NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F056011

Metagenome / Metatranscriptome Family F056011

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F056011
Family Type Metagenome / Metatranscriptome
Number of Sequences 138
Average Sequence Length 42 residues
Representative Sequence TAYRWFALALHKEPDNQALQDDLQKLWSQMTQPERQLAIKLSQ
Number of Associated Samples 118
Number of Associated Scaffolds 138

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 97.83 %
% of genes from short scaffolds (< 2000 bps) 92.75 %
Associated GOLD sequencing projects 111
AlphaFold2 3D model prediction Yes
3D model pTM-score0.40

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (92.029 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(13.768 % of family members)
Environment Ontology (ENVO) Unclassified
(23.913 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(63.043 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 49.30%    β-sheet: 0.00%    Coil/Unstructured: 50.70%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.40
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 138 Family Scaffolds
PF04542Sigma70_r2 17.39
PF08281Sigma70_r4_2 15.94
PF13193AMP-binding_C 6.52
PF05362Lon_C 6.52
PF00782DSPc 5.07
PF13490zf-HC2 5.07
PF13350Y_phosphatase3 4.35
PF03162Y_phosphatase2 1.45
PF13460NAD_binding_10 0.72
PF02742Fe_dep_repr_C 0.72
PF00463ICL 0.72
PF04273BLH_phosphatase 0.72
PF00275EPSP_synthase 0.72
PF02661Fic 0.72
PF06172Cupin_5 0.72
PF13517FG-GAP_3 0.72
PF00144Beta-lactamase 0.72

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 138 Family Scaffolds
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 17.39
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 17.39
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 17.39
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 17.39
COG0466ATP-dependent Lon protease, bacterial typePosttranslational modification, protein turnover, chaperones [O] 6.52
COG1067Predicted ATP-dependent proteasePosttranslational modification, protein turnover, chaperones [O] 6.52
COG1750Predicted archaeal serine protease, S18 familyGeneral function prediction only [R] 6.52
COG3480Predicted secreted protein YlbL, contains PDZ domainSignal transduction mechanisms [T] 6.52
COG2365Protein tyrosine/serine phosphatase Oca4Signal transduction mechanisms [T] 1.45
COG1321Mn-dependent transcriptional regulator MntR, DtxR familyTranscription [K] 0.72
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 0.72
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.72
COG2224Isocitrate lyaseEnergy production and conversion [C] 0.72
COG2367Beta-lactamase class ADefense mechanisms [V] 0.72
COG3453Predicted phosphohydrolase, protein tyrosine phosphatase (PTP) superfamily, DUF442 familyGeneral function prediction only [R] 0.72
COG3542Predicted sugar epimerase, cupin superfamilyGeneral function prediction only [R] 0.72

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms92.03 %
UnclassifiedrootN/A7.97 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000567|JGI12270J11330_10104208All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1223Open in IMG/M
3300000579|AP72_2010_repI_A01DRAFT_1018786All Organisms → cellular organisms → Bacteria1033Open in IMG/M
3300001084|JGI12648J13191_1014047All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium772Open in IMG/M
3300001356|JGI12269J14319_10053902All Organisms → cellular organisms → Bacteria2361Open in IMG/M
3300001356|JGI12269J14319_10066842All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2005Open in IMG/M
3300001356|JGI12269J14319_10320085All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium554Open in IMG/M
3300002245|JGIcombinedJ26739_101563563All Organisms → cellular organisms → Bacteria → Acidobacteria556Open in IMG/M
3300002245|JGIcombinedJ26739_101567513All Organisms → cellular organisms → Bacteria → Acidobacteria555Open in IMG/M
3300004973|Ga0072322_1328627All Organisms → cellular organisms → Bacteria → Acidobacteria529Open in IMG/M
3300005435|Ga0070714_102508943All Organisms → cellular organisms → Bacteria → Acidobacteria500Open in IMG/M
3300005534|Ga0070735_10354449All Organisms → cellular organisms → Bacteria → Acidobacteria881Open in IMG/M
