300028556|Ga0265337_1154647 | Not Available | 621 | Open in IMG/M |
3300028800|Ga0265338_10200722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1504 | Open in IMG/M |
3300029636|Ga0222749_10412024 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae | 718 | Open in IMG/M |
3300030626|Ga0210291_10785650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 846 | Open in IMG/M |
3300030863|Ga0265766_1025932 | Not Available | 504 | Open in IMG/M |
3300030969|Ga0075394_12029880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 562 | Open in IMG/M |
3300030981|Ga0102770_11174753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 737 | Open in IMG/M |
3300031057|Ga0170834_106210012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 833 | Open in IMG/M |
3300031231|Ga0170824_112698919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 552 | Open in IMG/M |
3300031616|Ga0307508_10592881 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 709 | Open in IMG/M |
3300031708|Ga0310686_103389814 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1787 | Open in IMG/M |
3300031708|Ga0310686_117861578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8175 | Open in IMG/M |
3300031715|Ga0307476_10497736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 903 | Open in IMG/M |
3300031715|Ga0307476_10501219 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 899 | Open in IMG/M |
3300031715|Ga0307476_10692229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 755 | Open in IMG/M |
3300031718|Ga0307474_10069501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2613 | Open in IMG/M |
3300031754|Ga0307475_10244991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1436 | Open in IMG/M |
3300031823|Ga0307478_10292409 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1332 | Open in IMG/M |
3300031823|Ga0307478_11420886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 575 | Open in IMG/M |
3300031939|Ga0308174_10255352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1364 | Open in IMG/M |
3300032756|Ga0315742_12774167 | Not Available | 563 | Open in IMG/M |
3300032756|Ga0315742_13050571 | Not Available | 540 | Open in IMG/M |
3300032770|Ga0335085_10069803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4653 | Open in IMG/M |
3300032805|Ga0335078_10043030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6696 | Open in IMG/M |
3300032893|Ga0335069_11601122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 698 | Open in IMG/M |
3300032895|Ga0335074_10058134 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5288 | Open in IMG/M |
3300032896|Ga0335075_10016828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 10895 | Open in IMG/M |
3300032896|Ga0335075_10914072 | Not Available | 802 | Open in IMG/M |
3300033545|Ga0316214_1007092 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1490 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 21.58% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 11.51% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 10.07% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.47% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.04% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.32% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.88% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.88% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.88% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.88% |
Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 2.88% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 2.16% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.16% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 2.16% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.44% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.44% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.44% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.44% |
Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 1.44% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.44% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.44% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.44% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.44% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.72% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.72% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.72% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.72% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.72% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.72% |
Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.72% |
Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.72% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.72% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.72% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Host-Associated | Open in IMG/M |
3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Host-Associated | Open in IMG/M |
3300010143 | Soil microbial communities from Mekong Delta, Cambodia to study soil gas exchange rates - MK-CA-DRY metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010162 | Labiotermes labralis P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P1 (version 2) | Host-Associated | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010866 | Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
3300019268 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) | Environmental | Open in IMG/M |
3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021151 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022513 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022523 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022525 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022528 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
3300022712 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022714 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022721 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300023056 | Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS2 | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027037 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027164 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027505 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027817 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Host-Associated | Open in IMG/M |
3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030626 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO410-VDE110SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030969 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030981 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 4C (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Host-Associated | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
3300032756 | Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined Assembly | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12053J15887_102859152 | 3300001661 | Forest Soil | MPEVSGTVHEAETDALTSDELLVEEVSIDGMCGVY* |
JGI12627J18819_102596571 | 3300001867 | Forest Soil | MPEVSTGHEAETEALTSDELLVEEVSIDGMCGVY* |
JGIcombinedJ26739_1002442532 | 3300002245 | Forest Soil | MPEVSSTVHETETEALTSDELLVEEVSIDGMCGVY* |
JGIcombinedJ26739_1008485332 | 3300002245 | Forest Soil | MPEVSTPVVSSTVHEAEAEALTSDELLVEEVSIDGMCGVY* |
JGIcombinedJ51221_101468681 | 3300003505 | Forest Soil | MPEVSSPVFTSTAHEAETEVLTTDELLVEEVSIDGMCGVY* |
Ga0058863_119181773 | 3300004799 | Host-Associated | LVPLMPAEVPMADHETETEALTSDELLVEEVSIDGMCGVY* |
Ga0058861_100223421 | 3300004800 | Host-Associated | WHLVPLMPAEVPMAEVPTAGHETETEALTSDELLVEEVSIDGMCGVY* |
Ga0070658_100997491 | 3300005327 | Corn Rhizosphere | MPAEVPMAEVPTAGHETETEALTSDELLVEEISIDGMCGVY* |
Ga0070681_116715731 | 3300005458 | Corn Rhizosphere | LMLAEVRMPEVSFPGHEVEAEALTSDELLVEEISIDGMCGVY* |
Ga0070732_105865272 | 3300005542 | Surface Soil | MPEVPSTGYEAETEALTSDELLVEEVSIDGMCGVY* |
Ga0070665_1011278902 | 3300005548 | Switchgrass Rhizosphere | MAEVPTAGHETETEALTSDELLVEEVSIDGMCGVY* |
Ga0068857_1002818012 | 3300005577 | Corn Rhizosphere | MPEVSSTGHEVETEALTSDELLVEEVSIDGMCGVY* |
Ga0070763_101233902 | 3300005610 | Soil | MPEVSTPVVTSTVHEAETEALTSDELLVEEVSIDGMCGVY* |
Ga0070763_105264883 | 3300005610 | Soil | MPELPSTGHEAETEDLTSDELLVEEVSIDGMCGVY* |
Ga0068856_1007735912 | 3300005614 | Corn Rhizosphere | MPEVSSPGHEVEAEALTSDELLVEEISIDGMCGVY* |
Ga0070766_109157183 | 3300005921 | Soil | MPEVSTPVVASTAHEAEAEALTSDELLVEEVSIDGMCGVY* |
Ga0079222_124315032 | 3300006755 | Agricultural Soil | MPEVSSTAHEAETEALASDELLVEEVSIDGMCGVY* |
Ga0079221_102742492 | 3300006804 | Agricultural Soil | MPEVPSTGHEVETEALTSDELLVEEVSIDGMCGVY* |
Ga0102924_10485501 | 3300007982 | Iron-Sulfur Acid Spring | MLAEVPMPEVSTPVVSGAAPEAETEALTSDELLVEEVSIDGMCGVY* |
Ga0102924_10671423 | 3300007982 | Iron-Sulfur Acid Spring | MRAEVPMTEVPTTGSETETEALTSDELLVEEVSIDGMCGVY* |
Ga0105240_121218141 | 3300009093 | Corn Rhizosphere | MLAEVRMPEVSSPGHEVEAEALTSDELLVEEISIDGMCGVY* |
Ga0126374_110227641 | 3300009792 | Tropical Forest Soil | VSMPEVSTGHEAETEDLTSGELLVEEVSIDGMCGVY* |
Ga0123355_110721943 | 3300009826 | Termite Gut | VPLMLAEVPMPEVSNTGHEAETEALTSDELLVEEVSIDGMCGVY* |
Ga0123355_119002611 | 3300009826 | Termite Gut | MLVEVPMPEVSSTGHEAETETLTSDELLVEEVSIDGMCGVY* |
Ga0123356_102840212 | 3300010049 | Termite Gut | MLAEVPMPEVPTAVPEAETDALTSDELLVEEVSIDGMCGVY* |
Ga0126322_10499153 | 3300010143 | Soil | LVPLTPAEVPMADHETETEALTSDELLVEEVSIDGMCGVY* |
Ga0131853_106141452 | 3300010162 | Termite Gut | MLAEVPMPEVASTGHEAETEALTSDELLVEEVSIDGMCGVY* |
Ga0126370_119734021 | 3300010358 | Tropical Forest Soil | MPELSSTVHETETEALTSDELLVEEVSIDGMCGVY* |
Ga0134128_118429842 | 3300010373 | Terrestrial Soil | MLAEVPVAEVPTTGHEAETDALASDELLVEEVSIDGMCGVY* |
Ga0126381_1027475321 | 3300010376 | Tropical Forest Soil | MPEVSSAGHEAETEVLAADELLVEEVSIDGMCGVY* |
Ga0134126_105166533 | 3300010396 | Terrestrial Soil | MLTEVPVPEVSSTEVEALTSDELLVEEVSIDGMCGVY* |
Ga0126344_12220703 | 3300010866 | Boreal Forest Soil | LVPLMVAEVHMPEVSTPVVSSPVVSGTGHEAEAEALTSDELLVEEVSIDGMCGVY* |
Ga0126361_111757472 | 3300010876 | Boreal Forest Soil | MRAEVPVPEVSTPVVTSTGHEAETEALASDELLVEEVSIDGMCGVY* |
