Basic Information | |
---|---|
Family ID | F055630 |
Family Type | Metagenome |
Number of Sequences | 138 |
Average Sequence Length | 39 residues |
Representative Sequence | MSATPDSTLANPEQLIADLQRQLAEREAELAECKAERDEALE |
Number of Associated Samples | 82 |
Number of Associated Scaffolds | 138 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 97.79 % |
% of genes near scaffold ends (potentially truncated) | 92.03 % |
% of genes from short scaffolds (< 2000 bps) | 91.30 % |
Associated GOLD sequencing projects | 72 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.51 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (62.319 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (49.275 % of family members) |
Environment Ontology (ENVO) | Unclassified (79.710 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.275 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.86% β-sheet: 0.00% Coil/Unstructured: 57.14% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 138 Family Scaffolds |
---|---|---|
PF13751 | DDE_Tnp_1_6 | 2.17 |
PF00072 | Response_reg | 1.45 |
PF00891 | Methyltransf_2 | 1.45 |
PF04986 | Y2_Tnp | 1.45 |
PF03692 | CxxCxxCC | 1.45 |
PF00239 | Resolvase | 1.45 |
PF00999 | Na_H_Exchanger | 1.45 |
PF02518 | HATPase_c | 1.45 |
PF01548 | DEDD_Tnp_IS110 | 1.45 |
PF07040 | DUF1326 | 1.45 |
PF00536 | SAM_1 | 1.45 |
PF13561 | adh_short_C2 | 0.72 |
PF04392 | ABC_sub_bind | 0.72 |
PF08028 | Acyl-CoA_dh_2 | 0.72 |
PF09391 | DUF2000 | 0.72 |
PF02538 | Hydantoinase_B | 0.72 |
PF00903 | Glyoxalase | 0.72 |
PF13602 | ADH_zinc_N_2 | 0.72 |
PF08388 | GIIM | 0.72 |
PF00378 | ECH_1 | 0.72 |
PF00589 | Phage_integrase | 0.72 |
PF00180 | Iso_dh | 0.72 |
PF08031 | BBE | 0.72 |
PF01590 | GAF | 0.72 |
PF07589 | PEP-CTERM | 0.72 |
PF02796 | HTH_7 | 0.72 |
PF04828 | GFA | 0.72 |
PF06559 | DCD | 0.72 |
PF03928 | HbpS-like | 0.72 |
PF13193 | AMP-binding_C | 0.72 |
PF13185 | GAF_2 | 0.72 |
COG ID | Name | Functional Category | % Frequency in 138 Family Scaffolds |
---|---|---|---|
COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 1.45 |
COG0146 | N-methylhydantoinase B/oxoprolinase/acetone carboxylase, alpha subunit | Amino acid transport and metabolism [E] | 1.45 |
COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 1.45 |
COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 1.45 |
COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 1.45 |
COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 1.45 |
COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 1.45 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.45 |
COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 1.45 |
COG5588 | Uncharacterized conserved protein, DUF1326 domain | Function unknown [S] | 1.45 |
COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.72 |
COG0717 | dCTP deaminase | Nucleotide transport and metabolism [F] | 0.72 |
COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.72 |
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.72 |
COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.72 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 62.32 % |
All Organisms | root | All Organisms | 37.68 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300005177|Ga0066690_10536298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 784 | Open in IMG/M |
3300005764|Ga0066903_104182892 | Not Available | 772 | Open in IMG/M |
3300005764|Ga0066903_107415014 | Not Available | 566 | Open in IMG/M |