3300005537|Ga0070730_10467982All Organisms → cellular organisms → Bacteria → Acidobacteria811Open in IMG/M
3300005541|Ga0070733_10320957All Organisms → cellular organisms → Bacteria → Acidobacteria1025Open in IMG/M
3300005541|Ga0070733_10834611Not Available619Open in IMG/M
3300005541|Ga0070733_11208763All Organisms → cellular organisms → Bacteria → Acidobacteria506Open in IMG/M
3300005542|Ga0070732_10297217All Organisms → cellular organisms → Bacteria → Acidobacteria969Open in IMG/M
3300005712|Ga0070764_10166711All Organisms → cellular organisms → Bacteria1219Open in IMG/M
3300006028|Ga0070717_11563043All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium598Open in IMG/M
3300006102|Ga0075015_101043852Not Available502Open in IMG/M
3300006162|Ga0075030_101532624All Organisms → cellular organisms → Bacteria → Acidobacteria522Open in IMG/M
3300006173|Ga0070716_100038629All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2644Open in IMG/M
3300006176|Ga0070765_100036723All Organisms → cellular organisms → Bacteria3879Open in IMG/M
3300006176|Ga0070765_102199384All Organisms → cellular organisms → Bacteria → Acidobacteria514Open in IMG/M
3300006893|Ga0073928_10626590Not Available757Open in IMG/M
3300009038|Ga0099829_11044626All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium677Open in IMG/M
3300009088|Ga0099830_11074131All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium667Open in IMG/M
3300009148|Ga0105243_10571663Not Available1084Open in IMG/M
3300009521|Ga0116222_1214295All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium830Open in IMG/M
3300009614|Ga0116104_1070279All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium727Open in IMG/M
3300009645|Ga0116106_1109973All Organisms → cellular organisms → Bacteria → Acidobacteria889Open in IMG/M
3300009762|Ga0116130_1232238All Organisms → cellular organisms → Bacteria → Acidobacteria586Open in IMG/M
3300009839|Ga0116223_10427837All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium776Open in IMG/M
3300010048|Ga0126373_11667240All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium702Open in IMG/M
3300010360|Ga0126372_10170658All Organisms → cellular organisms → Bacteria → Acidobacteria1770Open in IMG/M
3300010379|Ga0136449_102765395Not Available694Open in IMG/M
3300011120|Ga0150983_10261703All Organisms → cellular organisms → Bacteria → Acidobacteria1185Open in IMG/M
3300011120|Ga0150983_15201835All Organisms → cellular organisms → Bacteria → Acidobacteria757Open in IMG/M
3300011120|Ga0150983_15502930All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium647Open in IMG/M
3300012203|Ga0137399_11393944All Organisms → cellular organisms → Bacteria → Acidobacteria587Open in IMG/M
3300012210|Ga0137378_10566701All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1045Open in IMG/M
3300012354|Ga0137366_10094766All Organisms → cellular organisms → Bacteria2264Open in IMG/M
3300012469|Ga0150984_114446801All Organisms → cellular organisms → Bacteria1562Open in IMG/M
3300012683|Ga0137398_10869372All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300012685|Ga0137397_11140427All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium565Open in IMG/M
3300012918|Ga0137396_11033755All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium592Open in IMG/M
3300012927|Ga0137416_10039906All Organisms → cellular organisms → Bacteria → Proteobacteria3211Open in IMG/M
3300014495|Ga0182015_10406157All Organisms → cellular organisms → Bacteria → Acidobacteria878Open in IMG/M
3300014501|Ga0182024_12269501All Organisms → cellular organisms → Bacteria → Acidobacteria592Open in IMG/M
3300015241|Ga0137418_11189733All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium537Open in IMG/M
3300015262|Ga0182007_10273686All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium612Open in IMG/M
3300016422|Ga0182039_10878729All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium799Open in IMG/M
3300016702|Ga0181511_1291858All Organisms → cellular organisms → Bacteria → Acidobacteria761Open in IMG/M
3300017970|Ga0187783_10680772All Organisms → cellular organisms → Bacteria743Open in IMG/M