Ga0150983_103254383 | 3300011120 | Forest Soil | MPEVSSTGHEAETEALSSDELLVEEVSIDGMCGVY* |
Ga0150983_145587631 | 3300011120 | Forest Soil | LAEVPMPEVSTPVVSGAAPEAETEALTSDELLVEEVSIDGMCGVY* |
Ga0137393_102401081 | 3300011271 | Vadose Zone Soil | MPEVSTPVVASTVHEAEAEALTSDELLVEEVSIDGMCG |
Ga0137363_105393393 | 3300012202 | Vadose Zone Soil | FPMAEVLTTEVSPAGDEAETEALTSDELLVEEVSIDGMCGVY* |
Ga0137385_110592862 | 3300012359 | Vadose Zone Soil | MPEVSNTGHEAETEALTSDELLVEEVSIDGMCGVY* |
Ga0137413_102827342 | 3300012924 | Vadose Zone Soil | MVAEVPMPEVSTPVVSSPVFSSPVVAGTVHEAEAEALTSDELLVEEVSIDGMCGVY* |
Ga0164303_113300832 | 3300012957 | Soil | MLAEVRMPEVSFPGHEVEAEALTSDELLVEEISIDGMCGVY* |
Ga0181534_104841302 | 3300014168 | Bog | MPEVIIGHEAETEALTSDELLVEEVSIDGMCGVY* |
Ga0181531_100438443 | 3300014169 | Bog | MRAEVPMPEVSSPVVPSTAHEAETEVLTTDELLVEEVSIDGMCGVY* |
Ga0157379_106051963 | 3300014968 | Switchgrass Rhizosphere | AEVPTAGDETETEALTSDELLVEEVSIDGMCGVY* |
Ga0187809_100539043 | 3300017937 | Freshwater Sediment | MPEVSSTEPEAETEALASDELLVEEVSIDGMCGVY |
Ga0181514_14466382 | 3300019268 | Peatland | MPEVSSPVVPSTAHEAETEVLTTDELLVEEVSIDGMCGVY |
Ga0197907_107875123 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | MPEVSFPGHEVEAEALTSDELLVEEISIDGMCGVY |
Ga0206356_100302683 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MPEVSSPGHEVEAEALTSDELLVEEISIDGMCGVY |
Ga0206356_108126053 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEVPTAGHETETEALTSDELLVEEVSIDGMCGVY |
Ga0206349_16692271 | 3300020075 | Corn, Switchgrass And Miscanthus Rhizosphere | LVPLMLAEVRMPEVSSPGHEVEAEALTSDELLVEEISIDGMCGVS |
Ga0206349_18454913 | 3300020075 | Corn, Switchgrass And Miscanthus Rhizosphere | LVPLMPAEVPMAEVPTAGHETETEALTSDELLVEEVSIDGMCGVY |
Ga0206355_11131791 | 3300020076 | Corn, Switchgrass And Miscanthus Rhizosphere | LVPLMLAEVRMPEVSSPGHEVEAEALTSDELLVEEISIDGMCGVY |
Ga0206351_106718321 | 3300020077 | Corn, Switchgrass And Miscanthus Rhizosphere | LMLAEVRMPEVSFPGHEVEAEALTSDELLVEEISIDGMCGVY |
Ga0206352_100750291 | 3300020078 | Corn, Switchgrass And Miscanthus Rhizosphere | LVPLMLAEVRMPEVSGTEHEVETEALTSDELLVEEVSIDGMCGVY |
Ga0206352_102026282 | 3300020078 | Corn, Switchgrass And Miscanthus Rhizosphere | PLMPAEVPMAEVPTAGHETETEALTSDELLVEEVSIDGMCGVY |
Ga0206350_113354571 | 3300020080 | Corn, Switchgrass And Miscanthus Rhizosphere | HLVPLMLAEVRMPEVSSPGHEVEAEALTSDELLVEEISIDGMCGVY |
Ga0206354_115595473 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | WHLVPLMPAEVPMAEVPTAGHETETEALTSDELLVEEVSIDGMCGVY |
Ga0206353_105314703 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | MLAEVRMPEVSGTEHEVETEALTSDELLVEEVSIDGMCGVY |
Ga0179592_102126251 | 3300020199 | Vadose Zone Soil | SPVVAGTVHEAEAEALASDELLVEEVSIDGMCGVY |
Ga0210403_103236842 | 3300020580 | Soil | LRLAELTEHEAETEALTSDELLVEEVSIDGMCGVY |
Ga0210395_106576583 | 3300020582 | Soil | MAEVTATEVPAAGHEAETAALTSDELLVEEVSIDGMCGVY |
Ga0210401_100521104 | 3300020583 | Soil | MPEVSTPVVAGTGHEAEAEDLASEELLVEEVSIDGMCGVY |
Ga0154015_10197801 | 3300020610 | Corn, Switchgrass And Miscanthus Rhizosphere | HLVPLMPAEVPMAEVPTAGHETETEALTSDELLVEEVSIDGMCGVY |
Ga0179584_12800331 | 3300021151 | Vadose Zone Soil | LMLAEVPMPEVSSTGLEAETEVLTSDELLVEEVSIDGMCGVY |
Ga0210405_111909331 | 3300021171 | Soil | HMPEVSTPVVAGTGHEAEAEDLASEELLVEEVSIDGMCGVY |
Ga0210408_101452022 | 3300021178 | Soil | MPEVSSTGHEAETEALSSDELLVEEVSIDGMCGVY |