3300005937|Ga0081455_10944383 | Not Available | 535 | Open in IMG/M |
3300006755|Ga0079222_11481102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 634 | Open in IMG/M |
3300009162|Ga0075423_10227667 | Not Available | 1954 | Open in IMG/M |
3300010048|Ga0126373_10033119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4487 | Open in IMG/M |
3300010361|Ga0126378_10869591 | Not Available | 1009 | Open in IMG/M |
3300010361|Ga0126378_12568432 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300010361|Ga0126378_13175655 | Not Available | 523 | Open in IMG/M |
3300010373|Ga0134128_11484752 | Not Available | 746 | Open in IMG/M |
3300010376|Ga0126381_100793671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1359 | Open in IMG/M |
3300010376|Ga0126381_101419546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1003 | Open in IMG/M |
3300012971|Ga0126369_11257911 | Not Available | 830 | Open in IMG/M |
3300013306|Ga0163162_12004927 | Not Available | 663 | Open in IMG/M |
3300016270|Ga0182036_10172934 | Not Available | 1559 | Open in IMG/M |
3300016270|Ga0182036_11936833 | Not Available | 500 | Open in IMG/M |
3300016294|Ga0182041_10447233 | Not Available | 1110 | Open in IMG/M |
3300016294|Ga0182041_10796473 | Not Available | 844 | Open in IMG/M |
3300016319|Ga0182033_10340306 | Not Available | 1251 | Open in IMG/M |
3300016341|Ga0182035_10204350 | Not Available | 1565 | Open in IMG/M |
3300016341|Ga0182035_11567119 | Not Available | 594 | Open in IMG/M |
3300016341|Ga0182035_12093749 | Not Available | 514 | Open in IMG/M |
3300016341|Ga0182035_12171426 | Not Available | 503 | Open in IMG/M |
3300016357|Ga0182032_10383351 | Not Available | 1133 | Open in IMG/M |
3300016357|Ga0182032_10567957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 940 | Open in IMG/M |
3300016357|Ga0182032_10950765 | Not Available | 732 | Open in IMG/M |
3300016371|Ga0182034_10151976 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1740 | Open in IMG/M |
3300016387|Ga0182040_11120661 | Not Available | 660 | Open in IMG/M |
3300016404|Ga0182037_11326650 | Not Available | 635 | Open in IMG/M |
3300016422|Ga0182039_10216242 | All Organisms → cellular organisms → Bacteria | 1539 | Open in IMG/M |
3300016422|Ga0182039_11937513 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300016445|Ga0182038_11524952 | Not Available | 600 | Open in IMG/M |
3300016445|Ga0182038_12199339 | Not Available | 500 | Open in IMG/M |
3300020583|Ga0210401_10849670 | Not Available | 772 | Open in IMG/M |
3300021178|Ga0210408_11139938 | Not Available | 598 | Open in IMG/M |
3300021178|Ga0210408_11368035 | Not Available | 534 | Open in IMG/M |
3300021560|Ga0126371_10561631 | Not Available | 1290 | Open in IMG/M |
3300021560|Ga0126371_11368659 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 839 | Open in IMG/M |
3300021560|Ga0126371_12613675 | Not Available | 612 | Open in IMG/M |
3300021560|Ga0126371_12645614 | Not Available | 608 | Open in IMG/M |
3300021560|Ga0126371_12847464 | Not Available | 586 | Open in IMG/M |
3300021560|Ga0126371_12972127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 574 | Open in IMG/M |
3300021560|Ga0126371_13595412 | Not Available | 523 | Open in IMG/M |
3300025915|Ga0207693_10452775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1003 | Open in IMG/M |
3300027874|Ga0209465_10546635 | Not Available | 576 | Open in IMG/M |
