NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F054973

Metagenome Family F054973

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F054973
Family Type Metagenome
Number of Sequences 139
Average Sequence Length 45 residues
Representative Sequence MHTPYFPAFRSRLAALGRRTAGTLRQATLEQLQQHLRDLLPAPLL
Number of Associated Samples 131
Number of Associated Scaffolds 139

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 55.40 %
% of genes near scaffold ends (potentially truncated) 98.56 %
% of genes from short scaffolds (< 2000 bps) 94.96 %
Associated GOLD sequencing projects 130
AlphaFold2 3D model prediction Yes
3D model pTM-score0.32

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (82.734 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog
(11.511 % of family members)
Environment Ontology (ENVO) Unclassified
(20.863 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(30.216 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 45.21%    β-sheet: 0.00%    Coil/Unstructured: 54.79%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.32
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 139 Family Scaffolds
PF02353CMAS 2.16
PF01609DDE_Tnp_1 2.16
PF13542HTH_Tnp_ISL3 1.44
PF00106adh_short 0.72
PF00730HhH-GPD 0.72
PF05960DUF885 0.72
PF13669Glyoxalase_4 0.72
PF07963N_methyl 0.72
PF01797Y1_Tnp 0.72
PF13495Phage_int_SAM_4 0.72
PF04542Sigma70_r2 0.72
PF00375SDF 0.72

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 139 Family Scaffolds
COG2226Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenGCoenzyme transport and metabolism [H] 2.16
COG22272-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylaseCoenzyme transport and metabolism [H] 2.16
COG2230Cyclopropane fatty-acyl-phospholipid synthase and related methyltransferasesLipid transport and metabolism [I] 2.16
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 2.16
COG3293TransposaseMobilome: prophages, transposons [X] 2.16
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 2.16
COG5421TransposaseMobilome: prophages, transposons [X] 2.16
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 2.16
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 2.16
COG01223-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylaseReplication, recombination and repair [L] 0.72
COG0177Endonuclease IIIReplication, recombination and repair [L] 0.72
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.72
COG1059Thermostable 8-oxoguanine DNA glycosylaseReplication, recombination and repair [L] 0.72
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 0.72
COG1194Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairsReplication, recombination and repair [L] 0.72
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.72
COG1943REP element-mobilizing transposase RayTMobilome: prophages, transposons [X] 0.72
COG22313-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamilyReplication, recombination and repair [L] 0.72
COG4805Uncharacterized conserved protein, DUF885 familyFunction unknown [S] 0.72
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 0.72

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms82.73 %
UnclassifiedrootN/A17.27 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001213|JGIcombinedJ13530_103702123All Organisms → cellular organisms → Bacteria → PVC group521Open in IMG/M
3300001471|JGI12712J15308_10042536Not Available1161Open in IMG/M
3300002347|JGIcombinedJ26865_1075468All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514541Open in IMG/M
3300004282|Ga0066599_101015137All Organisms → cellular organisms → Bacteria → PVC group604Open in IMG/M
3300005536|Ga0070697_101700793Not Available564Open in IMG/M
3300005554|Ga0066661_10412891All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia827Open in IMG/M
3300005602|Ga0070762_11218418All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514521Open in IMG/M
3300005712|Ga0070764_10726590Not Available613Open in IMG/M
3300005830|Ga0074473_10164457All Organisms → cellular organisms → Bacteria → PVC group615Open in IMG/M
3300005901|Ga0075274_1062992Not Available585Open in IMG/M
3300006031|Ga0066651_10560439All Organisms → cellular organisms → Bacteria → PVC group606Open in IMG/M
3300006041|Ga0075023_100235619All Organisms → cellular organisms → Bacteria → PVC group724Open in IMG/M
3300006102|Ga0075015_100589191All Organisms → cellular organisms → Bacteria → PVC group650Open in IMG/M
3300006224|Ga0079037_101561975All Organisms → cellular organisms → Bacteria → PVC group659Open in IMG/M
3300007265|Ga0099794_10806923Not Available502Open in IMG/M
3300009137|Ga0066709_104086195All Organisms → cellular organisms → Bacteria → PVC group531Open in IMG/M
3300009167|Ga0113563_12759941All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300009500|Ga0116229_11281472Not Available583Open in IMG/M