Ga0210396_104516823 | 3300021180 | Soil | MPEVSTPVVSTAVVAGTGHEAEAEALASEELLVEEVSIDGMCGVY |
Ga0210393_106387982 | 3300021401 | Soil | MPEVSTPVVSGAAPEAETEALTSDELLVEEVSIDGMCGVY |
Ga0210385_100064526 | 3300021402 | Soil | MAEVPSTGHETETEELTSDELLVEEVSIDGMCGVY |
Ga0210385_102926752 | 3300021402 | Soil | VPEVSTTGHEAETEALTSDELLVEEVSIDGMCGVY |
Ga0210389_100230706 | 3300021404 | Soil | MPEVSTTGHEAETEALTSDELLVEEVSIDGMCGVY |
Ga0210387_104513923 | 3300021405 | Soil | MPEVSTPVVTSTVHEAETEALTSDELLVEEVSIDGMCGVY |
Ga0210386_104790082 | 3300021406 | Soil | MRAEVHVPEVSTTGHEAETEALTSDELLVEEVSIDGMCGVY |
Ga0210383_105025042 | 3300021407 | Soil | MPEVSSTGHEAETEALTSDELLVEEVSIDGMCGVY |
Ga0210398_107602062 | 3300021477 | Soil | MAEVPGTGHETETEELTSDELLVEEVSIDGMCGVY |
Ga0210410_104509422 | 3300021479 | Soil | MPEVSTPVVAGTGHEAEAEALASEELLVEEVSIDGMCGVY |
Ga0126371_113768051 | 3300021560 | Tropical Forest Soil | MPEVSSAGHEAETEVLAADELLVEEVSIDGMCGVY |
Ga0224712_103668781 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | MPEVPSTGHEVETEALTSDELLVEEVSIDGMCGVY |
Ga0242667_10207333 | 3300022513 | Soil | VPLMRAEVNVPEVSTTGHEAETEALNSDELLVEEVSIDGMCGVY |
Ga0242663_10342673 | 3300022523 | Soil | LVPLMVAEVHMPEVSTPVVAGTVVSGTVHEADAEVLTSDELLVEEVSIDGMCGVY |
Ga0242656_10411633 | 3300022525 | Soil | MAEIPTAEVSTTVFSAAGHEAEILASDELLVEEVSIDGMCGVY |
Ga0242669_10558181 | 3300022528 | Soil | LVPLMVAEVHMPEVSTPVVAGTGHEAEAEDLASEELLVEEVSIDGMCGVY |
Ga0212123_1001592410 | 3300022557 | Iron-Sulfur Acid Spring | MTEVPTTGSETETEALTSDELLVEEVSIDGMCGVY |
Ga0242653_10549161 | 3300022712 | Soil | LSATTPEVPMPEQVKEQVGETEALCSDELLVEEVSIDGMCGVY |
Ga0242671_10461583 | 3300022714 | Soil | PMPEVSSAGHETETEALTSDELLVEEVSIDGMCGVY |
Ga0242666_11767373 | 3300022721 | Soil | VPLMRAEVHVPEVSTTGHEAETEALTSDELLVEEVSIDGMCGVY |
Ga0242665_103245172 | 3300022724 | Soil | MPEVSSTGHESETEALTSDELLVEEVSIDGMCGVY |
Ga0242654_100991401 | 3300022726 | Soil | MAEVPTAEVSTTVFSAAGHEAEILASDELLVEEVSIDGMCGVY |
Ga0242654_102865461 | 3300022726 | Soil | EVSTPVVSNTEHEAAAEALTSDELLVEEVSIDGMCGVY |
Ga0233357_10080743 | 3300023056 | Soil | MPEVSTPVVSSPVVSSTVHEAEAEALTSDELLVEEVSIDGMCGVY |
Ga0207693_112466492 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MPEVPDTGHEAETEALTSDELLVEEVSIDGMCGVY |
Ga0207700_102357332 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MPEVSDTGHETETEALTSDELLVEEVSIDGMCGVY |
Ga0207700_107898192 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MPEVSNTGLEAETEALTSDELLVEEVSIDGMCGVY |
Ga0207678_100025829 | 3300026067 | Corn Rhizosphere | MPEVSGTEHEVETEALTSDELLVEEVSIDGMCGVY |
Ga0179593_10219525 | 3300026555 | Vadose Zone Soil | VFSSPVVAGTVHEAEAEALTSDELLVEEVSIDGMCGVY |
Ga0179587_100668822 | 3300026557 | Vadose Zone Soil | MPEVSTPVVSSPVFSSPVVAGTVHEAEAEALTSDELLVEEVSIDGMCGVY |
Ga0209005_10030642 | 3300027037 | Forest Soil | MAQVPTAGHEAETEALTSDELLVEEVSIDGMCGVY |
Ga0208994_10020452 | 3300027164 | Forest Soil | MPEVSGTVHEAETDALTSDELLVEEVSIDGMCGVY |
Ga0209218_10469382 | 3300027505 | Forest Soil | MPEVSSTVHEAETEALTSDELLVEEVSIDGMCGVY |
Ga0209112_103481182 | 3300027817 | Forest Soil | MLAEVRMPEVSPAVHEAETEALTSDELLVEEVSIDGMCGVY |
Ga0209275_101226092 | 3300027884 | Soil | MPETPSAGHEPEAEALTSDELLVEEISIDGMCGVY |
Ga0209624_102306472 | 3300027895 | Forest Soil | MPELSSTGHEAETEALTSDELLVEEVSIDGMCGVY |
Ga0209415_101629653 | 3300027905 | Peatlands Soil | MPEVPSTGHEAEAEALASDELLVEEVSIDGMCGVY |