3300031543|Ga0318516_10303455 | Not Available | 923 | Open in IMG/M |
3300031543|Ga0318516_10853073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga tunisiensis | 513 | Open in IMG/M |
3300031544|Ga0318534_10243547 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
3300031545|Ga0318541_10283353 | Not Available | 923 | Open in IMG/M |
3300031546|Ga0318538_10381185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 762 | Open in IMG/M |
3300031546|Ga0318538_10514934 | Not Available | 649 | Open in IMG/M |
3300031546|Ga0318538_10559416 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 620 | Open in IMG/M |
3300031572|Ga0318515_10398470 | Not Available | 737 | Open in IMG/M |
3300031640|Ga0318555_10399486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 745 | Open in IMG/M |
3300031640|Ga0318555_10519324 | Not Available | 645 | Open in IMG/M |
3300031679|Ga0318561_10230260 | Not Available | 1008 | Open in IMG/M |
3300031679|Ga0318561_10243369 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
3300031679|Ga0318561_10375267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 780 | Open in IMG/M |
3300031679|Ga0318561_10602682 | Not Available | 605 | Open in IMG/M |
3300031713|Ga0318496_10106452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1509 | Open in IMG/M |
3300031715|Ga0307476_10983337 | Not Available | 622 | Open in IMG/M |
3300031719|Ga0306917_10147986 | Not Available | 1739 | Open in IMG/M |
3300031719|Ga0306917_10355344 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1139 | Open in IMG/M |
3300031724|Ga0318500_10633950 | Not Available | 543 | Open in IMG/M |
3300031736|Ga0318501_10175053 | Not Available | 1114 | Open in IMG/M |
3300031744|Ga0306918_10198101 | Not Available | 1512 | Open in IMG/M |
3300031744|Ga0306918_10778545 | Not Available | 747 | Open in IMG/M |
3300031744|Ga0306918_10958834 | Not Available | 665 | Open in IMG/M |
3300031744|Ga0306918_11429619 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300031748|Ga0318492_10293389 | Not Available | 845 | Open in IMG/M |
3300031748|Ga0318492_10513617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 636 | Open in IMG/M |
3300031751|Ga0318494_10563802 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
3300031765|Ga0318554_10349674 | Not Available | 840 | Open in IMG/M |
3300031765|Ga0318554_10399479 | Not Available | 780 | Open in IMG/M |
3300031765|Ga0318554_10737965 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 552 | Open in IMG/M |
3300031768|Ga0318509_10462681 | Not Available | 709 | Open in IMG/M |
3300031771|Ga0318546_10091467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1981 | Open in IMG/M |
3300031771|Ga0318546_10194857 | Not Available | 1382 | Open in IMG/M |
3300031771|Ga0318546_11115804 | Not Available | 554 | Open in IMG/M |
3300031777|Ga0318543_10124556 | All Organisms → cellular organisms → Bacteria | 1121 | Open in IMG/M |
3300031781|Ga0318547_10932045 | Not Available | 542 | Open in IMG/M |
3300031781|Ga0318547_11019690 | Not Available | 517 | Open in IMG/M |
3300031782|Ga0318552_10655178 | Not Available | 535 | Open in IMG/M |
3300031796|Ga0318576_10255627 | Not Available | 826 | Open in IMG/M |
3300031797|Ga0318550_10219117 | Not Available | 922 | Open in IMG/M |
3300031797|Ga0318550_10463393 | Not Available | 612 | Open in IMG/M |
3300031798|Ga0318523_10330994 | Not Available | 759 | Open in IMG/M |