3300009521|Ga0116222_1040339All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium2046Open in IMG/M
3300009522|Ga0116218_1474653All Organisms → cellular organisms → Bacteria → PVC group558Open in IMG/M
3300009548|Ga0116107_1028919All Organisms → cellular organisms → Bacteria → PVC group2075Open in IMG/M
3300009623|Ga0116133_1143737All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium ADurb.Bin006623Open in IMG/M
3300009639|Ga0116122_1077798All Organisms → cellular organisms → Bacteria → PVC group1093Open in IMG/M
3300009644|Ga0116121_1104055All Organisms → cellular organisms → Bacteria890Open in IMG/M
3300009709|Ga0116227_11412634All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514523Open in IMG/M
3300009762|Ga0116130_1149236All Organisms → cellular organisms → Bacteria → PVC group737Open in IMG/M
3300010336|Ga0134071_10549278Not Available600Open in IMG/M
3300010362|Ga0126377_11853218Not Available679Open in IMG/M
3300011443|Ga0137457_1289747All Organisms → cellular organisms → Bacteria → PVC group559Open in IMG/M
3300012096|Ga0137389_11778507Not Available512Open in IMG/M
3300012168|Ga0137357_1095915All Organisms → cellular organisms → Bacteria → PVC group610Open in IMG/M
3300012201|Ga0137365_10102100All Organisms → cellular organisms → Bacteria2158Open in IMG/M
3300012205|Ga0137362_10966107Not Available726Open in IMG/M
3300012285|Ga0137370_10599098All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium681Open in IMG/M
3300012353|Ga0137367_10428284All Organisms → cellular organisms → Bacteria → PVC group937Open in IMG/M
3300012361|Ga0137360_11554910All Organisms → cellular organisms → Bacteria → PVC group566Open in IMG/M
3300012582|Ga0137358_10944649Not Available562Open in IMG/M
3300012683|Ga0137398_10937996Not Available602Open in IMG/M
3300012927|Ga0137416_11835420All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514554Open in IMG/M
(restricted) 3300013125|Ga0172369_10414214All Organisms → cellular organisms → Bacteria → PVC group674Open in IMG/M
3300014158|Ga0181521_10426342All Organisms → cellular organisms → Bacteria → PVC group648Open in IMG/M
3300014167|Ga0181528_10178896All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → unclassified Pedosphaera → Pedosphaera sp. Tous-C6FEB1146Open in IMG/M
3300014169|Ga0181531_10949747All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300014199|Ga0181535_10072011All Organisms → cellular organisms → Bacteria2293Open in IMG/M
3300014498|Ga0182019_10359879All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia984Open in IMG/M
3300014502|Ga0182021_13403013All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514530Open in IMG/M
3300014872|Ga0180087_1087811All Organisms → cellular organisms → Bacteria → PVC group597Open in IMG/M
3300015053|Ga0137405_1211963All Organisms → cellular organisms → Bacteria → PVC group1093Open in IMG/M
3300016387|Ga0182040_11714458All Organisms → cellular organisms → Bacteria → PVC group537Open in IMG/M
3300017938|Ga0187854_10251948All Organisms → cellular organisms → Bacteria → PVC group765Open in IMG/M
3300017975|Ga0187782_11378436Not Available554Open in IMG/M
3300017988|Ga0181520_10968414All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium ADurb.Bin006564Open in IMG/M
3300018014|Ga0187860_1352481All Organisms → cellular organisms → Bacteria → PVC group559Open in IMG/M
3300018015|Ga0187866_1109776All Organisms → cellular organisms → Bacteria1126Open in IMG/M
3300018022|Ga0187864_10357665All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514638Open in IMG/M
3300018024|Ga0187881_10417611All Organisms → cellular organisms → Bacteria → PVC group549Open in IMG/M
3300018040|Ga0187862_10414132All Organisms → cellular organisms → Bacteria → PVC group825Open in IMG/M
3300018043|Ga0187887_10561380All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514674Open in IMG/M
3300018044|Ga0187890_10568388All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514639Open in IMG/M
3300018082|Ga0184639_10513810All Organisms → cellular organisms → Bacteria → PVC group602Open in IMG/M
3300019360|Ga0187894_10231162All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula885Open in IMG/M
3300020005|Ga0193697_1118358Not Available618Open in IMG/M
3300020057|Ga0163151_10549715All Organisms → cellular organisms → Bacteria → PVC group545Open in IMG/M
3300020195|Ga0163150_10471379All Organisms → cellular organisms → Bacteria → PVC group560Open in IMG/M
3300021086|Ga0179596_10655063Not Available532Open in IMG/M
3300021181|Ga0210388_11600995All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514541Open in IMG/M
3300021401|Ga0210393_11395973All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514559Open in IMG/M
3300021402|Ga0210385_11290762Not Available559Open in IMG/M
3300021420|Ga0210394_10983601All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514731Open in IMG/M
3300021420|Ga0210394_11573970All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514554Open in IMG/M