Ga0209415_105323672 | 3300027905 | Peatlands Soil | MPEVSSNGHETETEALTSDELLVEEVSIDGMCGVY |
Ga0209006_100270033 | 3300027908 | Forest Soil | MPEVSSTGHEAEAEALTSDELLVEEVSIDGMCGVY |
Ga0209006_104759942 | 3300027908 | Forest Soil | MPEVSSTVHEAETEVLTSDELLVEEVSIDGMCGVY |
Ga0209006_110047371 | 3300027908 | Forest Soil | MPEVSTPVVTDTGHEADAEALTSDELLVEEVSIDGMCGVY |
Ga0209526_101202582 | 3300028047 | Forest Soil | MPEVSTPVVSSTVHEAEAEALTSDELLVEEVSIDGMCGVY |
Ga0268266_104268341 | 3300028379 | Switchgrass Rhizosphere | MAEVPTAGHETETEALTSDELLVEEVSIDGMSGVY |
Ga0137415_110801622 | 3300028536 | Vadose Zone Soil | MLAEVPMPEVSSTGHEAETEALTSDELLVEEVSIDGMCGVY |
Ga0265337_100003344 | 3300028556 | Rhizosphere | MPEVSSTGHETETEALASDELLVEEVSIDGMCGVY |
Ga0265337_11546473 | 3300028556 | Rhizosphere | SRLPYRRHQEVRMPEQETETEALTSDELLVEEVSIDGMCGVY |
Ga0265338_102007223 | 3300028800 | Rhizosphere | MPEVPSTAHETETEALASDELLVEEVSIDGMCGVY |
Ga0222749_104120243 | 3300029636 | Soil | LVPLMDGGSMPEVLSGHEAETEALTSDELLVEEVSIDGMCGVY |
Ga0210291_107856501 | 3300030626 | Soil | RTEDLMPEVSSTGHEAETEALTSDELLVEEVSIDGMCGVY |
Ga0265766_10259321 | 3300030863 | Soil | LGATIAPEVPMAEVPTTGHEAETEELSSEELLVEEVSIDGMCGVY |
Ga0075394_120298803 | 3300030969 | Soil | MPEVPSTGHEAETEALTSDELLVEEVSIDGMCGVY |
Ga0102770_111747533 | 3300030981 | Soil | PAEVHVPEVSSTVQEAETEALTSDELLVEEVSIDGMCGVY |
Ga0170834_1062100121 | 3300031057 | Forest Soil | MAEVPTAEVPTAGHEAETEVLASDELLVEEVSIDGMCGVY |
Ga0170824_1126989191 | 3300031231 | Forest Soil | ALWHLVPLMIAEVPMTEVPTTVFSAAGHEAETEVLASDELLVEEVSIDGMCGVY |
Ga0307508_105928811 | 3300031616 | Ectomycorrhiza | MPEVSSIGHEAETEVLTSDELLVEEVSIDGMCGVY |
Ga0310686_1033898142 | 3300031708 | Soil | MPEVSTPVVSSTGHEAETEALTSDELLVEEVSIDGMCGVY |
Ga0310686_1178615786 | 3300031708 | Soil | MTEVSSPVLTSTAHEAETEVLTTDELLVEEVSIDGMCGVY |
Ga0307476_104977362 | 3300031715 | Hardwood Forest Soil | MPEVSTPVITSTVHEAETEALTSDELLVEEVSIDGMCG |
Ga0307476_105012193 | 3300031715 | Hardwood Forest Soil | MPEVSTTGPEAETEALTSDELLVEEVSIDGMCGVY |
Ga0307476_106922293 | 3300031715 | Hardwood Forest Soil | MRAEVPVTEVPTTGSETETEALTSDELLVEEVSIDGMCGVY |
Ga0307474_100695012 | 3300031718 | Hardwood Forest Soil | MPEVSTPVVSTPVVAGTGHEAEAEALASEELLVEEVSIDGMCGVY |
Ga0307475_102449912 | 3300031754 | Hardwood Forest Soil | MPEVSTPVVAGTGHEAEAEALASDELLVEEVSIDGMCGVY |
Ga0307478_102924093 | 3300031823 | Hardwood Forest Soil | LVPLMLAEVHMPEVSTTGPEAETEALTSDELLVEEVSIDGMCGVY |
Ga0307478_114208863 | 3300031823 | Hardwood Forest Soil | NTGLANTVLANPVHEAGTEALTSDELLVEEVSIDGMCGVY |
Ga0308174_102553523 | 3300031939 | Soil | MPEVSSTGHEVETEALTSDELLVEEVSIDGMCGVY |
Ga0315742_127741671 | 3300032756 | Forest Soil | PLMVAEVHMPEVSTPVVSSPVVSSTVHEAEAEALTSDELLVEEVSIDGMCGVY |
Ga0315742_130505711 | 3300032756 | Forest Soil | PEVSSPVVTSTAHEAETEALTSDELLVEEVSIDGMCGVY |
Ga0335085_100698035 | 3300032770 | Soil | MPDVSSTGHEAETDALTSDELLVEEVSIDGMCGVY |
Ga0335078_100430304 | 3300032805 | Soil | MPEVSSTAHEAETEALTSEELLVEEVSIDGMCGVY |
Ga0335069_116011222 | 3300032893 | Soil | MAEVPTTGHEADTDALASDELLVEEVSIDGMCGVY |
Ga0335074_100581343 | 3300032895 | Soil | MAEHEVATHEADADALASDELLVEEVSIDGMCGVY |
Ga0335075_100168284 | 3300032896 | Soil | MAEVPTTGHETETEALTSDELLVEEVSIDGMCGVY |
Ga0335075_109140722 | 3300032896 | Soil | MAEVPTTGHDTETETLTSDELLVEEVSIDGMCGVY |
Ga0316214_10070923 | 3300033545 | Roots | MAEVSGPVFTSTAHEAETEVLTTDELLVEEVSIDGMCGVY |
⦗Top⦘ |