3300031805|Ga0318497_10138551 | All Organisms → cellular organisms → Bacteria | 1326 | Open in IMG/M |
3300031819|Ga0318568_10821467 | Not Available | 576 | Open in IMG/M |
3300031821|Ga0318567_10555408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 652 | Open in IMG/M |
3300031833|Ga0310917_10329919 | Not Available | 1034 | Open in IMG/M |
3300031879|Ga0306919_10504597 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
3300031890|Ga0306925_10037797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 4973 | Open in IMG/M |
3300031890|Ga0306925_10054299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4182 | Open in IMG/M |
3300031890|Ga0306925_10896427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocella → Methylocella tundrae | 912 | Open in IMG/M |
3300031896|Ga0318551_10096962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Elioraeaceae → Elioraea → Elioraea rosea | 1565 | Open in IMG/M |
3300031896|Ga0318551_10721379 | Not Available | 578 | Open in IMG/M |
3300031897|Ga0318520_10814561 | Not Available | 586 | Open in IMG/M |
3300031910|Ga0306923_10026421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 6211 | Open in IMG/M |
3300031910|Ga0306923_10032305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5661 | Open in IMG/M |
3300031910|Ga0306923_11150072 | Not Available | 833 | Open in IMG/M |
3300031912|Ga0306921_10021540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 7080 | Open in IMG/M |
3300031912|Ga0306921_10042684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 5124 | Open in IMG/M |
3300031942|Ga0310916_10104376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 2281 | Open in IMG/M |
3300031942|Ga0310916_10475990 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1064 | Open in IMG/M |
3300031942|Ga0310916_11243294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 614 | Open in IMG/M |
3300031945|Ga0310913_10720458 | Not Available | 705 | Open in IMG/M |
3300031945|Ga0310913_10798044 | Not Available | 666 | Open in IMG/M |
3300031946|Ga0310910_10530234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. JC676 | 934 | Open in IMG/M |
3300031947|Ga0310909_10888138 | Not Available | 732 | Open in IMG/M |
3300031954|Ga0306926_10657684 | Not Available | 1274 | Open in IMG/M |
3300031981|Ga0318531_10521338 | Not Available | 538 | Open in IMG/M |
3300032001|Ga0306922_10189485 | All Organisms → cellular organisms → Bacteria | 2206 | Open in IMG/M |
3300032001|Ga0306922_10495395 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1303 | Open in IMG/M |
3300032035|Ga0310911_10924421 | Not Available | 503 | Open in IMG/M |
3300032052|Ga0318506_10128658 | Not Available | 1099 | Open in IMG/M |
3300032054|Ga0318570_10482799 | Not Available | 565 | Open in IMG/M |
3300032055|Ga0318575_10361947 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 735 | Open in IMG/M |
3300032059|Ga0318533_11238183 | Not Available | 546 | Open in IMG/M |
3300032063|Ga0318504_10040063 | Not Available | 1918 | Open in IMG/M |
3300032063|Ga0318504_10376925 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
3300032065|Ga0318513_10411373 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 660 | Open in IMG/M |
3300032066|Ga0318514_10728235 | Not Available | 527 | Open in IMG/M |
3300032076|Ga0306924_10303268 | All Organisms → cellular organisms → Bacteria | 1833 | Open in IMG/M |
3300032076|Ga0306924_11087543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 872 | Open in IMG/M |