3300018008|Ga0187888_1156623All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium928Open in IMG/M
3300018037|Ga0187883_10553257All Organisms → cellular organisms → Bacteria → Acidobacteria595Open in IMG/M
3300018085|Ga0187772_10530845All Organisms → cellular organisms → Bacteria832Open in IMG/M
3300018086|Ga0187769_10422992All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1003Open in IMG/M
3300018088|Ga0187771_11550059Not Available562Open in IMG/M
3300018090|Ga0187770_10569871All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium899Open in IMG/M
3300018482|Ga0066669_11735140All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium574Open in IMG/M
3300019082|Ga0187852_1140170All Organisms → cellular organisms → Bacteria → Acidobacteria1033Open in IMG/M
3300020581|Ga0210399_10666978All Organisms → cellular organisms → Bacteria → Acidobacteria857Open in IMG/M
3300020582|Ga0210395_10617409All Organisms → cellular organisms → Bacteria → Acidobacteria813Open in IMG/M
3300020582|Ga0210395_11310349All Organisms → cellular organisms → Bacteria → Acidobacteria530Open in IMG/M
3300021171|Ga0210405_10818976All Organisms → cellular organisms → Bacteria → Acidobacteria712Open in IMG/M
3300021171|Ga0210405_10971644All Organisms → cellular organisms → Bacteria → Acidobacteria642Open in IMG/M
3300021178|Ga0210408_10323539All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1230Open in IMG/M
3300021178|Ga0210408_10985832All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium653Open in IMG/M
3300021180|Ga0210396_10646019All Organisms → cellular organisms → Bacteria → Acidobacteria917Open in IMG/M
3300021181|Ga0210388_11233512All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium633Open in IMG/M
3300021402|Ga0210385_10352480All Organisms → cellular organisms → Bacteria → Acidobacteria1099Open in IMG/M
3300021405|Ga0210387_10650752All Organisms → cellular organisms → Bacteria → Acidobacteria935Open in IMG/M
3300021405|Ga0210387_11004556All Organisms → cellular organisms → Bacteria → Acidobacteria731Open in IMG/M
3300021432|Ga0210384_11120431All Organisms → cellular organisms → Bacteria → Acidobacteria690Open in IMG/M
3300021477|Ga0210398_11226314All Organisms → cellular organisms → Bacteria → Acidobacteria592Open in IMG/M
3300021559|Ga0210409_11733518All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium501Open in IMG/M
3300021560|Ga0126371_10658538All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1196Open in IMG/M
3300021560|Ga0126371_13190706All Organisms → cellular organisms → Bacteria → Acidobacteria554Open in IMG/M
3300021860|Ga0213851_1754084All Organisms → cellular organisms → Bacteria → Acidobacteria849Open in IMG/M
3300022505|Ga0242647_1025180All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium617Open in IMG/M
3300022522|Ga0242659_1066014All Organisms → cellular organisms → Bacteria → Acidobacteria666Open in IMG/M
3300022721|Ga0242666_1121894All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium619Open in IMG/M
3300022840|Ga0224549_1027173Not Available779Open in IMG/M
3300025446|Ga0208038_1080132All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium568Open in IMG/M
3300025898|Ga0207692_10086197All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1692Open in IMG/M
3300025898|Ga0207692_10709739All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium653Open in IMG/M
3300025922|Ga0207646_11634911All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.Bin425555Open in IMG/M
3300026291|Ga0209890_10218990All Organisms → cellular organisms → Bacteria → Acidobacteria604Open in IMG/M
3300026552|Ga0209577_10832357All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium516Open in IMG/M
3300027181|Ga0208997_1057429All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium580Open in IMG/M
3300027297|Ga0208241_1048770All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium669Open in IMG/M
3300027432|Ga0209421_1098342All Organisms → cellular organisms → Bacteria → Acidobacteria598Open in IMG/M
3300027576|Ga0209003_1031758Not Available898Open in IMG/M
3300027678|Ga0209011_1074815All Organisms → cellular organisms → Bacteria1006Open in IMG/M
