Basic Information | |
---|---|
Family ID | F055740 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 138 |
Average Sequence Length | 43 residues |
Representative Sequence | MIKINLLESSKGKGKRGGGGGPSMPSMEMGDMGSPKLKVL |
Number of Associated Samples | 124 |
Number of Associated Scaffolds | 138 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 100.00 % |
% of genes near scaffold ends (potentially truncated) | 99.28 % |
% of genes from short scaffolds (< 2000 bps) | 93.48 % |
Associated GOLD sequencing projects | 120 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.15 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (100.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (15.217 % of family members) |
Environment Ontology (ENVO) | Unclassified (24.638 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.899 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.15 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 138 Family Scaffolds |
---|---|---|
PF11104 | PilM_2 | 92.03 |
PF12728 | HTH_17 | 5.80 |
PF13181 | TPR_8 | 0.72 |
PF07681 | DoxX | 0.72 |
PF00347 | Ribosomal_L6 | 0.72 |
COG ID | Name | Functional Category | % Frequency in 138 Family Scaffolds |
---|---|---|---|
COG0097 | Ribosomal protein L6P/L9E | Translation, ribosomal structure and biogenesis [J] | 0.72 |
COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.72 |
COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.72 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 100.00 % |
Unclassified | root | N/A | 0.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001087|JGI12677J13195_1011182 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
3300001593|JGI12635J15846_10097543 | All Organisms → cellular organisms → Bacteria | 2115 | Open in IMG/M |
3300001686|C688J18823_10123945 | All Organisms → cellular organisms → Bacteria | 1790 | Open in IMG/M |
3300001867|JGI12627J18819_10092973 | All Organisms → cellular organisms → Bacteria | 1248 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100259798 | All Organisms → cellular organisms → Bacteria | 1624 | Open in IMG/M |
3300003573|Ga0007412J51696_1152402 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300004268|Ga0066398_10124999 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
3300004474|Ga0068968_1446113 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
3300004619|Ga0068953_1462333 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
3300005526|Ga0073909_10066687 | All Organisms → cellular organisms → Bacteria | 1348 | Open in IMG/M |
3300005535|Ga0070684_100170955 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1974 | Open in IMG/M |
3300005541|Ga0070733_10810546 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
3300005542|Ga0070732_10925763 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300005563|Ga0068855_100827265 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
3300005591|Ga0070761_10500044 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
3300005944|Ga0066788_10016234 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1619 | Open in IMG/M |
3300006162|Ga0075030_100932247 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
3300006426|Ga0075037_1696257 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
3300006893|Ga0073928_10758539 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
3300006914|Ga0075436_101230096 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300007265|Ga0099794_10507735 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300009521|Ga0116222_1500381 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300009638|Ga0116113_1162639 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
3300010358|Ga0126370_10333687 | All Organisms → cellular organisms → Bacteria | 1218 | Open in IMG/M |
3300010359|Ga0126376_11437433 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
3300010361|Ga0126378_10022700 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5461 | Open in IMG/M |
3300010362|Ga0126377_13550475 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300010379|Ga0136449_104001023 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300010379|Ga0136449_104427895 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