3300032076|Ga0306924_11311144 | Not Available | 777 | Open in IMG/M |
3300032076|Ga0306924_11827954 | Not Available | 632 | Open in IMG/M |
3300032089|Ga0318525_10235957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 940 | Open in IMG/M |
3300032090|Ga0318518_10437141 | Not Available | 670 | Open in IMG/M |
3300032091|Ga0318577_10209895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium jicamae | 932 | Open in IMG/M |
3300032261|Ga0306920_100271165 | Not Available | 2530 | Open in IMG/M |
3300032261|Ga0306920_100661160 | Not Available | 1542 | Open in IMG/M |
3300032261|Ga0306920_103629404 | Not Available | 568 | Open in IMG/M |
3300033289|Ga0310914_11813681 | Not Available | 514 | Open in IMG/M |
3300033290|Ga0318519_10809742 | Not Available | 576 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 49.28% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 32.61% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.14% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.17% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.72% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.72% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.72% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.72% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.72% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.72% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.72% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.72% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0066690_105362981 | 3300005177 | Soil | LANPEQLIADLQRQLAECSAERDEALQRETATRCNALDLSGSE* |
Ga0066903_1041828922 | 3300005764 | Tropical Forest Soil | MRATPDSTFTSPERLIAELQRQLAEREVELAECKAERHEAL* |
Ga0066903_1074150141 | 3300005764 | Tropical Forest Soil | MSATPDSTLANPEQLLADLQRQLAEREAELAECKAERDEA |
Ga0081455_109443832 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MSATPDSTLADPQELIADLQRQLAEREAELAEALAER |
Ga0079222_114811022 | 3300006755 | Agricultural Soil | MNAPPENTAADPEQLIADLRRQLAEREAERDEGLQ |
Ga0075423_102276673 | 3300009162 | Populus Rhizosphere | MSATPDNTFADPEQRIADLEHQLAEREAELAVSNAERDEALQRQT |
Ga0126373_100331195 | 3300010048 | Tropical Forest Soil | MSAMPERTLADTERLIADLQRQLDECRAELAARNSE* |
Ga0126378_108695911 | 3300010361 | Tropical Forest Soil | MSAKPDSTFINPEQRIADLERQLAEREAELAESNAER |
Ga0126378_125684322 | 3300010361 | Tropical Forest Soil | MSATPDSTLANPEQLIADLQRQLAEREAELAERKAER |
Ga0126378_131756551 | 3300010361 | Tropical Forest Soil | MRATPDSTFTSPERLIAELQRQLAEREVELAECKAERQEAL* |
Ga0134128_114847523 | 3300010373 | Terrestrial Soil | MSATPDSTLVDPEQRIADLKRQLAEREAELAECRAERD |
Ga0126381_1007936711 | 3300010376 | Tropical Forest Soil | MSATPDSTFTNPEQRIADLERQLAESQAERDAYKAERDEALER |
Ga0126381_1014195462 | 3300010376 | Tropical Forest Soil | MSAIPDSTLAASEQLIADLQRQLAEFRAERDEARTARDRDR* |
Ga0126369_112579112 | 3300012971 | Tropical Forest Soil | MRAMPDSTFTSPERLIAELQRQLAEREVELAECKAERHEAL* |
Ga0163162_120049272 | 3300013306 | Switchgrass Rhizosphere | MSATPDSTVANPEQQIAELERRLAGREAELAACKAERDEALEQ |
Ga0182036_101729344 | 3300016270 | Soil | MSATPDSTLANPEQRIADLERQLAEREAELAECKAERDQGLQRE |
Ga0182036_119368331 | 3300016270 | Soil | MSATPESTLVNPEQLIADLQRQLAAREAELAECKA |
Ga0182041_104472331 | 3300016294 | Soil | MSATPDSTLANPEQRIADLERQLAEREAELAECQAE |
Ga0182041_107964731 | 3300016294 | Soil | MGATPDSMLGKPEQLIADLQRQLAEREAELAECKAER |