3300027783|Ga0209448_10167570All Organisms → cellular organisms → Bacteria → Acidobacteria732Open in IMG/M
3300027824|Ga0209040_10180301All Organisms → cellular organisms → Bacteria1113Open in IMG/M
3300027826|Ga0209060_10422894All Organisms → cellular organisms → Bacteria → Acidobacteria606Open in IMG/M
3300027857|Ga0209166_10465837All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium651Open in IMG/M
3300027867|Ga0209167_10569488Not Available620Open in IMG/M
3300027879|Ga0209169_10188005All Organisms → cellular organisms → Bacteria → Acidobacteria1079Open in IMG/M
3300027889|Ga0209380_10108486All Organisms → cellular organisms → Bacteria1608Open in IMG/M
3300027889|Ga0209380_10774488All Organisms → cellular organisms → Bacteria → Acidobacteria546Open in IMG/M
3300027895|Ga0209624_10628488All Organisms → cellular organisms → Bacteria → Acidobacteria711Open in IMG/M
3300027905|Ga0209415_10280495All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1461Open in IMG/M
3300027911|Ga0209698_10031698All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis4829Open in IMG/M
3300027986|Ga0209168_10260687All Organisms → cellular organisms → Bacteria → Acidobacteria856Open in IMG/M
3300028047|Ga0209526_10784395All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium592Open in IMG/M
3300028780|Ga0302225_10560815All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium530Open in IMG/M
3300028798|Ga0302222_10291224Not Available636Open in IMG/M
3300028906|Ga0308309_10820314All Organisms → cellular organisms → Bacteria → Acidobacteria808Open in IMG/M
3300029636|Ga0222749_10224224All Organisms → cellular organisms → Bacteria → Acidobacteria948Open in IMG/M
3300029907|Ga0311329_10233573All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1381Open in IMG/M
3300029918|Ga0302143_1182679All Organisms → cellular organisms → Bacteria → Acidobacteria508Open in IMG/M
3300029939|Ga0311328_10435779All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium934Open in IMG/M
3300029944|Ga0311352_10924196All Organisms → cellular organisms → Bacteria → Acidobacteria675Open in IMG/M
3300030490|Ga0302184_10160347All Organisms → cellular organisms → Bacteria → Acidobacteria969Open in IMG/M
3300030580|Ga0311355_10268170All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1736Open in IMG/M
3300030617|Ga0311356_11306003All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300030760|Ga0265762_1014555All Organisms → cellular organisms → Bacteria1420Open in IMG/M
3300031057|Ga0170834_100768809All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium597Open in IMG/M
3300031090|Ga0265760_10160633All Organisms → cellular organisms → Bacteria → Acidobacteria741Open in IMG/M
3300031525|Ga0302326_11702238All Organisms → cellular organisms → Bacteria832Open in IMG/M
3300031708|Ga0310686_101175385All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1457Open in IMG/M
3300031708|Ga0310686_104191040All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium763Open in IMG/M
3300031715|Ga0307476_10047005All Organisms → cellular organisms → Bacteria2930Open in IMG/M
3300031715|Ga0307476_10059813All Organisms → cellular organisms → Bacteria → Acidobacteria2618Open in IMG/M
3300031715|Ga0307476_10307414All Organisms → cellular organisms → Bacteria1163Open in IMG/M
3300031715|Ga0307476_11283591All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium535Open in IMG/M
3300031823|Ga0307478_11227330Not Available624Open in IMG/M
3300031912|Ga0306921_11169761All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium858Open in IMG/M
3300031962|Ga0307479_10383398All Organisms → cellular organisms → Bacteria1390Open in IMG/M
3300032174|Ga0307470_10370288All Organisms → cellular organisms → Bacteria1001Open in IMG/M
3300032770|Ga0335085_12256780All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium546Open in IMG/M
3300032783|Ga0335079_10179723All Organisms → cellular organisms → Bacteria → Acidobacteria2358Open in IMG/M
3300032805|Ga0335078_10418192All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1752Open in IMG/M
3300032828|Ga0335080_11151262All Organisms → cellular organisms → Bacteria782Open in IMG/M