3300011077|Ga0138572_1149734 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
3300011085|Ga0138581_1042969 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
3300012350|Ga0137372_10707234 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
3300012509|Ga0157334_1010602 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
3300012918|Ga0137396_10806819 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
3300012944|Ga0137410_11652908 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300015241|Ga0137418_10091116 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 2754 | Open in IMG/M |
3300015262|Ga0182007_10073985 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
3300015265|Ga0182005_1101661 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
3300016387|Ga0182040_10666553 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
3300017933|Ga0187801_10433480 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300017993|Ga0187823_10192125 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
3300017995|Ga0187816_10022623 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2487 | Open in IMG/M |
3300018035|Ga0187875_10677906 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300018040|Ga0187862_10326348 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
3300018046|Ga0187851_10528065 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
3300018060|Ga0187765_11153918 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300019260|Ga0181506_1026792 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
3300019284|Ga0187797_1371976 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
3300019786|Ga0182025_1033405 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300020582|Ga0210395_11047967 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300020582|Ga0210395_11136675 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
3300021088|Ga0210404_10299634 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
3300021170|Ga0210400_11342688 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300021178|Ga0210408_10864567 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
3300021178|Ga0210408_11298002 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300021180|Ga0210396_10511999 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
3300021180|Ga0210396_11331104 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300021181|Ga0210388_11507257 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300021401|Ga0210393_10185573 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1678 | Open in IMG/M |
3300021407|Ga0210383_10094266 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2516 | Open in IMG/M |
3300021407|Ga0210383_11278204 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300021474|Ga0210390_11309684 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
3300021475|Ga0210392_10141243 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1635 | Open in IMG/M |
3300021477|Ga0210398_10544332 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
3300021559|Ga0210409_10787914 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
3300022508|Ga0222728_1005175 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1525 | Open in IMG/M |
3300022522|Ga0242659_1005897 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1572 | Open in IMG/M |
3300022726|Ga0242654_10200685 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
3300022728|Ga0224566_111739 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300025463|Ga0208193_1098191 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
3300025473|Ga0208190_1085672 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
3300025812|Ga0208457_1045586 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
3300026078|Ga0207702_11263219 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
3300026217|Ga0209871_1035126 | All Organisms → cellular organisms → Bacteria | 943 | Open in IMG/M |
3300026294|Ga0209839_10104520 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