Ga0182033_103403061 | 3300016319 | Soil | MSATPESTVANPEQLIADLQRQLAEREAELAECKAE |
Ga0182035_102043501 | 3300016341 | Soil | MTATPDSTLATPEQLIADLQRQLAEREAELAEGKAERDEALQWE |
Ga0182035_115671191 | 3300016341 | Soil | MSTTPAGTLADSEQLIADLQRQLAEREAELADRRAECNEALQREA |
Ga0182035_120937492 | 3300016341 | Soil | MSAAHDSTLANPEQFIADLQRQLAEREAELAEREAELAECKAERDEAL |
Ga0182035_121714261 | 3300016341 | Soil | MSTTPASTLADSEQLIADLQRQLAEREAELADRRAECNEAL |
Ga0182032_103833511 | 3300016357 | Soil | MSATPDSTLAYPDQPIADLERQLAEREAELAECKAERDEA |
Ga0182032_105679572 | 3300016357 | Soil | MSATPDSTLAASERRIADLERQLAEREAELAECKAERDEA |
Ga0182032_109507652 | 3300016357 | Soil | MSAKPDSSLANPEQLIADLQRQLAEREAELAECKAERDEALQR |
Ga0182034_101519763 | 3300016371 | Soil | MSATPDSRLADSEQLIADLQRQLAEREAELAECKA |
Ga0182040_111206611 | 3300016387 | Soil | MSATPYSTLANSEQRIADLERQLAEREAELAECKAERDEALEQQ |
Ga0182037_113266502 | 3300016404 | Soil | MRATPDSTFTSPERLIAELQRQLAEREVELAECKAERHEGL |
Ga0182039_102162424 | 3300016422 | Soil | MSATPDSTFTSPEQRIADLERQLAEREAELAECKAE |
Ga0182039_119375132 | 3300016422 | Soil | MSTTPAGTLADSEQLIADLQRQLAEREAELADRRAECNEALQREAA |
Ga0182038_115249522 | 3300016445 | Soil | MRTTPDSTLANSDRVIAGLQRQLAERAAELAECQAE |
Ga0182038_121993391 | 3300016445 | Soil | MSAKPESQLANPEQRIADLERQLAEREAELAECKADRDAGLE |
Ga0210401_108496702 | 3300020583 | Soil | MSATPDSTLANPEQLIADLQRQLAEREAELTECKAE |
Ga0210408_111399381 | 3300021178 | Soil | MSATPDSTLADSEQLIANLHRQLAEREAELAECRAGRDEA |
Ga0210408_113680351 | 3300021178 | Soil | MSATPDSTLANPEQLIADLQRQLAEREAELAECKAE |
Ga0126371_105616313 | 3300021560 | Tropical Forest Soil | MRATPDSTFTSPERLIAELQRQLAEREVELAECKAERHEAL |
Ga0126371_113686593 | 3300021560 | Tropical Forest Soil | MSATPDSTLANPEQRIADLERQLAERTAERDEALHR |
Ga0126371_126136751 | 3300021560 | Tropical Forest Soil | MSATHDSTFANPEQRIADLQRQLGEYKAERDEAHRQLADTAA |
Ga0126371_126456143 | 3300021560 | Tropical Forest Soil | MSPTPDSTFTNPEQRIADLERQLAERQAELDKAQRK |
Ga0126371_128474641 | 3300021560 | Tropical Forest Soil | MSTTPDNTLAEPEQRIADLERQLAEREAELAECKAE |
Ga0126371_129721271 | 3300021560 | Tropical Forest Soil | MSATPDSKLADPQQRIADLERQLAEREAELAERTAEHDEALEQ |
Ga0126371_135954122 | 3300021560 | Tropical Forest Soil | MSATPESTLTNPEQRIADLERQLAEREAELAESNAERDEALEQ |
Ga0207693_104527752 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MSTIPASTLADSERLIADLQRQLAEREAELAECKAERDEA |
Ga0209465_105466352 | 3300027874 | Tropical Forest Soil | MSATPDSTLANLEQRIADLERQLAERKAERDEAFAERDKAKRSVAERIAE |
Ga0318516_103034551 | 3300031543 | Soil | MSATRDSTLADSEQLIADLQRQLAKCRAERDEAPTFPPPRWGR |
Ga0318516_108530731 | 3300031543 | Soil | MSATPDSTLANPEQRIADLERQLAEREADLAECKA |
Ga0318534_102435472 | 3300031544 | Soil | MRTTPGSTLANPEQRIADLERQLAEREAELAEARK |
Ga0318541_102833531 | 3300031545 | Soil | MSATPDSTLVNPEQLIADLQRQLAEREAELAEAQRNL |
Ga0318538_103811851 | 3300031546 | Soil | QMRATPDSTFTSPERLIADLQRQLAEREVELAECKAERHEAL |
Ga0318538_105149342 | 3300031546 | Soil | MSATPDSTLATPEQLIADLQRQLAEREAELAEGKAERDEALQR |
Ga0318538_105594162 | 3300031546 | Soil | MSATPDSTLANPEQRIADLQRQLVERETELAECKA |
Ga0318515_103984702 | 3300031572 | Soil | MSATPDSTLANPEQRIADLERQLAEREAEFAEALQR |
Ga0318555_103994861 | 3300031640 | Soil | MSATPDSTLANPEQRIADLERQLAEREAELAECKAE |
Ga0318555_105193242 | 3300031640 | Soil | MSATHDSTLANPEQLIADLQRQLAECKAERDKALQRE |
Ga0318561_102302601 | 3300031679 | Soil | MSATPDSTLANPEQRIADLQRQLVERTAERDEALKQQTA |
Ga0318561_102433691 | 3300031679 | Soil | MSATPDSTLANPEQLIADLRRQLVECKAELAECKAERDEALQ |