3300034163|Ga0370515_0167133All Organisms → cellular organisms → Bacteria941Open in IMG/M
3300034163|Ga0370515_0427219All Organisms → cellular organisms → Bacteria → Acidobacteria559Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil13.77%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil9.42%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.25%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil7.25%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil6.52%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil5.07%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil5.07%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa5.07%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.62%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.62%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland2.90%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland2.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.90%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.90%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.90%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.17%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog2.17%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.45%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.45%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.45%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil1.45%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.72%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.72%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.72%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.72%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.72%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.72%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.72%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.72%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.72%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.72%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.72%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000567Peat soil microbial communities from Weissenstadt, Germany - SII-2010EnvironmentalOpen in IMG/M
3300000579Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A01EnvironmentalOpen in IMG/M
3300001084Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1EnvironmentalOpen in IMG/M
3300001356Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004973Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 19 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300009614Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_150EnvironmentalOpen in IMG/M
3300009645Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40EnvironmentalOpen in IMG/M
3300009762Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40EnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015262Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaGHost-AssociatedOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016702Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018008Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019082Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300021860Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022505Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022522Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022721Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022840Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 1-5EnvironmentalOpen in IMG/M
3300025446Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026291Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027181Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027297Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes)EnvironmentalOpen in IMG/M
3300027432Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027576Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027678Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027783Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027824Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027826Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027986Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028780Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2EnvironmentalOpen in IMG/M