3300021962|Ga0222713_10766104All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300022835|Ga0224537_1017488Not Available608Open in IMG/M
3300025463|Ga0208193_1080069All Organisms → cellular organisms → Bacteria → PVC group656Open in IMG/M
3300025507|Ga0208188_1131501All Organisms → cellular organisms → Bacteria → PVC group542Open in IMG/M
3300025548|Ga0208716_1073668All Organisms → cellular organisms → Bacteria → PVC group697Open in IMG/M
3300025648|Ga0208507_1130726All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514709Open in IMG/M
3300025807|Ga0208828_1117429All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514599Open in IMG/M
3300025838|Ga0208872_1194738Not Available676Open in IMG/M
3300025852|Ga0209124_10123605All Organisms → cellular organisms → Bacteria1060Open in IMG/M
3300026116|Ga0207674_12105432All Organisms → cellular organisms → Bacteria → PVC group528Open in IMG/M
3300026823|Ga0207759_119230All Organisms → cellular organisms → Bacteria → PVC group530Open in IMG/M
3300026895|Ga0207758_1026926All Organisms → cellular organisms → Bacteria → PVC group543Open in IMG/M
3300027819|Ga0209514_10177571All Organisms → cellular organisms → Bacteria → PVC group1099Open in IMG/M
3300027860|Ga0209611_10510574All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514674Open in IMG/M
3300027903|Ga0209488_10991999Not Available582Open in IMG/M
3300028560|Ga0302144_10172519All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514699Open in IMG/M
3300028748|Ga0302156_10244105All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514824Open in IMG/M
3300028779|Ga0302266_10338441All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300028792|Ga0307504_10410234All Organisms → cellular organisms → Bacteria → PVC group535Open in IMG/M
3300028873|Ga0302197_10200209All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia933Open in IMG/M
3300029911|Ga0311361_10002560All Organisms → cellular organisms → Bacteria39054Open in IMG/M
3300029911|Ga0311361_10099877All Organisms → cellular organisms → Bacteria4124Open in IMG/M
3300029911|Ga0311361_11219773All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300029915|Ga0311358_10252244All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales1541Open in IMG/M
3300029915|Ga0311358_10412712All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin5141086Open in IMG/M
3300029922|Ga0311363_10772860All Organisms → cellular organisms → Bacteria892Open in IMG/M
3300029953|Ga0311343_11063845Not Available629Open in IMG/M
3300029956|Ga0302150_10391348All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300029990|Ga0311336_10880192All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514774Open in IMG/M
3300029990|Ga0311336_11700955All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514557Open in IMG/M
3300029992|Ga0302276_10218598All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514870Open in IMG/M
3300030004|Ga0302186_10298826All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514538Open in IMG/M
3300030294|Ga0311349_11692619All Organisms → cellular organisms → Bacteria → PVC group585Open in IMG/M
3300030294|Ga0311349_11841400All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514558Open in IMG/M
3300030339|Ga0311360_11249944Not Available583Open in IMG/M
3300030620|Ga0302046_11090401All Organisms → cellular organisms → Bacteria → PVC group632Open in IMG/M
3300030838|Ga0311335_11231895All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300031232|Ga0302323_100799607All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula1037Open in IMG/M
3300031258|Ga0302318_10042557All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin5141786Open in IMG/M
3300031525|Ga0302326_12994378All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300031576|Ga0247727_10316610All Organisms → cellular organisms → Bacteria1314Open in IMG/M
3300031708|Ga0310686_110827784Not Available716Open in IMG/M
3300031708|Ga0310686_118303116Not Available717Open in IMG/M
3300031772|Ga0315288_11062716All Organisms → cellular organisms → Bacteria → PVC group713Open in IMG/M
3300031788|Ga0302319_10007277All Organisms → cellular organisms → Bacteria21794Open in IMG/M
3300031820|Ga0307473_11237694All Organisms → cellular organisms → Bacteria → PVC group556Open in IMG/M
3300031834|Ga0315290_11379784All Organisms → cellular organisms → Bacteria → PVC group577Open in IMG/M
3300031873|Ga0315297_11390290All Organisms → cellular organisms → Bacteria → PVC group570Open in IMG/M
3300031879|Ga0306919_10170158All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula1603Open in IMG/M
3300031897|Ga0318520_10919774All Organisms → cellular organisms → Bacteria → PVC group551Open in IMG/M
3300031902|Ga0302322_101479170All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514829Open in IMG/M