3300026550|Ga0209474_10123190 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1716 | Open in IMG/M |
3300026557|Ga0179587_10654536 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
3300026984|Ga0208732_1014569 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
3300027605|Ga0209329_1152527 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300027609|Ga0209221_1126487 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
3300027684|Ga0209626_1112552 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
3300027737|Ga0209038_10148646 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
3300027745|Ga0209908_10025833 | All Organisms → cellular organisms → Bacteria | 1155 | Open in IMG/M |
3300027767|Ga0209655_10142853 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
3300027842|Ga0209580_10536751 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
3300027905|Ga0209415_11070049 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300027908|Ga0209006_10368352 | All Organisms → cellular organisms → Bacteria | 1215 | Open in IMG/M |
3300027911|Ga0209698_11043471 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300028020|Ga0265351_1023684 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300028047|Ga0209526_10649959 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
3300028560|Ga0302144_10132512 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
3300028747|Ga0302219_10123537 | All Organisms → cellular organisms → Bacteria | 985 | Open in IMG/M |
3300028747|Ga0302219_10432879 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300028800|Ga0265338_10037680 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4596 | Open in IMG/M |
3300028873|Ga0302197_10381306 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
3300029907|Ga0311329_10417012 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
3300029955|Ga0311342_10022007 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8224 | Open in IMG/M |
3300030399|Ga0311353_10523077 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
3300030503|Ga0311370_10155597 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3142 | Open in IMG/M |
3300030520|Ga0311372_10922760 | All Organisms → cellular organisms → Bacteria | 1168 | Open in IMG/M |
3300030597|Ga0210286_1274013 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300030707|Ga0310038_10457989 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300030740|Ga0265460_11413795 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
3300030746|Ga0302312_10089690 | All Organisms → cellular organisms → Bacteria | 1276 | Open in IMG/M |
3300030815|Ga0265746_1007847 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
3300030815|Ga0265746_1033033 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
3300030836|Ga0265767_108007 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
3300030874|Ga0265742_1002593 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
3300030885|Ga0265743_114362 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300031231|Ga0170824_114558072 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
3300031236|Ga0302324_101245845 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
3300031259|Ga0302187_10322206 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
3300031525|Ga0302326_10444751 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1989 | Open in IMG/M |
3300031715|Ga0307476_10723054 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
3300031715|Ga0307476_10906933 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
3300031753|Ga0307477_10475741 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
3300031754|Ga0307475_10168461 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1745 | Open in IMG/M |
3300031823|Ga0307478_10160280 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1791 | Open in IMG/M |
3300031823|Ga0307478_10736035 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
3300031823|Ga0307478_11032506 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
3300031823|Ga0307478_11046216 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
3300031823|Ga0307478_11298178 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
