Basic Information | |
---|---|
Family ID | F056092 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 138 |
Average Sequence Length | 44 residues |
Representative Sequence | SAATEQQIASLGELTTTSQHLSVAAAKLSETIQRFNVNGKA |
Number of Associated Samples | 112 |
Number of Associated Scaffolds | 137 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.74 % |
% of genes near scaffold ends (potentially truncated) | 95.65 % |
% of genes from short scaffolds (< 2000 bps) | 78.99 % |
Associated GOLD sequencing projects | 102 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.61 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (77.536 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (27.536 % of family members) |
Environment Ontology (ENVO) | Unclassified (63.768 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (69.565 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 56.52% β-sheet: 0.00% Coil/Unstructured: 43.48% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.61 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 137 Family Scaffolds |
---|---|---|
PF02678 | Pirin | 15.33 |
PF01979 | Amidohydro_1 | 12.41 |
PF13442 | Cytochrome_CBB3 | 6.57 |
PF05726 | Pirin_C | 5.84 |
PF00210 | Ferritin | 4.38 |
PF00196 | GerE | 2.19 |
PF14417 | MEDS | 2.19 |
PF08281 | Sigma70_r4_2 | 1.46 |
PF04542 | Sigma70_r2 | 1.46 |
PF00135 | COesterase | 1.46 |
PF00033 | Cytochrome_B | 0.73 |
PF01292 | Ni_hydr_CYTB | 0.73 |
PF00174 | Oxidored_molyb | 0.73 |
PF00080 | Sod_Cu | 0.73 |
PF00005 | ABC_tran | 0.73 |
PF12102 | MrcB_N | 0.73 |
PF12704 | MacB_PCD | 0.73 |
PF00015 | MCPsignal | 0.73 |
PF03466 | LysR_substrate | 0.73 |
COG ID | Name | Functional Category | % Frequency in 137 Family Scaffolds |
---|---|---|---|
COG1741 | Redox-sensitive bicupin YhaK, pirin superfamily | General function prediction only [R] | 21.17 |
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 1.46 |
COG0840 | Methyl-accepting chemotaxis protein (MCP) | Signal transduction mechanisms [T] | 1.46 |
COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 1.46 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 1.46 |
COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 1.46 |
COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 1.46 |
COG1290 | Cytochrome b subunit of the bc complex | Energy production and conversion [C] | 0.73 |
COG1969 | Ni,Fe-hydrogenase I cytochrome b subunit | Energy production and conversion [C] | 0.73 |
COG2032 | Cu/Zn superoxide dismutase | Inorganic ion transport and metabolism [P] | 0.73 |
COG2041 | Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductases | Energy production and conversion [C] | 0.73 |
COG2864 | Cytochrome b subunit of formate dehydrogenase | Energy production and conversion [C] | 0.73 |
COG3038 | Cytochrome b561 | Energy production and conversion [C] | 0.73 |
COG3658 | Cytochrome b subunit of Ni2+-dependent hydrogenase | Energy production and conversion [C] | 0.73 |
COG3915 | Uncharacterized conserved protein | Function unknown [S] | 0.73 |
COG4117 | Thiosulfate reductase cytochrome b subunit | Inorganic ion transport and metabolism [P] | 0.73 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 77.54 % |
Unclassified | root | N/A | 22.46 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001661|JGI12053J15887_10060301 | All Organisms → cellular organisms → Bacteria | 2109 | Open in IMG/M |
3300002560|JGI25383J37093_10101897 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 837 | Open in IMG/M |
3300002560|JGI25383J37093_10101897 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 837 | Open in IMG/M |
3300002560|JGI25383J37093_10106233 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
3300002560|JGI25383J37093_10208958 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300002561|JGI25384J37096_10003048 | All Organisms → cellular organisms → Bacteria | 5884 | Open in IMG/M |
3300002562|JGI25382J37095_10004128 | All Organisms → cellular organisms → Bacteria | 4996 | Open in IMG/M |
3300002562|JGI25382J37095_10272330 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300005171|Ga0066677_10567880 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
3300005172|Ga0066683_10452139 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 787 | Open in IMG/M |
3300005174|Ga0066680_10061978 | All Organisms → cellular organisms → Bacteria | 2223 | Open in IMG/M |
3300005174|Ga0066680_10265552 | All Organisms → cellular organisms → Bacteria | 1092 | Open in IMG/M |
3300005177|Ga0066690_10122147 | All Organisms → cellular organisms → Bacteria | 1692 | Open in IMG/M |
3300005178|Ga0066688_10516417 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
3300005178|Ga0066688_11026920 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300005179|Ga0066684_10362604 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 970 | Open in IMG/M |
3300005179|Ga0066684_11109809 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 505 | Open in IMG/M |
3300005180|Ga0066685_10090983 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2026 | Open in IMG/M |