3300031997|Ga0315278_12041319All Organisms → cellular organisms → Bacteria → PVC group534Open in IMG/M
3300032042|Ga0318545_10355198All Organisms → cellular organisms → Bacteria → PVC group528Open in IMG/M
3300032076|Ga0306924_11446114All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula731Open in IMG/M
3300032118|Ga0315277_11402510All Organisms → cellular organisms → Bacteria → PVC group605Open in IMG/M
3300032143|Ga0315292_10973660All Organisms → cellular organisms → Bacteria705Open in IMG/M
3300032163|Ga0315281_12281017All Organisms → cellular organisms → Bacteria → PVC group511Open in IMG/M
3300032397|Ga0315287_12110059All Organisms → cellular organisms → Bacteria → PVC group617Open in IMG/M
3300032401|Ga0315275_10356753Not Available1638Open in IMG/M
3300032401|Ga0315275_12507040All Organisms → cellular organisms → Bacteria → PVC group533Open in IMG/M
3300032516|Ga0315273_11252970All Organisms → cellular organisms → Bacteria → PVC group930Open in IMG/M
3300033416|Ga0316622_101524825All Organisms → cellular organisms → Bacteria780Open in IMG/M
3300033480|Ga0316620_11787456All Organisms → cellular organisms → Bacteria → PVC group610Open in IMG/M
3300033483|Ga0316629_10361217All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1008Open in IMG/M
3300033486|Ga0316624_12076679All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514528Open in IMG/M
3300033488|Ga0316621_10522394All Organisms → cellular organisms → Bacteria → PVC group833Open in IMG/M
3300033890|Ga0334810_133382All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514598Open in IMG/M
3300034156|Ga0370502_0218475All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium ADurb.Bin006609Open in IMG/M
3300034157|Ga0370506_083360All Organisms → cellular organisms → Bacteria → PVC group700Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog11.51%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil9.35%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment7.91%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland5.76%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen5.76%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland5.04%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.04%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog3.60%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.60%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.60%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil2.16%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil2.16%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.16%
Host-AssociatedHost-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated2.16%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater1.44%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.44%
Freshwater Microbial MatEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat1.44%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands1.44%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.44%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.44%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.44%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil1.44%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen1.44%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.44%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.44%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil1.44%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater0.72%
FreshwaterEnvironmental → Aquatic → Freshwater → Pond → Sediment → Freshwater0.72%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.72%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.72%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.72%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.72%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.72%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.72%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.72%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.72%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.72%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.72%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.72%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.72%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.72%
Microbial Mat On RocksEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks0.72%
BiofilmEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm0.72%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.72%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300001471Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2EnvironmentalOpen in IMG/M
3300002347Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 deep-072012 (NGEE Surface samples 415 (1, 2, 3 deep-072012) AP id is 1030520, ASSEMBLY_DATE=20131219)EnvironmentalOpen in IMG/M