3300032160|Ga0311301_12097577 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
3300032160|Ga0311301_12708506 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300032174|Ga0307470_11654178 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300032205|Ga0307472_100283771 | All Organisms → cellular organisms → Bacteria | 1320 | Open in IMG/M |
3300032261|Ga0306920_100806810 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1377 | Open in IMG/M |
3300032828|Ga0335080_11446807 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
3300032828|Ga0335080_11517716 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
3300032892|Ga0335081_11429846 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
3300032893|Ga0335069_11623290 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
3300032898|Ga0335072_10777051 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
3300032955|Ga0335076_10931502 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
3300033134|Ga0335073_10211043 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2400 | Open in IMG/M |
3300033158|Ga0335077_10316492 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1702 | Open in IMG/M |
3300033486|Ga0316624_11201471 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
3300033829|Ga0334854_019335 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1647 | Open in IMG/M |
3300034091|Ga0326724_0621215 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.22% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.25% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 7.97% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.97% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 6.52% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.80% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.07% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.35% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 3.62% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.90% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.90% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.90% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.90% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.17% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.45% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.45% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.45% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 1.45% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.45% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.45% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.45% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.72% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.72% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.72% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.72% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.72% |
Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.72% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.72% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.72% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.72% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.72% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.72% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.72% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.72% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.72% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.72% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.72% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.72% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001087 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300003573 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Bulk_28 (Metagenome Metatranscriptome, Counting Only) | Host-Associated | Open in IMG/M |
3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
3300004474 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004619 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 45 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005944 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006426 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_054 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