3300005180|Ga0066685_11008615 | Not Available | 549 | Open in IMG/M |
3300005186|Ga0066676_11065314 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300005187|Ga0066675_10531009 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
3300005440|Ga0070705_101300926 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300005444|Ga0070694_101906883 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300005446|Ga0066686_10725415 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
3300005536|Ga0070697_100036996 | All Organisms → cellular organisms → Bacteria | 3943 | Open in IMG/M |
3300005553|Ga0066695_10783568 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300005554|Ga0066661_10935922 | Not Available | 507 | Open in IMG/M |
3300005558|Ga0066698_10465098 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
3300005560|Ga0066670_10161832 | All Organisms → cellular organisms → Bacteria | 1317 | Open in IMG/M |
3300005574|Ga0066694_10578715 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 523 | Open in IMG/M |
3300005586|Ga0066691_10599112 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
3300005586|Ga0066691_10818090 | Not Available | 549 | Open in IMG/M |
3300005587|Ga0066654_10531277 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
3300005598|Ga0066706_10124462 | All Organisms → cellular organisms → Bacteria | 1907 | Open in IMG/M |
3300006031|Ga0066651_10051829 | All Organisms → cellular organisms → Bacteria | 1923 | Open in IMG/M |
3300006163|Ga0070715_10872185 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300006796|Ga0066665_11426703 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300006796|Ga0066665_11681149 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300006797|Ga0066659_11210194 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
3300006804|Ga0079221_10059346 | All Organisms → cellular organisms → Bacteria | 1746 | Open in IMG/M |
3300006847|Ga0075431_101107784 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
3300006854|Ga0075425_100084501 | All Organisms → cellular organisms → Bacteria | 3592 | Open in IMG/M |
3300006914|Ga0075436_100047486 | All Organisms → cellular organisms → Bacteria | 2961 | Open in IMG/M |
3300009012|Ga0066710_102309427 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 782 | Open in IMG/M |
3300009012|Ga0066710_104797501 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_2_20CM_70_9 | 506 | Open in IMG/M |
3300009038|Ga0099829_10103710 | Not Available | 2216 | Open in IMG/M |
3300009089|Ga0099828_11996129 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 507 | Open in IMG/M |
3300009089|Ga0099828_12000882 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 507 | Open in IMG/M |
3300009090|Ga0099827_10043361 | All Organisms → cellular organisms → Bacteria | 3342 | Open in IMG/M |
3300009137|Ga0066709_102996915 | Not Available | 620 | Open in IMG/M |
3300009143|Ga0099792_10852515 | Not Available | 600 | Open in IMG/M |
3300009147|Ga0114129_11913343 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
3300010085|Ga0127445_1045427 | Not Available | 747 | Open in IMG/M |
3300010117|Ga0127449_1114416 | Not Available | 570 | Open in IMG/M |
3300010124|Ga0127498_1154784 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300010301|Ga0134070_10022135 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2073 | Open in IMG/M |
3300010304|Ga0134088_10027446 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2552 | Open in IMG/M |
3300010304|Ga0134088_10364828 | Not Available | 702 | Open in IMG/M |
3300010320|Ga0134109_10385959 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
3300010321|Ga0134067_10068554 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1170 | Open in IMG/M |
3300010321|Ga0134067_10300324 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 619 | Open in IMG/M |
3300010335|Ga0134063_10003826 | All Organisms → cellular organisms → Bacteria | 5471 | Open in IMG/M |
3300010335|Ga0134063_10012889 | All Organisms → cellular organisms → Bacteria | 3315 | Open in IMG/M |
3300010335|Ga0134063_10519782 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 598 | Open in IMG/M |
3300010336|Ga0134071_10048246 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1924 | Open in IMG/M |
3300010336|Ga0134071_10052387 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1854 | Open in IMG/M |
3300010364|Ga0134066_10138327 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 752 | Open in IMG/M |
3300010396|Ga0134126_10838341 | Not Available | 1037 | Open in IMG/M |
3300011269|Ga0137392_10119114 | Not Available | 2103 | Open in IMG/M |
3300011270|Ga0137391_10475668 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1060 | Open in IMG/M |
3300011414|Ga0137442_1130660 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300012199|Ga0137383_11029328 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 599 | Open in IMG/M |
3300012201|Ga0137365_10092006 | All Organisms → cellular organisms → Bacteria | 2284 | Open in IMG/M |