3300004282Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sedimentEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005830Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.178_YBMEnvironmentalOpen in IMG/M
3300005901Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_201EnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006041Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006224Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaGEnvironmentalOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009167Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)EnvironmentalOpen in IMG/M
3300009500Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MGHost-AssociatedOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009548Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100EnvironmentalOpen in IMG/M
3300009623Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10EnvironmentalOpen in IMG/M
3300009639Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40EnvironmentalOpen in IMG/M
3300009644Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10EnvironmentalOpen in IMG/M
3300009709Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fb - Sphagnum magellanicum MGHost-AssociatedOpen in IMG/M
3300009762Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40EnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300011443Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012168Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT860_2EnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300013125 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11.25mEnvironmentalOpen in IMG/M
3300014158Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaGEnvironmentalOpen in IMG/M
3300014167Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014199Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaGEnvironmentalOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014872Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT790_16_10DEnvironmentalOpen in IMG/M
3300015053Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300017938Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150EnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300018014Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40EnvironmentalOpen in IMG/M
3300018015Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150EnvironmentalOpen in IMG/M
3300018022Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40EnvironmentalOpen in IMG/M
3300018024Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2EnvironmentalOpen in IMG/M
3300019360White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaGEnvironmentalOpen in IMG/M
3300020005Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2EnvironmentalOpen in IMG/M
3300020057Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP5.IB-2EnvironmentalOpen in IMG/M
3300020195Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.P2.IBEnvironmentalOpen in IMG/M
3300021086Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300022835Peat soil microbial communities from Stordalen Mire, Sweden - 717 E2 10-14EnvironmentalOpen in IMG/M
3300025463Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025507Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025548Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-3 deep-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025648Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09.1 (SPAdes)EnvironmentalOpen in IMG/M
3300025807Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_160m (SPAdes)EnvironmentalOpen in IMG/M
3300025838Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug08 (SPAdes)EnvironmentalOpen in IMG/M
3300025852Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-22A (SPAdes)EnvironmentalOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026823Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 19 (SPAdes)EnvironmentalOpen in IMG/M
3300026895Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 12 (SPAdes)EnvironmentalOpen in IMG/M
3300027819Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW37 contaminated, 5.8 m (SPAdes)EnvironmentalOpen in IMG/M
3300027860Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG (SPAdes)Host-AssociatedOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300028560Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_2EnvironmentalOpen in IMG/M
3300028748Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2EnvironmentalOpen in IMG/M
3300028779Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_2EnvironmentalOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300028873Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_1EnvironmentalOpen in IMG/M
3300029911III_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029915III_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300029922III_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029953II_Bog_E3 coassemblyEnvironmentalOpen in IMG/M