Ga0318561_103752673 | 3300031679 | Soil | MSATPDSTLADSEQLIADLQRQLAEREAELAECKAER |
Ga0318561_106026821 | 3300031679 | Soil | MSATPDSTLANPEQLIADLQRQLAECQAERDEWKAERDEA |
Ga0318496_101064524 | 3300031713 | Soil | MSATPDSTLANPEQLIADLQRQLAEHEAELAECKAERD |
Ga0307476_109833372 | 3300031715 | Hardwood Forest Soil | MSATPDSTLANPEQLIADLQRQLAEREAELAVCKAERDEALQRET |
Ga0306917_101479861 | 3300031719 | Soil | MSTTPDSTLANPDQRIADLERQLGEREAELAECKAER |
Ga0306917_103553442 | 3300031719 | Soil | MSATPESTFTSPEQLITDLQRQLAEREVELAECRAERDEALEQQTAAAEV |
Ga0318500_106339501 | 3300031724 | Soil | MSATPNSTLANSEQLIVDLQRQLAECRAELAECKA |
Ga0318501_101750532 | 3300031736 | Soil | MSATPDSTLANSEQLIADLQRQLAECQAERDECQAERDECKAE |
Ga0306918_101981014 | 3300031744 | Soil | MSATPDSTLATPEQLIADLQRQLAEREAELAEVKAERDEA |
Ga0306918_107785451 | 3300031744 | Soil | MSATPDSTLANPEQLIADLQRQLAECQAERDEWKA |
Ga0306918_109588341 | 3300031744 | Soil | MSATPDSTLANPDQRIADLERQLAERDVELAEREAE |
Ga0306918_114296192 | 3300031744 | Soil | MSTTPASTVADSEQLIADLQRQLAEREAELAEREAELAEAR |
Ga0318492_102933891 | 3300031748 | Soil | MSATPDSALANPEQLIADLQRQLAEREAELAEGKAERDEAL |
Ga0318492_105136172 | 3300031748 | Soil | MSATPDSTLANPDQRIADLERQLAEREAELAEAQRNLN |
Ga0318494_105638021 | 3300031751 | Soil | MSATTEKTLANPEQRIADLERQLAEREVELAECKAERDEALKQQTA |
Ga0318554_103496741 | 3300031765 | Soil | MSATPDSTLANPEQLIADLRRQLVECKAELAECKAERDE |
Ga0318554_103994792 | 3300031765 | Soil | MSATRDSTLADSEQLIADLQRQLAKCRAERDEAPT |
Ga0318554_107379652 | 3300031765 | Soil | MSATPNITLANPEQRIADLEHQLAERDAELAEREAE |
Ga0318509_104626811 | 3300031768 | Soil | MSATPDSTLAYPDQPIADLERQLAEREAELAECKA |
Ga0318546_100914672 | 3300031771 | Soil | MSATPDSTLANSEQRIADLELQLAEREAELAECKAERDEALEQQTA |
Ga0318546_101948573 | 3300031771 | Soil | MSATPEKTLANPEQRIADLERQLAEREVELAECKAERDEAL |
Ga0318546_111158042 | 3300031771 | Soil | MSATPDSTLADSERRIADLERQLAEREAELAECKAERDASKV |
Ga0318543_101245563 | 3300031777 | Soil | MSTTPASTLADSEQLIADLQRQLAEREAELADRQAECN |
Ga0318543_103557991 | 3300031777 | Soil | MSATPDSTLTNPDQLIADLRRQVAEREAELAEAQRNLN |
Ga0318547_109320451 | 3300031781 | Soil | MRATPDSTFTSPERLIADLQRQLAEREVELAECKAE |
Ga0318547_110196902 | 3300031781 | Soil | MSATPDSTLANPEHRIADLERQLVERAAELAECRAERD |
Ga0318552_106551782 | 3300031782 | Soil | MSATPDSTLANPEHRIADLERQLAERAAELAECRAERDE |
Ga0318576_102556272 | 3300031796 | Soil | MSATPDSTLANPEQRIGDLERQLAEREAELAECKAERDEAREQQ |
Ga0318550_102191171 | 3300031797 | Soil | MSATPDSTLANPEQLIADLQRQFAEREADLAECKAERDEALQR |
Ga0318550_104633931 | 3300031797 | Soil | MSATPDSTLADSEQLIADLQRQLAEREAELAECKAE |
Ga0318523_103309941 | 3300031798 | Soil | MSATPDSTLATPEQLIADLQRQLAEREAELAEVKAERDEALQRE |
Ga0318497_101385511 | 3300031805 | Soil | MSATQDSTLANPEQFIADLQRQLAECRAELAECKAERDEALAQ |
Ga0318568_108214671 | 3300031819 | Soil | MSATPDSTFTNPEQRIADLERQLAEREAELAESNAERDEALEQQ |
Ga0318567_105554082 | 3300031821 | Soil | MSATPDSTLAHPEQLIADLQRQLAEREVELADCRAE |
Ga0310917_103299191 | 3300031833 | Soil | MSATPDSTFTSAEQLIADLQRQLVECKAERDEALEQ |
Ga0306919_105045971 | 3300031879 | Soil | MSTTPASTLADSEQLIADLQRQLAEREAELADHRAECN |
Ga0306925_100377975 | 3300031890 | Soil | MSATPDSTLANSEQRIADLERQLAEREAELAECKAERDEALEQQT |
Ga0306925_100542994 | 3300031890 | Soil | MSATPDSTLANPEQLIADLQRQLAVCRAERDECKA |
Ga0306925_108964271 | 3300031890 | Soil | MSATPDITFTDPKQRIADLERQLAEREAELAERTAERDEALEQQ |
Ga0318551_100969623 | 3300031896 | Soil | MSATPDSTLAHPEQLIADLQRQLAEREVELADCRAERDEAQR |