3300009638 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300011077 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 57 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011085 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 71 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012509 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_6 | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Host-Associated | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300019260 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019284 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300022508 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022522 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022728 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU2 | Environmental | Open in IMG/M |
3300025463 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 (SPAdes) | Environmental | Open in IMG/M |
3300025473 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 (SPAdes) | Environmental | Open in IMG/M |
3300025812 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150 (SPAdes) | Environmental | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026217 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 (SPAdes) | Environmental | Open in IMG/M |
3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300026984 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF048 (SPAdes) | Environmental | Open in IMG/M |
3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027609 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027745 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M | Environmental | Open in IMG/M |
3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028020 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE4 | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028560 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_2 | Environmental | Open in IMG/M |
3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
3300028873 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_1 | Environmental | Open in IMG/M |
3300029907 | I_Bog_N1 coassembly | Environmental | Open in IMG/M |
3300029955 | II_Bog_E2 coassembly | Environmental | Open in IMG/M |
3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300030597 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO747-VDE046SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
3300030740 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assembly | Environmental | Open in IMG/M |
3300030746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_1 | Environmental | Open in IMG/M |
3300030815 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030836 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030874 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030885 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031259 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E1_3 | Environmental | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
3300033829 | Peat soil microbial communities from Stordalen Mire, Sweden - 715 P2 1-5 | Environmental | Open in IMG/M |
3300034091 | Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00N | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12677J13195_10111822 | 3300001087 | Forest Soil | MIKINLLESSKGKNKRGGSNAPTMPSMEMGDLGSPKLKVLVVVLLAG |
JGI12635J15846_100975434 | 3300001593 | Forest Soil | MIKINLLETTKGKGKRGGGSSGPTMPTMEVGDLGSPALKVVIVLVLAGV |
C688J18823_101239454 | 3300001686 | Soil | MIKINLLENSKGKGKRGGSAAPSMPTMEMGDMGSPKLKVLAIVVIV |
JGI12627J18819_100929731 | 3300001867 | Forest Soil | MIKINLLETAKGKGKRAGSGPSMPAIEMGDMGSPKLKI |
JGIcombinedJ26739_1002597981 | 3300002245 | Forest Soil | MIKINLLENSKGKNKRGGSSGPSMPTMEMGDMGSPKLKIL |
Ga0007412J51696_11524022 | 3300003573 | Avena Fatua Rhizosphere | MIKINLLETNKGKGKRGSGGGPSMPTMEMGDVGSPKLKVL |
Ga0066398_101249991 | 3300004268 | Tropical Forest Soil | MIKINLLETAKGKGKRGGSSPVMPTMEMGDMGSPKLKILVM |