3300029956Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_2EnvironmentalOpen in IMG/M
3300029990I_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300029992Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_3EnvironmentalOpen in IMG/M
3300030004Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E1_1EnvironmentalOpen in IMG/M
3300030294II_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300030339III_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300030620Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111EnvironmentalOpen in IMG/M
3300030838I_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300031232Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3EnvironmentalOpen in IMG/M
3300031258Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_1EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031576Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031772Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20EnvironmentalOpen in IMG/M
3300031788Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031834Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0EnvironmentalOpen in IMG/M
3300031873Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031902Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2EnvironmentalOpen in IMG/M
3300031997Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0EnvironmentalOpen in IMG/M
3300032042Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032118Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15EnvironmentalOpen in IMG/M
3300032143Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0EnvironmentalOpen in IMG/M
3300032163Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0EnvironmentalOpen in IMG/M
3300032397Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0EnvironmentalOpen in IMG/M
3300032401Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0EnvironmentalOpen in IMG/M
3300032516Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0EnvironmentalOpen in IMG/M
3300033416Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_CEnvironmentalOpen in IMG/M
3300033480Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_BEnvironmentalOpen in IMG/M
3300033483Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_AEnvironmentalOpen in IMG/M
3300033486Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_AEnvironmentalOpen in IMG/M
3300033488Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_CEnvironmentalOpen in IMG/M
3300033890Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-1-MEnvironmentalOpen in IMG/M
3300034156Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_01D_18EnvironmentalOpen in IMG/M
3300034157Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_18EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
JGIcombinedJ13530_10370212313300001213WetlandMHTPFFPALRCRLAALGRRTTTSLRQSTLAQLQQQLREFLPPPL
JGI12712J15308_1004253613300001471Forest SoilMETPYFPQFRSRLAALGHRTHSMRQATLVQLQERLRDFLPAPLLS
JGIcombinedJ26865_107546823300002347Arctic Peat SoilMHTPYFPCLRSRLAPLGRRTTPNLRQTTLAQLQQHLRDFLPAPLL
Ga0066599_10101513713300004282FreshwaterMTPYFPALRSRLAALGRRTAQTVRQTTLAQLQEQLRDLLPAPLLS
Ga0070697_10170079323300005536Corn, Switchgrass And Miscanthus RhizosphereMHTPYFPALRSRVAALGRRTARTIRQATLDQLQEHLRDLLPAPLLSA
Ga0066661_1041289123300005554SoilMHTPYFPTLRSRLAALGRRTAHHTQQTTLVQLQQQLGDFLPPPLLCPQ
Ga0070762_1121841823300005602SoilMTTPYFPVFRSRLAALGRRTARTLRQTTLAQLQQHLR
Ga0070764_1072659023300005712SoilMNTPFFPEFRSRLAALGRRTTQTLRQTTLAQLQRHLSDFIPAPLLSAEDEGPNS
Ga0074473_1016445723300005830Sediment (Intertidal)MNTPFFPHWRSRLAALGRRTLRTVRQATLAQLQEHLRDFLPAPLLS
Ga0075274_106299213300005901Rice Paddy SoilMETPYFPCLRSRLAALGRRSAQTLRQATLTQLQEHLRELLPPPLLSATDEGPN
Ga0066651_1056043913300006031SoilMLHTPYFPTLRSRLAALGRRTAQTLRQTTLSQLQEHLRDLLPVPLLC
Ga0075023_10023561933300006041WatershedsMSTPFFPAFRSRLAALGRRTAHAIRQATLAQLQQHLGDYL
Ga0075015_10058919123300006102WatershedsMSTPFFPTFRSRLAALGRRTAHALGQATLVQLQQHLGDYLPAGLLSAEEEGAHS
Ga0079037_10156197513300006224Freshwater WetlandsMETPFFPALRARLAAYGRRSLQTVRQWTLAQLGQQLHDLL
Ga0099794_1080692323300007265Vadose Zone SoilMHTPYFPALRSGLAALGRRTAHALRQATLGQLQEHLR
Ga0066709_10408619513300009137Grasslands SoilMLTPYFPALRSRLAALGRRTAHSLRQATLGQLQEHLRDLLPAPLFSAEDQ
Ga0113563_1275994113300009167Freshwater WetlandsMHTPFFPVFRARFAALGRRTASPLRQNTLQQLAQHLA
Ga0116229_1128147223300009500Host-AssociatedMHTPFFPAFRPRLAALGRRTAQTLRQTTLAQLQHHLRDFLPPPLLA
Ga0116222_104033923300009521Peatlands SoilMHTPCFPAFRSRLAALGRRTTPNLRQTTLAQLQQHLRDFLPAPLLGRGGRPQQP*
Ga0116218_147465313300009522Peatlands SoilMPTPYFPAFRSRLAALGRRTVQGLRQATLAQLQQHLRDFLPAPLLAAE
Ga0116107_102891913300009548PeatlandMHTPYFPTFRCRLAALGRRTTHSVRQATLAQLEEHLRDFLPAPL
Ga0116133_114373713300009623PeatlandMHTPFFPAFRSRLAALGRRTAHTLRQATLTQLQQHLRDVLSPP
Ga0116122_107779833300009639PeatlandMHTPYFSILRSRLAALGRRTARVIRQATLAQLQEQLRDFLPAPLLSAED
Ga0116121_110405513300009644PeatlandMHTPLFPAFRPRLAALGRRTAHTLRQATLTQLQEHLRNLLPAPLALGYR*