3300028798Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029907I_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300029918Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_1EnvironmentalOpen in IMG/M
3300029939I_Bog_E3 coassemblyEnvironmentalOpen in IMG/M
3300029944II_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030490Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3EnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030617II_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030760Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031090Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300034163Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12270J11330_1010420813300000567Peatlands SoilYRWFAFALRKQPDNEPLQENLQKIWAQMTQPERQLAVKLTQ*
AP72_2010_repI_A01DRAFT_101878613300000579Forest SoilLALRKDPENTSIHADLSKLWKEMTPAEQQLAIKLTQ*
JGI12648J13191_101404713300001084Forest SoilRWFAMALRKDPDNQPVQADLQKLWGEMTQPERQLAIKLSQ*
JGI12269J14319_1005390213300001356Peatlands SoilAYRWFALALRKDPDNEAVQTDLQKLWGEMTQPERQLAIKLSQ*
JGI12269J14319_1006684233300001356Peatlands SoilYRWFALALRKDPNNESLQADLNKLWGEMTQPERQLAIKLSQ*
JGI12269J14319_1032008513300001356Peatlands SoilLPTAYRWFALALHKEPDNQALQEDLQKLWSQMTQPERQLAIKLSQ*
JGIcombinedJ26739_10156356313300002245Forest SoilLHKQPDNQPLQDDLQKLWNQMTQPERQLAIKLSQ*
JGIcombinedJ26739_10156751313300002245Forest SoilFALALRKQPDDQPLQDNMKKLWGDMTQPERQLAIRLSQ*
Ga0072322_132862713300004973Peatlands SoilTPRDLPTAYRWFALALRKDPDNQAVQTDLQKLWGEMTQPERQLAIRLSQ*
Ga0070714_10250894323300005435Agricultural SoilTPRDLPTAYRWFALALRKDPENTSIHTDLSKLWKEMTPAEQQLAIKLTQ*
Ga0070735_1035444923300005534Surface SoilTAYRWFALALRKDPDNESVQTDLQKLWGEMTQPERQLAIKLSQ*
Ga0070730_1046798213300005537Surface SoilLPTAYRWFALALRKEPDNVAVQGDLQKLWGEMTQPERQLAIRLTH*
Ga0070733_1032095733300005541Surface SoilTPRDLPTAYSWFARALRKEPDSTSVQTDLQKLWSEMTQPERQLAIKLSQ*
Ga0070733_1083461113300005541Surface SoilPRDLPTAYRWFAMALRKDPSNDAVQTDLKKLWGEMTQPERQLAIKLTQ*
Ga0070733_1120876323300005541Surface SoilPRDLPTAYRWFALALRKEPDNQAVQTDLQKLWGEMTQPERQLAIRLSQ*
Ga0070732_1029721713300005542Surface SoilRWFALALRKQPDNASIQADLQKLWSEMTQPERQLAIKLSQ*
Ga0070764_1016671123300005712SoilAYRWFALALHKEPDNQALQDDLQKLWSQMTQPERQLAIRLSQ*
Ga0070717_1156304313300006028Corn, Switchgrass And Miscanthus RhizosphereHDLPTAYRWFAMALRKDPENQAIQGDLQKLWGEMTQPERQLAIKLTQ*
Ga0075015_10104385223300006102WatershedsPHDLPTAYRWFAMALRKEPDNQSVQADLQKLWGEMTQPERQLAIKLSQ*
Ga0075030_10153262423300006162WatershedsLALRKDPENTAAQEDLSKLWSEMTPPERQLAIKLSQ*
Ga0070716_10003862913300006173Corn, Switchgrass And Miscanthus RhizosphereLRKDPENQAVQADLQKLWGEMTQPERQLAIKLSQ*
Ga0070765_10003672353300006176SoilTAYRWFAMALRKDPDNQAVQADLQKLWSEMTQPERQLAIKLSQ*
Ga0070765_10219938413300006176SoilALRKQPDDQPLQDNMKKLWGDMTQPERQLAIRLSQ*
Ga0073928_1062659023300006893Iron-Sulfur Acid SpringALHKEPDNQALQNDLQNLWRKMTRPERQLAIKLSQ*
Ga0099829_1104462613300009038Vadose Zone SoilLALRKQPDNQPLQENLQRLWTQMTQPERQLAIKLSQ*
Ga0099830_1107413113300009088Vadose Zone SoilRDLPTAYRWFALALRKQPDNQPLQENLQRLWSQMTQPERQLAIKLSQ*
Ga0105243_1057166313300009148Miscanthus RhizosphereTAYRWFAVALRKDPSNQSIQTDLQKLWGEMTQPERQLAIKLTQ*
Ga0116222_121429523300009521Peatlands SoilWFALALRKEPDNQSVQTDLQKLWGEMTQPERQLAIKLSQ*
Ga0116104_107027923300009614PeatlandALALHKQPDNQPLQDDLQKLWSQMTQPERQLAIKLSQ*
Ga0116106_110997313300009645PeatlandMALHKQPDNLPLQDDLQKLWSQMTQPERQLAIKLSQ*
Ga0116130_123223813300009762PeatlandALALHKQPDNEALQDNLQKLWSQMTPPERQLAIKLSQ*
Ga0116223_1042783713300009839Peatlands SoilLRKDPDNEAVQTDLQKLWGEMTQPERQLAIKLSQ*
Ga0126373_1166724013300010048Tropical Forest SoilIALRKDPENTAIQADLSKLWGEMTQPERQLAIKLTQ*
Ga0126372_1017065833300010360Tropical Forest SoilMALRKDPDNTALHSDLTKLWGEMTQPERQLAIKMTQ*
Ga0136449_10276539523300010379Peatlands SoilLHKEPDNQALQNNLQNLWSTMTPPERQLAIKLSQ*
Ga0150983_1026170313300011120Forest SoilDLPTAYRWFALALRKDPDNESVQTDLQKLWGEMTQPERQLAIKLSQ*
Ga0150983_1520183523300011120Forest SoilRWFALALRKDPANQPLQADLQKLWGEMTQPERQLAIQLSQ*
Ga0150983_1550293013300011120Forest SoilLPTAYRWFALALHKEPDNQALQDDLQKLWSQMTQPERQLAIKLSQ*
Ga0137399_1139394413300012203Vadose Zone SoilDLPTAYRWFALALHKQPDNQALQDYPESLWDKMTQPERQLAIKFSQ*