Ga0318551_107213791 | 3300031896 | Soil | MSATPDSTLANPDQLIADLQRQLAEREAELAECKAERDEALEQ |
Ga0318520_108145611 | 3300031897 | Soil | MSATPDNTLADSERRIADLERQLAEREAELAECKAERDEALEQQT |
Ga0306923_100264217 | 3300031910 | Soil | MSTTPASTVADSEQLIADLQRQLAEREAELAEYKAER |
Ga0306923_100323057 | 3300031910 | Soil | MSATPDSTLANPEQRIADLERQLAEREAELAECKAERDEAR |
Ga0306923_111500721 | 3300031910 | Soil | MSATPDSTLANPEQRIADLERQLAEREAELAEALQR |
Ga0306921_100215402 | 3300031912 | Soil | MRATPDSTFTSPERLIADLQRQLAEREVELAECKAERHEAL |
Ga0306921_100426845 | 3300031912 | Soil | MSATPDSTLANSEQRIADLERQLAEREAELAECKAERDEALE |
Ga0310916_101043761 | 3300031942 | Soil | MSATPDSTFTNPEQRIADLERQLAEREAELTQAREQ |
Ga0310916_104759901 | 3300031942 | Soil | GPQMRATPDSTFTSPERLIADLQRQLAEREVELAECKAERHEAL |
Ga0310916_112432942 | 3300031942 | Soil | MSATPDSTFANPELRIADLERQLAEREAELAECRA |
Ga0310913_107204581 | 3300031945 | Soil | MSAAHDSTLANPEQFIADLQRQLAEREAELAEREAE |
Ga0310913_107980441 | 3300031945 | Soil | MSATHDSTLANPEQLIADLQRQLAECKAEIDEALEQQTAT |
Ga0310910_105302341 | 3300031946 | Soil | MSATSDSTLANPEQRIADLERQLAEREAELAERTAE |
Ga0310909_108881381 | 3300031947 | Soil | MSATPDSMLADPDQRIADLERQLAEREAELAERTAERDEA |
Ga0306926_103657973 | 3300031954 | Soil | MSATPESMLANPEHLIADVQRQLAEREAELAEAQRNLN |
Ga0306926_106576843 | 3300031954 | Soil | MSATPDSTLANPDQRIADLERQLAEREAELAECKPERDEGLQRETA |
Ga0318531_105213381 | 3300031981 | Soil | MSATPDNTLADSERRIADLERQLAEREAELAECKA |
Ga0306922_101894851 | 3300032001 | Soil | MSTTPASTLADSEQLIADLQRQLAEREAELADRRAECNEALQREAATA |
Ga0306922_104953951 | 3300032001 | Soil | MSATPDSTLANSEQRIADLERQLAEREAELAECKAERDE |
Ga0310911_109244211 | 3300032035 | Soil | LSATPDSTLANPEQRIADLERQLAEREAELAEAQRSLNET |
Ga0318506_101286582 | 3300032052 | Soil | MSATPDSTLANPERRIADLERQLAEREAELAECKAERDKALQRE |
Ga0318570_104827991 | 3300032054 | Soil | MSATPDTTLADSERRIADLERHLAEREAELADCKAERDEALE |
Ga0318575_103619471 | 3300032055 | Soil | MSATPESTFTSPEQRIADLERQLAEREVELAEAQRN |
Ga0318533_112381831 | 3300032059 | Soil | MSATPDSTLANPEQLIADLQRQLAEREAELAECKA |
Ga0318504_100400635 | 3300032063 | Soil | MSATPDSTLANPEQRIADLQRQLVERTAERDEALKQ |
Ga0318504_103769252 | 3300032063 | Soil | MSATQDSTLANPEQFIADLQRQLAECRAELAECKAE |
Ga0318513_104113731 | 3300032065 | Soil | MSATPDSTLANPEQRIADLQRQLVEREAELAECKA |
Ga0318514_107282351 | 3300032066 | Soil | MSATPYSTLANSEQRIADLERQLAEREAELAECKAERDEALE |
Ga0306924_103032681 | 3300032076 | Soil | MSATPDSRLADSEQLIADLQRQLAEREAELAECKAERDEA |
Ga0306924_110875433 | 3300032076 | Soil | MSATPDSTLANPDQRIADLERQLAERETELAECKAE |
Ga0306924_113111441 | 3300032076 | Soil | MSATPDSTLANPEQLIADLQRQLAEREAELAECKAERDEALE |
Ga0306924_118279541 | 3300032076 | Soil | MSTTPDSTLVDPERRIADLERQLAKREAELAECKAERNEALDQQTA |
Ga0318525_102359572 | 3300032089 | Soil | MSATPDSTLANPEQRIADLERQLAEREAELAEALQRE |
Ga0318518_104371411 | 3300032090 | Soil | MSATPDSTLANSEQRIADLERQLAEREAELAECKAERDEALEQQ |
Ga0318577_102098952 | 3300032091 | Soil | MNATPDSTLANPEQRIADLERQLAEREAELAEALRR |
Ga0306920_1002711655 | 3300032261 | Soil | MSATPNSTLANSEQLIVDLQRQLAECRAELAECKAERDEALA |
Ga0306920_1006611604 | 3300032261 | Soil | MSTTPASTLADSEQLIADLQRQLAEREAELADRRAECNEALQREAAT |
Ga0306920_1036294041 | 3300032261 | Soil | MNATPDSTLASPEQRIADLERQLAEREAELAKRDAELT |
Ga0310914_118136811 | 3300033289 | Soil | MRTTPDSTLANSDRVIAGLQRQLAERAAELAECQAERDQGLQ |
Ga0318519_108097421 | 3300033290 | Soil | MAATPDSTLANPEQLIADLQRQLAERKAERDQYKAERD |
⦗Top⦘ |