Ga0116227_1141263413300009709Host-AssociatedMNTPCFPAFRSRLAALGRHTTQTVRQTTLAQLQQHLRDFL
Ga0116130_114923613300009762PeatlandMPTPYFPAIRSRLAALGRRTVHGLRQATLAQLQEHLRDF
Ga0134071_1054927823300010336Grasslands SoilMQTPYFPSFRSRLAALGRRAAQTIRQATLNQLQEHLRNLLPVPLLSATDEGP
Ga0126377_1185321823300010362Tropical Forest SoilMNTPNTPYFPALRSRLAALGRRTAQHLRQTTMAQLQYHLHDLLPAPLLCSEDQ
Ga0137457_128974713300011443SoilMNTPCFPHWRSRLAALGRRTTQTVRQTTLTQLQQHLRDFLPAP
Ga0137389_1177850723300012096Vadose Zone SoilMHTPYFPALRSRLAALGRRTAQTVRQTTVAQLQAHLRD
Ga0137357_109591533300012168SoilMNTSFFPPWRGRLAALGRRTTHALRQTTMAQLQQHLRDFLPAPLLST
Ga0137365_1010210033300012201Vadose Zone SoilMDTPYFCAFRSRLAALGRRTAQTIRQATLGQLQEHLAHLLPAPLLSATDEG
Ga0137362_1096610713300012205Vadose Zone SoilMHTPYFPALRSGLAALGRRTAHALRQATLGQLQEHLRHLLPAPLLSATD
Ga0137370_1059909813300012285Vadose Zone SoilMQTPYFPTFRSRLAALGRRTAGSLRQATLAQLQQHL
Ga0137367_1042828423300012353Vadose Zone SoilMHTPYFPALRSRLAALGRRTAHSLRQTTLAQLQEYLRD
Ga0137360_1155491023300012361Vadose Zone SoilMRDTPFFPAFRCRLAALGRRSFQPLRQNTLAQFQEQMRNLIPAHLLSQE
Ga0137358_1094464923300012582Vadose Zone SoilMHTPYFPSLHCRLAALGRRTAKTVRQATLAQLQHNLRQLLPAPLLSAEDEG
Ga0137398_1093799623300012683Vadose Zone SoilMQTLYFPSLRSRLAALGRRTAGSIRQGTLSQLQEHLR
Ga0137416_1183542013300012927Vadose Zone SoilMPTPYFPAFRSRLAPLGRRTVQTLRQTTLAQLQQHLRDFLPPPLLAAE
(restricted) Ga0172369_1041421423300013125FreshwaterMHTPFLPAFRSRLAALGRRAAATLRQATLGQLQDQLRDLLPA
Ga0181521_1042634213300014158BogMPTPFFPAFRSRLAALGRRTVHSLRQATLAQLQEHLRDFLPAPLLAAQDNGPNSRQ
Ga0181528_1017889643300014167BogMVVVTPFFPGLRSRLAALGRRTAHPLRQTTLVQLQ
Ga0181531_1094974723300014169BogMNTPVFPAFRSRLAALGRRTVQLRQATLGQLQEHLRDFLPAQL
Ga0181535_1007201133300014199BogMDTPFFPPWRSRLAALGRRTAHALRQTTLSQLQQHLRDVLPAPLLSATDQGPN
Ga0182019_1035987933300014498FenMHTPYFPAFRSRLAALGRRTAGTLRQATLEQLQQH
Ga0182021_1340301323300014502FenMHTPLFPAFRSRLAALGRRTARTLRQATLAQLQEHLRNL
Ga0180087_108781133300014872SoilMLTPYFPALRSRLAALGRRTTQTVRQATLAQLQEHLRDLL
Ga0137405_121196313300015053Vadose Zone SoilMHTPYLPAFRSRLAALGRRTVHSVRQATLAQLQQHLRDLLPDPLLSSEDEGCSHPKMK
Ga0182040_1171445813300016387SoilMSHTPYFPAFRSRLAAQGRRTAHSVRQATLGQLQAHFRQLLPAPLLSSEE
Ga0187854_1025194813300017938PeatlandMKRYIYRPMPTPYFPAIRSRLAALGRRTVHGLRQATLAQLQEHLRDFLPAP
Ga0187782_1137843613300017975Tropical PeatlandMHTPCFPALRSRLAALGRRTAQKLRDYTLDQLDDCL
Ga0181520_1096841423300017988BogMSTTPFFPAFRSRLASLGRGVSRTLPRLRQCTLSQIEA
Ga0187860_135248123300018014PeatlandMHTPYFSILRSRLAALGRRTARVIRQATLAQLQEQLRDFLPAPLL
Ga0187866_110977613300018015PeatlandMPTPFFPAFRSRLAALGRRTVHSLRQATLAQLQEHLRDFLPAPLLAAQDNGPN
Ga0187864_1035766523300018022PeatlandMPTPYFPCLRSRLAPLGRRTTQRLRQTTLAQLQQHLRDFLPAPLLSAEEDGPNSR
Ga0187881_1041761113300018024PeatlandMPTPFFPAFRSRLAALGRRTVHSLRQATPAQLQEHLR
Ga0187862_1041413233300018040PeatlandMHTPYFSILRSRLAALGRRTARVIRQATLAQLQEQLRDFLPAPLLSAEDQGPNSR
Ga0187887_1056138023300018043PeatlandMHTPLFPAFRPRLAALGRRTAHTLRQATLTQLQEHLRN
Ga0187890_1056838813300018044PeatlandMHTPCFPCWRSRLAALGRRTTQNLRQTTLAQLQQHLRDFLPAPLLS
Ga0184639_1051381013300018082Groundwater SedimentMLTPYFPALRSRLAALGRRAAQTVLQTTLAQLQEHLRDLLPAPLL
Ga0187894_1023116233300019360Microbial Mat On RocksMHTPFLPAFRSRLAALGRRTVHSLRQATLGQLQDRIRDLLPAPLLASQEAGPNSR
Ga0193697_111835813300020005SoilMHTAYFPALRSRLAAMGRRTAQTVRQATLRQLQEHLRDFLPAPLLSSEDEGLNS
Ga0163151_1054971513300020057Freshwater Microbial MatMNTPFFPRWRGRLAALGRRSAHPLRQTTLAQLQQHLRDFLPAPLLSSEDEG
Ga0163150_1047137913300020195Freshwater Microbial MatMNTPFFPRWRGRLAALGRRSAHPLRQTTLAQLQQHLRDFLPAPLLSSEDEGLN
Ga0179596_1065506323300021086Vadose Zone SoilMQTPYFPSFRSRLAALGRRTAHHLRQVTLGQLQDHLRDLLPVPLLS
Ga0210388_1160099523300021181SoilMRTPYFPALRSRLAAYGRRTATALRQSTLAQLQQQLRDFLPAPLL
Ga0210393_1139597313300021401SoilMTTPYFPVFRSRLAALGRRTARTLRQTTLAQLQQHLRDFLPPPLLSAED
Ga0210385_1129076213300021402SoilMNTPFFPEFRPRLAALGRRTTQTLRQTTLAQLQRHLSDFIPPPFLSPETE
Ga0210394_1098360123300021420SoilMTTPYFPAFRSRLAALGRRTARTLRQTTLAQLQQHLRDFLPPPLLPAEP
Ga0210394_1157397023300021420SoilMHTPYFPSLRSRLAPLGRRAAHTVRQGTLAQLQQHLRDFLPAPLLAAEQDG
Ga0222713_1076610413300021962Estuarine WaterMHTPFFPAFRARLAALGRRTTTHLRQATLQQLGAHLAGL
Ga0224537_101748823300022835SoilMKTPYFPCWRSRLAPLGRRTAPVRQTTLAQLQEHLRDFLPAPL
Ga0208193_108006913300025463PeatlandMHTPYFPALRSRLAAWGRRTGAAVRQTTLAQLQTHLHDLLPPPLLAAA
Ga0208188_113150123300025507PeatlandMKRYIYRPMPTPYFPAIRSRLAALGRRTVHGLRQATLAQLQEHLRDFLPAPLL
Ga0208716_107366823300025548Arctic Peat SoilMHTPCFPAFRARLAALGRRTTPNLRQTTLAQLQQHLRDFLPAPLLSSE
Ga0208507_113072633300025648FreshwaterMHTPWFPAFRSRLAALGGRTAQTLRQTTLVQLQEHLRDFLPPHLLS
Ga0208828_111742913300025807FreshwaterMTTPYFPALRPRLAALGRRTAQTVRQTTLAQLQEHL
Ga0208872_119473813300025838FreshwaterMHTPCFPAFRSRLAALGRHTAQTLRQTPLAQLQQQLRDF
Ga0209124_1012360533300025852Arctic Peat SoilMHTPCFPAFRARLAALGRRTTPNLRQTTLAQLQQHLRDFL
Ga0207674_1210543223300026116Corn RhizosphereMLTTPYFPTLRSRLAALGRRTAQALRQTTLNQLQE