Ga0137378_1056670123300012210Vadose Zone SoilAYRWFALALRKDPENSAVQADLQKLWGEMTQPERQLAIKLSQ*
Ga0137366_1009476633300012354Vadose Zone SoilPTAYRWFALALRKDPENSAVQADLQKLWGEMTQPERQLAIKLSQ*
Ga0150984_11444680133300012469Avena Fatua RhizosphereWFALALRRDPENNAVQADLQKLWSEMTQPERQLAIKLSQ*
Ga0137398_1086937213300012683Vadose Zone SoilYRWFALALHKQPDNQVLQDELQKLWRQMTPPERQLAIKLSQ*
Ga0137397_1114042713300012685Vadose Zone SoilLALRKEPDNMSVQSDLQKLWGEMTQPERQLAIRLTH*
Ga0137396_1103375513300012918Vadose Zone SoilRWFAVALRKEPDNPALQQNLQKLWSQMTRPERQLAIKLSQ*
Ga0137416_1003990613300012927Vadose Zone SoilAPRDLPTAYRWFAVALRKEPDNPALQQNLQKLWSQMTRPEQQLAIKLSQ*
Ga0182015_1040615713300014495PalsaTPRDLPTAYRWFALALRKQPDNQPLQESLQKIWAQMTPPERQLAIRLSQ*
Ga0182024_1226950123300014501PermafrostFAMALHKDPDNQSVQTDLQKLWGEMTQPERQLAIKLSQ*
Ga0137418_1118973313300015241Vadose Zone SoilDLPTAYRWFAMALHKQPDNQALQNDLQKLWSQMTPPERQLAIKLSQ*
Ga0182007_1027368623300015262RhizosphereFAVALRKDPSNEAIQSDLQKLWGEMTQPERQLAIKLTQ*
Ga0182039_1087872923300016422SoilDLPTAYRWFAIALRKDPENTSVQADLSKLWSEMTQPERQLAIKLTQ
Ga0181511_129185823300016702PeatlandWFAMALHKQPDNLPLQDDLQKLWSQMTQPERQLAIKLSQ
Ga0187783_1068077223300017970Tropical PeatlandPTAYRWFALALHKEPENQVLQDDLQKLWGQMTQPERQLAIRLSQ
Ga0187888_115662313300018008PeatlandPRDLPTAYRWFAMALHKEPDNLRLQNDLQNLWSQMTQPERQLAIKLSQ
Ga0187883_1055325713300018037PeatlandPRDLPTAYRWYALALHKQTDNQTLQDDLQNLWGKMTPPERQLAIKLSQ
Ga0187772_1053084513300018085Tropical PeatlandYRWFALALHKDPDNKTLQDDLQNLWGQMTPPERQLAIKLSQ
Ga0187769_1042299223300018086Tropical PeatlandAYRWFALALRKDPTNESLQSDLQKLWGEMTQPERQLAIRLSQ
Ga0187771_1155005923300018088Tropical PeatlandALALRKDPNNESLQADLQKLWGEMTQPERQLAIKLSQ
Ga0187770_1056987133300018090Tropical PeatlandAYRWFALALRKDPSNQSVAADLQKLWREMTQPERQLAIRLSQ
Ga0066669_1173514023300018482Grasslands SoilYRWFAVALRKDPSNQAIQTDLQKLWGEMTQPERQLAIKLTQ
Ga0187852_114017013300019082PeatlandPRDLPTAYLWFARALHKQPDNQGLQDDLQKLWGQMTQPERQLAIKLSQ
Ga0210399_1066697813300020581SoilRWFAQALHKQPDNQTLQDDLQNLWSKMTPPERQLAIKLSQ
Ga0210395_1061740923300020582SoilWFAQALHKQPDNQRLQDDLQKLWGQMTPPERQLAIKLSQ
Ga0210395_1131034913300020582SoilPTAYRWFAMALRKDPDNQPVQADLQKLWSEMTQPERQLAIKLSQ
Ga0210405_1081897623300021171SoilTPHDLPTAYRWFALALRKDPNNMAVQTDLQKLWGEMTQPERQLAIKLSQ
Ga0210405_1097164423300021171SoilLALRKQPNDQPLQQNMEKLWGRMTQPERQLAIRLSQ
Ga0210408_1032353933300021178SoilTPRDLPTAYRWFALALRKDPDNQAVQTDLQKLWGEMTQPERQLAIRLSQ
Ga0210408_1098583223300021178SoilLPTAYRWFAMALRKDPDNQAVQADLQKLWSEMTQPERQLAIKLSQ
Ga0210396_1064601913300021180SoilPHDLPTAYRWFALALRKDPDNESVQTDLQKLWGEMTQPERQLAIKLSQ
Ga0210388_1123351213300021181SoilPRDLPTSYRWIALALRKEPDNQALKDNLQKLWSEMTQPERQLAIKLSQ
Ga0210385_1035248033300021402SoilFALALRKDPANQPLQADLQKLWGEMTQPERQLAIKLSQ
Ga0210387_1065075223300021405SoilWIALALRKEPDNQALKESLQKLWSEMTQPERQLAIKLSQ
Ga0210387_1100455613300021405SoilLPTAYSWFSKVLRRDPDNKAASDDLNKLWGEMTQPERQLAIKLSQ
Ga0210384_1112043123300021432SoilWFALALRKQPDNASIQADLQKLWSEMTQPERQLAIKLSQ
Ga0210398_1122631423300021477SoilFALALHKDPDNQALQDDLQKLWSQMTPPERQLAIKLSQ
Ga0210409_1173351823300021559SoilAYRWFAVALRKEPDNPALQQNLQKLWSQMTQPERHLAIKLSQ
Ga0126371_1065853833300021560Tropical Forest SoilDLPTAYRWFALALRRDPENSAVQADLSKLWSEMTPPERQLAIKLSQ
Ga0126371_1319070613300021560Tropical Forest SoilMALRKEPDNASVQNDLQKLWGEMTQPERQLAIKLSQ
Ga0213851_175408423300021860WatershedsALALRKDPDNQAVQTDLKKLWGEMTQPERQLAIKLSH
Ga0242647_102518013300022505SoilPTAYRWYAVALHKEPDNQALQNDLQKLWSQMTQPERQLAIRLSQ
Ga0242659_106601423300022522SoilLPTAYRWFALALRKDPDNQSVQADLSKLWGEMTQPERQLAIKLSQ
Ga0242666_112189413300022721SoilTAYRWFALALHKEPDNQALQDDLQKLWSQMTQPERQLAIKLSQ
Ga0224549_102717313300022840SoilTCTPRDLPTAYRWFALALHKEPENTALQQDLQKLWGQMTQPERQLAIKLSQ
Ga0208038_108013213300025446PeatlandFALALHKQPDNQPLQDDLQKLWSQMTQPERQLAIKLSQ
Ga0207692_1008619713300025898Corn, Switchgrass And Miscanthus RhizosphereTAYRWFALALRKDPENTSIHADLSKLWKEMTPAEQQLAIKLTQ
Ga0207692_1070973923300025898Corn, Switchgrass And Miscanthus RhizosphereRWFAVALRKDPSNEAIQNDLQKLWGEMTQPERQLAIKLTQ
Ga0207646_1163491123300025922Corn, Switchgrass And Miscanthus RhizosphereLPTAYRWFAMALRKDPNNQSVQADLQKLWSEMTQPERQLAIKLSQ
Ga0209890_1021899023300026291SoilPTAYRWFALALRKQPDNQSVQTDLKKLWGEMTQPERQLAMKLSQ