Ga0068968_14461131 | 3300004474 | Peatlands Soil | MIKINLLENSKGKNKRGGGGPSMPSMEMGDMGSPKLKVLAVLVIFGLGN |
Ga0068953_14623332 | 3300004619 | Peatlands Soil | MIKINLLETAKGKGKRGGGGPSMPSMEMGDMGSPKLKVLVV |
Ga0073909_100666873 | 3300005526 | Surface Soil | MIKINLLESNKGKGKRGSSGPSMPAMEMGDMGSPTLKVLVILVVAGLLNLGY |
Ga0070684_1001709553 | 3300005535 | Corn Rhizosphere | MIKINLLETSKGKGKRASAAPSMPSIEMGDMGSPKLKILAMVVIVGLGNLG |
Ga0070733_108105462 | 3300005541 | Surface Soil | MIKINLLESSKQKNKRGGSSAPAMPSMEMGDMGSPKLKVLV |
Ga0070732_109257632 | 3300005542 | Surface Soil | MIKINLLESSKGKGKRGGGGGPSMPSMEMGDMGSPKLKVL |
Ga0068855_1008272651 | 3300005563 | Corn Rhizosphere | MIKINLLETSKGKGKRASAAPSMPSIEMGDMGSPKLKILAMVVIVGLGN |
Ga0070761_105000441 | 3300005591 | Soil | MIKINLLENSKGKNKRGGGGGASMPTMDMGDMGSP |
Ga0066788_100162341 | 3300005944 | Soil | MIKINLLENSKGKSKRGGGGGPSMPSMELGDMGSPKLKIL |
Ga0075030_1009322472 | 3300006162 | Watersheds | MIKINLLESSKGKGKRGGSGPSMPTMEMGDMGSPKLKILAIM |
Ga0075037_16962572 | 3300006426 | Permafrost Soil | MIRINLLENSKGKNRRSGGGPSMPSIDMGSMGSPKLKVL |
Ga0073928_107585391 | 3300006893 | Iron-Sulfur Acid Spring | MIRINLLENSKGKNKRAGGGGPAVPTMEMGDLGSPKLKV |
Ga0075436_1012300961 | 3300006914 | Populus Rhizosphere | MIKINLLETGKGKRASSAGPSMPTMEMGDMGSPKLKILVVMV |
Ga0099794_105077351 | 3300007265 | Vadose Zone Soil | MIRINLLESAKGKNKRAGGSSSVAMPSMEMGDMGSPKLKVL |
Ga0116222_15003811 | 3300009521 | Peatlands Soil | MIKINLLESARGKKKSGSSVPTMPSMEMGDMGSPKLKVLVVIILAG |
Ga0116113_11626391 | 3300009638 | Peatland | MIKINLLESARGKKKGSGGSPAMPTMEMGDMGSPKLKVLVVL |
Ga0126370_103336871 | 3300010358 | Tropical Forest Soil | MIKINLLETAKGKGKRASAGPSMPTMEMGDMGSPKLKILVIVVLVG |
Ga0126376_114374332 | 3300010359 | Tropical Forest Soil | MIKINLLETNKGKGKRGSGGGPSLPSMEMGDMGSPKLKVLVVLVVV |
Ga0126378_100227006 | 3300010361 | Tropical Forest Soil | MIKINLLETAKGKGKRAGSSPSMPAIEMGDMGSPKLKILVIVVIVGLA |
Ga0126377_135504752 | 3300010362 | Tropical Forest Soil | MIKINLLETAKGKGKRGGSSPAMPTMEMGDMGSPKLKILVMVV |
Ga0136449_1040010231 | 3300010379 | Peatlands Soil | MIKINLLENSKGKSKRGGGGPSMPTMEMGDMGSPKLKI |
Ga0136449_1044278951 | 3300010379 | Peatlands Soil | MIKINLLENSKGKKRGGSGPSMPTMEMGDMGSPKLKILAVLVIAGLFNLG |
Ga0138572_11497342 | 3300011077 | Peatlands Soil | MIKINLLETSKGKRSGGGPSMPTMEMGDMGSPKLKVLAVLVIAGLFNLG |
Ga0138581_10429691 | 3300011085 | Peatlands Soil | MIKINLLENFKGKNKRGGGGPSMPSMEMGDMGSPKLKVLAVLV |
Ga0137372_107072341 | 3300012350 | Vadose Zone Soil | MIKINLLENSKGKNRRGSSGPSMPTMEMGDMGSPKRKMLAVLVVAG |
Ga0157334_10106022 | 3300012509 | Soil | MIKINLLESNKGKGKRGGSGPSMPAMEMGDMGSPTLKVLVILVIAGLLNL |
Ga0137396_108068192 | 3300012918 | Vadose Zone Soil | MIRINLLETAKGKNKRAGVPSMPSIELGDMGSPKLKVLV |
Ga0137410_116529082 | 3300012944 | Vadose Zone Soil | MIRINLLESAKGKNKRAGGSSSVAMPSMEMGDMGSPKL |
Ga0137418_100911161 | 3300015241 | Vadose Zone Soil | MIRINLLENSKGKNKRAGGSSGPVMPAMDMGDMGSPKLKVLVVLLVAGV |
Ga0182007_100739852 | 3300015262 | Rhizosphere | MIKINLLETSKGKGKRASAAPSMPSIEMGDMGSPKL |
Ga0182005_11016611 | 3300015265 | Rhizosphere | MIKINLLENSKGKGKRGGSAAPSMPTMEMGDMGSPKLK |
Ga0182040_106665531 | 3300016387 | Soil | MIKINLLETAKGKGKRGGSTPSMPTMEMGDMGSPKLKIL |
Ga0187801_104334801 | 3300017933 | Freshwater Sediment | MIKINLLETAKGKGKRGGGGGPSMPTMEMGDMGSPKLKVLVIVVI |
Ga0187823_101921251 | 3300017993 | Freshwater Sediment | MIKINLLENSKGKGKRATSAGPSMPSIEMGGMGSPKLKVLVVVVLAGLINL |
Ga0187816_100226234 | 3300017995 | Freshwater Sediment | MIKINLLETAKGKGKRGGGGASLPTMEMGDMGSPKLKVLVVLVIVGLFN |
Ga0187875_106779062 | 3300018035 | Peatland | MIKINLLETSKGKRSGGGPSMPSMEMGDMGSPKLKVL |
Ga0187862_103263482 | 3300018040 | Peatland | MIKINLLESSKGKNKRGGSSGPTMPTMEMGDMGSP |
Ga0187851_105280651 | 3300018046 | Peatland | MIKINLLENAKGKKRGGGSPAMPTMEMGDMGSPKLKVL |
Ga0187765_111539181 | 3300018060 | Tropical Peatland | MIKINLLETAKGKGKRGGSSPAMPSIEMGDMGSPQLKVL |
Ga0181506_10267921 | 3300019260 | Peatland | MIRINLLENSKGKSKRAGGSSGPTMPSMEFGDMGSPKLKVLVVLIV |
Ga0187797_13719762 | 3300019284 | Peatland | MIRINLLETAKGKGKRGGSGPSMPSMEMGDMGSPKLKVLVVMVLVGLFN |
Ga0182025_10334051 | 3300019786 | Permafrost | MIKINLLENAKGKNKRGGGGGSSMPTMEMGDMGSPKLKKVLAVL |