Ga0207759_11923023300026823Tropical Forest SoilMQTPYFPNFRCRLAALGRRTAQRLRQATLAQVQQHLCDLL
Ga0207758_102692623300026895Tropical Forest SoilMQTPYFPNFRCRLAALGRRTAQRLRQATLAQVQQHLCDLLPTPLLSSEDEGL
Ga0209514_1017757133300027819GroundwaterMHTPFFPAFRSRLAALGRRTTHPLRQTTLAQLQEHLRDFLPAPLLAA
Ga0209611_1051057423300027860Host-AssociatedMHTPFFPAFRPRLAALGRRTAQTLRQTTLAQLQHHLRDFLPPPLLAAEDEGPNSR
Ga0209488_1099199923300027903Vadose Zone SoilMETPYFPPLRSRLAALGRRTAQTIRQATLGQLQEH
Ga0302144_1017251933300028560BogMVMVTPFFPGLRSRLAALGRRTAHTLRQTTLVQLQQHLRDLLPAPLLS
Ga0302156_1024410533300028748BogMVMVTPFFPGLRSRLAALGRRTAHTLRQTTLVQLQQHLRDLLPAP
Ga0302266_1033844113300028779BogMHTPFFPAFRSRLAALGRHTKPLRQATLAQLQEHLRDFLPAALLAS
Ga0307504_1041023413300028792SoilMLITPYFPSLRSRLAALGRRTAQALRQTTLNQLQEHLRDLLPVPLLSA
Ga0302197_1020020913300028873BogMKTPYFPCWRSRLAPLGRRTTQNLRQTTLAQFQQHLRDFLPAPL
Ga0311361_1000256013300029911BogMVLVTPFFPLFRARLAALGRRTAHTLRQTTLVQLQQHLRDLLPAPLLSAEDEGP
Ga0311361_1009987753300029911BogMVMVTPFFPGLRSRLAALGRRTAHTLRQTTLVQLQQHLRDLLPAPLLSAEDEGP
Ga0311361_1121977323300029911BogMITPCFPAFRPRLAALGRRTVHSLRQATLAQLQDQLR
Ga0311358_1025224433300029915BogMNTPFFPAFRPRLAALGRRTEPLRQATLAQLQEHFRACLPPG
Ga0311358_1041271233300029915BogMVLVTPFFPLFRARLAALGRRTAHTLRQTTLVQLQQHLRDLLPAPLL
Ga0311363_1077286033300029922FenMITPCFPAFRPRLAALGRRTVHSLRQATLAQLQDQLRDFLPAPLLSSEDE
Ga0311343_1106384513300029953BogMNTPYFPAFRPRLAALGRHTVATVRQTALAQLQQHLRDFLPAPLLSAEDEGL
Ga0302150_1039134813300029956BogMNTPFFPAFRPRLAALGRRTEPLRQATLAQLQEHFRACL
Ga0311336_1088019223300029990FenMHTPFFPAFRSRLAGLGRRTTQTFRQTTLAQLQQQLRDCLPLS
Ga0311336_1170095513300029990FenMNTPYFPPFRSRLAALGRRTVQPVRQTTLAQLQLHLRD
Ga0302276_1021859823300029992BogMVLVTPFFPLFRARLAALGRRTAHTLRQTTLVQLQQ
Ga0302186_1029882623300030004BogMKTPYFPCWRSRLAPLGRRTTQNLRQTTLAQFQQHLRDFLPAPLLSSEEDGPNSRD
Ga0311349_1169261913300030294FenMHTPYFPCFRSRLAALGRRTAKTIRQATLDQLQQHLRNLLP
Ga0311349_1184140023300030294FenMHTPFFPAFRSRLAGLGRRTTQTFRQTTLAQLQQQLRDCLPLSLLS
Ga0311360_1124994413300030339BogMKTPYFPCWRSRLAPLGRRTTQNLRQTTLAQFQQHLRDFLPAPLLSSEEDGP
Ga0302046_1109040113300030620SoilMNTPFFPALRSRLAALGRRTVSTLRQATLSQLQEQLRGL
Ga0311335_1123189523300030838FenMHTPYFPAFRSRLAALGRRTAGTLRQATLEQLQQHLR
Ga0302323_10079960733300031232FenMHTPYFPAFRSRLAALGRRTAGTLRQATLEQLQQHLRDLLPAPLL
Ga0302318_1004255743300031258BogMVLVTPFFPLFRARLAALGRRTAHTLRQTTLVQLQQHL
Ga0302326_1299437813300031525PalsaMKTPFFPAFRARLAALGRRTARSLRQATLAQFQEQLRDCLPIPLLSGE
Ga0247727_1031661033300031576BiofilmMNTPFFPAFRSRLAAVGRRTARTLRQATLGQLQEQIRDL
Ga0310686_11082778423300031708SoilMNTPYFPPFRSRLAPLGRRSVQPVRQATLAQLQQHLRDFL
Ga0310686_11830311633300031708SoilMETPYFPDWRSRLAALGRRCVPSVRQATLAQLQEHLRDFLPAPLLSAQDDGPNSRD
Ga0315288_1106271613300031772SedimentMHPPYFPALRSRLAALGRRTAQTVRQATLAQLQEHLRDFLPAPLLSAE
Ga0302319_10007277203300031788BogMVLVTPFFPLFRARLAALGRRTAHTLRQTTLVQLQQHLRDLLPAPL
Ga0307473_1123769423300031820Hardwood Forest SoilMLTTPYFPTLRSGLAALGRRTAQALRQTTLNQLQEHLRDLLPVPLLSAEDE
Ga0315290_1137978423300031834SedimentMHTPYFPAFRSRLAALGRRTAHLLRQATLAQIEEHLRDFLPAPLL
Ga0315297_1139029013300031873SedimentMLTPYFPALRSRLAALGRRTDQTVRQTTLTQLQQHLHDLLPAPLLAS
Ga0306919_1017015833300031879SoilMSTPFFPAFRCRLAALGRRTAHLLRQATLAQLQQQVGDYLPAGLLASEEEGPN
Ga0318520_1091977423300031897SoilMPTPFFPAFRCRLAALGRRTAHLLRQATLAQLQQQVGDYLPAGLLAS
Ga0302322_10147917033300031902FenMNTPYFPSFRSRLAALGRRTVQRVRQTTLAQLQQHLRDFLPPGLLSAEE
Ga0315278_1204131913300031997SedimentMHTPFFPAWRSRLAALGRRTARAVRPAILAQLQEH
Ga0318545_1035519823300032042SoilMSTPFFPAFRCRLAALGRRTAHLLRQATLAQLQQQVGDYLPAGLLASEEQG
Ga0306924_1144611413300032076SoilMSTPFFPAFRCRLAALGRRTAHLLRQATLAQLQQQVGDYLPAG
Ga0315277_1140251013300032118SedimentMHTPYFPAFRSRLAALGRRTAHLLRQATLAQLEEHLRDFLP
Ga0315292_1097366033300032143SedimentMHTPFFPAWRSRLAALGRRTARAVRETTLAQLQDYLRDFLP
Ga0315281_1228101723300032163SedimentMLTPYFPALRARLAARGRRTAQTVRQTTLAQLQEHLRDLLPAPLLA
Ga0315287_1211005923300032397SedimentMHTPYFPAFRSRLAALGRRTAHLLRQATLAQIEEHLRDF
Ga0315275_1035675313300032401SedimentMNTPCFPAFRCRLAALGHRTLHTVRQTTLTQLQQHLSDLLPAPLLCAEEDG
Ga0315275_1250704013300032401SedimentMHTPYFPALRSRLAALGRRTAQTVRQATLGQLQEHCRDLIPELLT
Ga0315273_1125297033300032516SedimentMNTPYFPAFRCRLAALGRHTRHAVRQTTLAQLQQHLSDLLPAPLLCAAEDGPNS
Ga0316622_10152482513300033416SoilMHTPYFPSFRPHLAALGRRTTQRLRLTTLAQLQEHLSDFLPPPL
Ga0316620_1178745613300033480SoilMHTPFFPAWRSRLAALGRRTARAVRQATLAQLQEHLRDFLPAPLLSAEDEGPNSRE
Ga0316629_1036121723300033483SoilRRRYIYRPMHTPFLPAFRSRLAALGRRTARSLRQATLGPLQDQIRDLLPAPLLSTEEDGP
Ga0316624_1207667923300033486SoilMHTHFFPAFRSRLAALGRRTAQAIRQATLSQLQEHLRNLLPAPLLSATEEG
Ga0316621_1052239413300033488SoilMPETPFFPAFRARLAALGRRTATTIRQATLAQLQEHLREFLPAQVLAAADEGPHS
Ga0334810_133382_483_5963300033890SoilMKTPYFPCWRSRLAPLGRRTAPVRQTTLAQLQKHLRDF
Ga0370502_0218475_479_6073300034156Untreated Peat SoilMHTPLFPAFRSRLAALGRRTAHTLRQATLAQLQEHLRNLLPAP
Ga0370506_083360_1_1113300034157Untreated Peat SoilMNTPFFPSFRPRLAALGRRTLQRLRQTTLAQLQEQIR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.