Ga0209577_1083235713300026552SoilPTAYRWFALALRKDPENQQLQDNLQRLWVQMTQPERQLAVKLSQ
Ga0208997_105742923300027181Forest SoilTPRDLPTAYRWFALALRKQPDNQPLQENLQRLWAQMTQPERQLAIKLSQ
Ga0208241_104877013300027297Forest SoilALHKEPDNQALQDDLQKLWSQMTQPERQLAIKLSQ
Ga0209421_109834213300027432Forest SoilMALHQQPDNQPVQNDLQDIWAKMTQPERQLAIKLSQ
Ga0209003_103175813300027576Forest SoilALRKQPDNQAVQADLQKLWREMTQPERQLAIKLSQ
Ga0209011_107481523300027678Forest SoilALALRKQPDNLPLQENLQRLWAQMTQPERQLAIKLSQ
Ga0209448_1016757023300027783Bog Forest SoilDLPTAYHWFALALRKQPNDQPLQQNMEKLWGRMTQPERQLAIRLSQ
Ga0209040_1018030133300027824Bog Forest SoilGTCAPRDLPTAYRWFALALHKEPDNQALQEDLQNLWGKMTPPERQLAIKLSQ
Ga0209060_1042289423300027826Surface SoilPRDLPTAYRWFALALHKDPDNQSVQTDLQKLWGEMTQPERQLAIRLSQ
Ga0209166_1046583713300027857Surface SoilLPTAYRWFALALRKEPDNVAVQGDLQKLWGEMTQPERQLAIRLTH
Ga0209167_1056948823300027867Surface SoilTPRDLPTAYRWFAMALRKDPSNDAVQTDLKKLWGEMTQPERQLAIKLTQ
Ga0209169_1018800513300027879SoilRDLPTAYRWFALALHQEPDNQALQDDLQRLWSQMTQPERQLAIKLSQ
Ga0209380_1010848613300027889SoilDLPTAYRWFALALHKEPDNQALQDDLQKLWSQMTQPERQLAIRLSQ
Ga0209380_1077448813300027889SoilALHQQPDNQPVQNDLQDIWAKMTQPERQLAIKLSQ
Ga0209624_1062848823300027895Forest SoilWFALALHKQPDNQPLQDDLQKLWNQMTQPERQLAIKLSQ
Ga0209415_1028049533300027905Peatlands SoilALRKDPDNQAVQTDLQKLWGEMTQPERQLAIKLSQ
Ga0209698_1003169813300027911WatershedsRDLPTAYRWFALALRKDPDNQAVQTDLKKLWGEMTQPERQLAIRLSQ
Ga0209168_1026068713300027986Surface SoilLPTAYRWFALALRKDPDNESVQTDLQKLWGEMTQPERQLAIKLSQ
Ga0209526_1078439523300028047Forest SoilPRDLPTAYRWFALALRKQPDNQPLQENLQRLWAQMTQPERQLAIKLSQ
Ga0302225_1056081513300028780PalsaALRKQPDDQPLQDNMKKLWGDMTQPERQLAIRLSQ
Ga0302222_1029122413300028798PalsaTPRDLPTAYRWFALALHKEPDNQALQDDLQRLWSRMTQPERQLAIRLSR
Ga0308309_1082031423300028906SoilRDLPTAYRWFALALHQEPDNQALQDDLQKLWSQMTQPERQLAIKLSQ
Ga0222749_1022422413300029636SoilYRWFALALHKQPDNQVLQDDLKSLWDKMTPPERQLAIKLSQ
Ga0311329_1023357313300029907BogWYALALHKQPDNQGLQDDLKKLWDKMTQPERQLAIKLSQ
Ga0302143_118267923300029918BogLPTAYRWFAQALHKQPDNQALQDDLKNLWEKMTPPERQLAIKLSH
Ga0311328_1043577923300029939BogDLPTAYRWFALALHREPENQALQQDLQKLWGQMTQPERQLAIKLSQ
Ga0311352_1092419623300029944PalsaRWFAQALHKDPDNNSLQTDLNKLWSEMTPPERQLAIKLSQ
Ga0302184_1016034733300030490PalsaPTAYRWYALALHKEPDNQTLQDDLQQLWSQMTPPERQLAIKLSQ
Ga0311355_1026817013300030580PalsaTPRDLPTAYRWFALALHKQPDNQALQDGLQKLWSQMTPPERQLAIKLSQ
Ga0311356_1130600313300030617PalsaWFALALHKEPDNQALQDDLQRLWSRMTQPERQLAIRLSR
Ga0265762_101455513300030760SoilHWFALALRKQPDDQPLQDNMKKLWGDMTQPERQLAIRLSQ
Ga0170834_10076880913300031057Forest SoilMALHKQPDNAALQDDLKKLWGQMTPPERQLAIRLSQ
Ga0265760_1016063323300031090SoilALHKDPDNQALQDDLQKLWSQKTQPERQLAIKLSQ
Ga0302326_1170223813300031525PalsaTAYRWFALALHKEPDNQALQQDLQKLWGQMTQPERQLAIKLSQ
Ga0310686_10117538533300031708SoilRWFAMALHKEPDNQALQDDLQKLWSKMTPPERQLAIKLSQ
Ga0310686_10419104023300031708SoilPTAYRWFALALRKDPENQAVQTDLKKLWGEMTQPERQLAIRLSQ
Ga0307476_1004700513300031715Hardwood Forest SoilPTAYRWFAMALRKDPENQAVQADLQKLWGEMTQPERQLAIRLSQ
Ga0307476_1005981353300031715Hardwood Forest SoilTPRDLPTAYRWFAMALHKQPDNSRLQDDLQKLWSQMTPPERQLAIKLSQ
Ga0307476_1030741413300031715Hardwood Forest SoilLPTAYRWFALALHKQPDNQALQDDLQKLWSRMTQPERQLAIKLSQ
Ga0307476_1128359113300031715Hardwood Forest SoilRDLPTAYRWFALALRKQPDNQPLQENLQRLWAQMTQPERQLAVKLSQ
Ga0307478_1122733023300031823Hardwood Forest SoilLPTAYRWFALALRKDPDNMAVQTDLQKLWGEMTQPERQLAIKMSQ
Ga0306921_1116976123300031912SoilPTAYRWFAIALRKDPENTSVQADLSKLWSEMTQPERQLAIKLTQ
Ga0307479_1038339813300031962Hardwood Forest SoilAYRWFAMALRKDPNNQSVQADLQKLWSEMTQPERQLAIKLSQ
Ga0307470_1037028813300032174Hardwood Forest SoilYRWFALALHKQPDNQALQDDLQKLWSRMTQPERQLAIKLSQ
Ga0335085_1225678013300032770SoilRWFAQALHKDPENEAIQQDLQKLWGEMTQPERQLAIKLSQ
Ga0335079_1017972313300032783SoilRWFAKALHKEPDNQSVQNDLQKLWGEMTQPERQLAIRLSQ
Ga0335078_1041819233300032805SoilAKALHKEPDNQSVQNDLQKLWGEMTQPERQLAIRLSQ
Ga0335080_1115126213300032828SoilTPHDLPSAYRWFALALRKDPGNQAIQTDLQKLWGEMTQPERQLAIKLTQ
Ga0370515_0167133_808_9393300034163Untreated Peat SoilTAYRWFALALHKEPENQALQDDLQKLWSQMTQPERQLAIKLSQ
Ga0370515_0427219_1_1113300034163Untreated Peat SoilLALHKEPDNQTLQDDLQQLWSQMTPPERQLAIKLSQ

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.