Ga0210395_110479671 | 3300020582 | Soil | MIKINLLENSKGKSKRGGGGPSMPTMEMGDMGSPKLKILGYW |
Ga0210395_111366751 | 3300020582 | Soil | MIRINLLETTKGKGKRGSSGPAMPAMEMGDMGSPKLKVLVVILIAGA |
Ga0210404_102996342 | 3300021088 | Soil | MIRINLLEAPKPKGKRSSMPSMPTMEVGDVGSPRLKVLL |
Ga0210400_113426881 | 3300021170 | Soil | MIKINLLENSKGKGKRGGGGGPSMPTMEMGDMGSPKLKVLAVLVIFGL |
Ga0210408_108645671 | 3300021178 | Soil | MIKINLLETAKGKNKRGSGGGPSMPSMDMGDMGSPKLKVLVIRVV |
Ga0210408_112980022 | 3300021178 | Soil | MIKINLLETAKGKGKRGGGGPSMPSMEMGDMGSPKLKVLV |
Ga0210396_105119991 | 3300021180 | Soil | MIKINLLENSKGKNKRGAGGGGPVMPTMEMGDMGSPKLKVLVIILLAGAL |
Ga0210396_113311041 | 3300021180 | Soil | MIRINLLETSKGKGKRGSSGPTMPAMEMGDMGSPKLKVLVVILIAG |
Ga0210388_115072571 | 3300021181 | Soil | MIKINLLENSKGKNKRGGGGGSGPVMPTMEMGDMGSPKLKVLV |
Ga0210393_101855731 | 3300021401 | Soil | MIKINLLESARGKKKGGGSSPAMPSMEMGDMGSPKLK |
Ga0210383_100942661 | 3300021407 | Soil | MIKINLVENSKGKGKRGGSSPVMPTMEMGDMGSPKLKILVIMVIVGLG |
Ga0210383_112782042 | 3300021407 | Soil | MIKINLLENSKGKSKRGGSSGPSMPTMEMGDMGSPKLKILAVLVVVGLFNL |
Ga0210390_113096842 | 3300021474 | Soil | MIKINLLENSKGKSKRGGGGPSMPTMEMGDMGSPKLKIL |
Ga0210392_101412433 | 3300021475 | Soil | MIKINLLENAKGKNKRGGGGGPAMPSMDMGDMGSPKLKVLAVLVIAGLF |
Ga0210398_105443321 | 3300021477 | Soil | MIKINLLENSKGKSKRGGSSGPSMPTMEMGDMGSPKLKILAVLVV |
Ga0210409_107879141 | 3300021559 | Soil | MIKINLLETAKGKGKRGGGGPSMPSMEMGDMGSPKLKVLVVVVLAGLINLG |
Ga0222728_10051753 | 3300022508 | Soil | MIRINLLENSKGKSKRAGGSSGPTMPAMELGDMGSPKLKVLV |
Ga0242659_10058971 | 3300022522 | Soil | MIKINLLESARGKKKGGGSSPAMPSMEMGDMGSPKLKIL |
Ga0242654_102006852 | 3300022726 | Soil | MIKINLLENSKGKSKRGGSSGPSMPTMEMGDMGSPKLK |
Ga0224566_1117391 | 3300022728 | Plant Litter | MIKINLLESSKGKNKRAGGGGPSLPAMEMGDMGSP |
Ga0208193_10981912 | 3300025463 | Peatland | MIKINLLETSKGKGKRGGGGSSGPAMPTMEVGDLGSPM |
Ga0208190_10856722 | 3300025473 | Peatland | MIKINLLENAKGKKRGGGSPAMPTMEMGDMGSPKLK |
Ga0208457_10455861 | 3300025812 | Peatland | MIKINLLESSKGKNKRGGSSGPTMPTMEMGDMGSPKLKVLVVLLLVVVSLLV |
Ga0207702_112632191 | 3300026078 | Corn Rhizosphere | MIKINLLENSKGKGKRGGSAAPSMPTMEMGDMGSPKLKILA |
Ga0209871_10351261 | 3300026217 | Permafrost Soil | MIKINLLENAKGKNKRGGGGGPAMPSMDMGDMGSPKLKVLAVLVIAGLFNL |
Ga0209839_101045202 | 3300026294 | Soil | MIKINLLENSKGKSKRGGGGGPSMPTMEMGDMGSPKLKVLA |
Ga0209474_101231903 | 3300026550 | Soil | MIKINLLETSKGKGKRASAAPSMPSIEMGDMGSPKLKILAMVV |
Ga0179587_106545362 | 3300026557 | Vadose Zone Soil | MIKINLLENSKGKNKRGGGGPSMPSMDMGDMGSPKLKV |
Ga0208732_10145692 | 3300026984 | Forest Soil | MIKINLLENSKGKSKRGGGGPSMPTMEMGDMGSPKLK |
Ga0209329_11525271 | 3300027605 | Forest Soil | MIKINLLESSKGKNKRGGSSAPTMPSMEMGDMGSPKLKVLVVLLL |
Ga0209221_11264872 | 3300027609 | Forest Soil | MIKINLLETTKGKGKRGGGSSGPTMPTMEVGDLGSPALKVVIVLVLAG |
Ga0209626_11125521 | 3300027684 | Forest Soil | MIRINLLETSKGKGKRGSSGPTMPAMEMGDMGSPKLKILAVLVVAGLFNL |
Ga0209038_101486462 | 3300027737 | Bog Forest Soil | MIRINLLETSKGKGKRGGSGPTMPAMEMGDMGSPKLKVLVVLLVAGALNFG |
Ga0209908_100258331 | 3300027745 | Thawing Permafrost | MIRINLLENSKGKSKRAGGSGAAMPTMEMGDMGSPKLKVLVV |
Ga0209655_101428532 | 3300027767 | Bog Forest Soil | MIKINLLENSKGKNKRSGGGAGPSLPAMEMGDLGSPKLKVLVV |
Ga0209580_105367511 | 3300027842 | Surface Soil | MIKINLLESSKGKGKRGGGGGPSMPSMEMGDMGSPKLKVLVVLVIAGLFNLG |
Ga0209415_110700491 | 3300027905 | Peatlands Soil | MIKINLLESSKGKNKRGGSSGPAMPTMEMGDMGSPKLKV |
Ga0209006_103683521 | 3300027908 | Forest Soil | MIRINLLESSKGKNKRAGGSSAPVMPTMEMGDMGSPRLKVLAVVVVA |
Ga0209698_110434711 | 3300027911 | Watersheds | MIKINLLENSKGKGKRGGSGPSMPTMEMGDMGSPKLKIL |
Ga0265351_10236842 | 3300028020 | Soil | MIKINLLESSKGKNKRGGSNAPTMPSMEMGDMGSPKLKVLVVLLLAGS |
Ga0209526_106499592 | 3300028047 | Forest Soil | MIRINLLESSKAKNKRAGGSSGPVMPAMEMGDMGSPKLKV |
Ga0302144_101325122 | 3300028560 | Bog | MIRINLLENSKGKSKRAGGSSGPAMPSMEFGDMGSPKLKVLVVLLVAGL |
Ga0302219_101235371 | 3300028747 | Palsa | MIKINLLETSKGKRGGGGPSMPTMEVGDMGSPKLKVLAVLVIA |
Ga0302219_104328792 | 3300028747 | Palsa | MIKINLLESARGKKKGSGGSPAMPTMEMGDMGSPKLKILVVL |
Ga0265338_100376801 | 3300028800 | Rhizosphere | MIKINLLENSKGKNRRGGGGPSMPTMEMGDMGSPKL |
Ga0302197_103813061 | 3300028873 | Bog | MIRINLLENSKGKNKRAGGSAAVMPTMDMGDMGSP |
Ga0311329_104170121 | 3300029907 | Bog | MIKINLLESAKGKNKRGAGGGSSMPKMEMGDMGSPKLKVLVVVLVVGL |
Ga0311342_100220077 | 3300029955 | Bog | MIRINLLESSKARNKRAGGGGPSMPKMEMGDMGSPSLKVLLIVLVAGLL |
Ga0311353_105230772 | 3300030399 | Palsa | MIKINLLETAKGRNKRGGTSSAMPTMEVGNVGSPKMAVLVVLVVVALGNGMYWMR |
Ga0311370_101555974 | 3300030503 | Palsa | MIRINLLENSKGKNRRAGGSGPSMPTMEMGDMGSPKLKVLVVI |
Ga0311372_109227601 | 3300030520 | Palsa | MIRINLLENSKGKNRRAGGSGPSMPTMEMGDMGSPKL |
Ga0210286_12740131 | 3300030597 | Soil | MIKINLLESARGKKKGGGSSPAMPSMEMGDMGSPNH |
Ga0310038_104579892 | 3300030707 | Peatlands Soil | MIKINLLENSKGKNKRGGGGPSMPSMEMGDMGSPKLKVLAVL |
Ga0265460_114137952 | 3300030740 | Soil | MIKINLLETSKGKNKRGGSNAPAMPTMEVGDLGSPRLKVLVVVLV |
Ga0302312_100896902 | 3300030746 | Palsa | MIKINLLESSKQKNKRGGSNAPAMPSMEMGDMGSPKLKVLVVLLVAGLLNF |
Ga0265746_10078471 | 3300030815 | Soil | MIKINLLESSKGKNKRGGSNAPSMPTMEMGDMGSPKLKVLLVLV |
Ga0265746_10330331 | 3300030815 | Soil | MIKINLLETAKGKNKRGGGAGPTMPTMEMGDMGSPKLKVLLVLVAVALFN |
Ga0265767_1080072 | 3300030836 | Soil | MIKINLLESARGKKKGSGGSPAMPTMEMGDMGSPKLKVLVILILAG |
Ga0265742_10025932 | 3300030874 | Soil | MIRINLLENSKGRSKRAGGGGPAMPTMEMGDMGSPKLKV |
Ga0265743_1143622 | 3300030885 | Soil | MIKINLLENSKGKSKRGGSGPSMPSMEMGDMGSPKLKILAVLVVA |
Ga0170824_1145580721 | 3300031231 | Forest Soil | MIRINLLETAKGKNKRGGSSGPAMPTMEMGDMGSPKL |
Ga0302324_1012458451 | 3300031236 | Palsa | MIKINLLESSKGKNKRGGSNGPAMPTMEMGDMGSPKLKVLVVL |
Ga0302187_103222061 | 3300031259 | Bog | MIRINLLENSKGKNKRAGGSAAVMPTMDMGDMGSPKL |
Ga0302326_104447511 | 3300031525 | Palsa | MIKINLLESARGKKKGSGGSPAMPTMEMGDMGSPKLKILVVLI |
Ga0307476_107230542 | 3300031715 | Hardwood Forest Soil | MIKINLLENSKAKNKRAGGGGPAMPTMEMGDMGSPKLKVLVVLLLAG |
Ga0307476_109069332 | 3300031715 | Hardwood Forest Soil | MIKINLLESSKQKNKRGGSSAPAMPSMDMGDMGSPKLKVLVVLV |
Ga0307477_104757412 | 3300031753 | Hardwood Forest Soil | MIRINLLETAKGKNKRAGGGVPTLPTMEMGDMGSPRLKVLAMLVVLG |
Ga0307475_101684611 | 3300031754 | Hardwood Forest Soil | MIRINLLETAKGKNKRAGVPSMPSIELGDMGSPKLKVLVVLL |
Ga0307478_101602801 | 3300031823 | Hardwood Forest Soil | MIRINLLETSKGKGKRGSSGPTMPAMEMGDMGSPKLKVLVVIL |
Ga0307478_107360352 | 3300031823 | Hardwood Forest Soil | MIRINLLETAKGKNKRAGGSSGPTLPAMEMGDMGSPRLKVLAAVVLAGLL |
Ga0307478_110325062 | 3300031823 | Hardwood Forest Soil | MIRINLLETSKGKNKRAGGSSVPAMPAMEMGDMGSPKLKVLVVLM |
Ga0307478_110462162 | 3300031823 | Hardwood Forest Soil | MIKINLLESSKGKNKRGGSSGPAMPTMEMGDMGSPKLKVLVVLLL |
Ga0307478_112981781 | 3300031823 | Hardwood Forest Soil | MIRINLLESSKAKNKRAGGSSGPVMPAMEMGDMGSPKLKVLVILIVAGALN |
Ga0311301_120975771 | 3300032160 | Peatlands Soil | MIKINLLENSKGKSKRGGGGPSMPTMEMGDMGSPKLKILAVLVIAG |
Ga0311301_127085061 | 3300032160 | Peatlands Soil | MIKINLLENSKGKKRGGSGPSMPTMEMGDMGSPKLKV |
Ga0307470_116541782 | 3300032174 | Hardwood Forest Soil | MIKINLLENSKGKSKRGGGGGPSMPSMEMGDMGSTKLK |
Ga0307472_1002837711 | 3300032205 | Hardwood Forest Soil | MIKINLLENSKGKGKRGSSGPSMPTMEMGDMGSPK |
Ga0306920_1008068101 | 3300032261 | Soil | MIKINLLETSKGKGKRAGSGPSMPTMEMGDMGSPK |
Ga0335080_114468072 | 3300032828 | Soil | MIKINLLETSKGKGKRGGSGPSMPSMEMGDMGSPKLKVLVVLVL |
Ga0335080_115177161 | 3300032828 | Soil | MIKINLLETNKGKGKRGSGGGSGPSMPTIEMGDMGSPR |
Ga0335081_114298462 | 3300032892 | Soil | MIKINLLETAKGKNKRGGGGPSMPSMEMGDMGSPKLKVLIVV |
Ga0335069_116232902 | 3300032893 | Soil | MIKINLLETAKGKGKRGSGGGGPSMPTMDMGDMGSPKLKVLAIVVIAGLL |
Ga0335072_107770512 | 3300032898 | Soil | MIKINLLETAKGKGKRGGGGGPSMPAIEMGDMGSPKL |
Ga0335076_109315022 | 3300032955 | Soil | MIKINLLESSKGKGKRVSSGAMPSMPTMEMGDMGSPKLKILVVVV |
Ga0335073_102110434 | 3300033134 | Soil | MIKINLLETAKGKGKRSGGGSSGPSLPSMELGNLGS |
Ga0335077_103164921 | 3300033158 | Soil | MIKINLLETNKGKGKRGSGGGSGPSMPSIEMGDMGSPTLKIL |
Ga0316624_112014712 | 3300033486 | Soil | MIKINLLETNKGKGKRGSGGGPSMPTMEMGDMGSPKLKVLVVLVLAGL |
Ga0334854_019335_1507_1647 | 3300033829 | Soil | MIRINLLENSKGKSKRAGGSGAAMPTMEMGDMGSPKLKVLVVLIVAG |
Ga0326724_0621215_2_148 | 3300034091 | Peat Soil | MIKINLLETAKGKNKRGGGGPALPTMEMGDMGSPKLKVLVVLVAAGLFN |
⦗Top⦘ |