3300012201|Ga0137365_10579040 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 823 | Open in IMG/M |
3300012203|Ga0137399_11650535 | Not Available | 529 | Open in IMG/M |
3300012204|Ga0137374_11099840 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 566 | Open in IMG/M |
3300012349|Ga0137387_10089120 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2134 | Open in IMG/M |
3300012353|Ga0137367_10602145 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 769 | Open in IMG/M |
3300012357|Ga0137384_10789138 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 768 | Open in IMG/M |
3300012359|Ga0137385_11560010 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 524 | Open in IMG/M |
3300012360|Ga0137375_10517926 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1011 | Open in IMG/M |
3300012362|Ga0137361_11521279 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 591 | Open in IMG/M |
3300012363|Ga0137390_10478445 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1220 | Open in IMG/M |
3300012376|Ga0134032_1131932 | Not Available | 634 | Open in IMG/M |
3300012407|Ga0134050_1377285 | Not Available | 611 | Open in IMG/M |
3300012685|Ga0137397_10835479 | Not Available | 683 | Open in IMG/M |
3300012917|Ga0137395_10992054 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
3300012918|Ga0137396_10088552 | All Organisms → cellular organisms → Bacteria | 2193 | Open in IMG/M |
3300012922|Ga0137394_10144308 | Not Available | 2023 | Open in IMG/M |
3300012925|Ga0137419_10488156 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
3300012929|Ga0137404_10814773 | Not Available | 848 | Open in IMG/M |
3300012930|Ga0137407_11192747 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
3300012972|Ga0134077_10479341 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 548 | Open in IMG/M |
3300012976|Ga0134076_10479519 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300014154|Ga0134075_10175673 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
3300014154|Ga0134075_10301071 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 698 | Open in IMG/M |
3300014157|Ga0134078_10502980 | Not Available | 564 | Open in IMG/M |
3300015359|Ga0134085_10396420 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 619 | Open in IMG/M |
3300017656|Ga0134112_10035352 | All Organisms → cellular organisms → Bacteria | 1774 | Open in IMG/M |
3300017656|Ga0134112_10068795 | Not Available | 1303 | Open in IMG/M |
3300017656|Ga0134112_10110440 | Not Available | 1038 | Open in IMG/M |
3300017657|Ga0134074_1029045 | All Organisms → cellular organisms → Bacteria | 1842 | Open in IMG/M |
3300018431|Ga0066655_10724878 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
3300018433|Ga0066667_10844370 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
3300018468|Ga0066662_10781836 | Not Available | 923 | Open in IMG/M |
3300018482|Ga0066669_11614356 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
3300018482|Ga0066669_12032805 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
3300025905|Ga0207685_10248550 | Not Available | 859 | Open in IMG/M |
3300025905|Ga0207685_10367066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 730 | Open in IMG/M |
3300026277|Ga0209350_1034270 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1506 | Open in IMG/M |
3300026296|Ga0209235_1000208 | All Organisms → cellular organisms → Bacteria | 28233 | Open in IMG/M |
3300026296|Ga0209235_1208294 | Not Available | 656 | Open in IMG/M |
3300026296|Ga0209235_1259946 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 534 | Open in IMG/M |
3300026297|Ga0209237_1159638 | Not Available | 847 | Open in IMG/M |
3300026301|Ga0209238_1017369 | All Organisms → cellular organisms → Bacteria | 2772 | Open in IMG/M |
3300026313|Ga0209761_1152290 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1089 | Open in IMG/M |
3300026317|Ga0209154_1286222 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300026318|Ga0209471_1010597 | All Organisms → cellular organisms → Bacteria | 4825 | Open in IMG/M |
3300026324|Ga0209470_1020713 | All Organisms → cellular organisms → Bacteria | 3556 | Open in IMG/M |
3300026325|Ga0209152_10239014 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 676 | Open in IMG/M |
3300026330|Ga0209473_1004939 | All Organisms → cellular organisms → Bacteria | 7067 | Open in IMG/M |
3300026331|Ga0209267_1005004 | All Organisms → cellular organisms → Bacteria | 7950 | Open in IMG/M |
3300026334|Ga0209377_1256014 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300026538|Ga0209056_10007563 | All Organisms → cellular organisms → Bacteria | 11183 | Open in IMG/M |
3300026540|Ga0209376_1094479 | All Organisms → cellular organisms → Bacteria | 1549 | Open in IMG/M |
3300026542|Ga0209805_1112263 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1294 | Open in IMG/M |
3300027181|Ga0208997_1065332 | Not Available | 544 | Open in IMG/M |
3300027383|Ga0209213_1042325 | Not Available | 861 | Open in IMG/M |
3300027882|Ga0209590_10803988 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 597 | Open in IMG/M |
3300027886|Ga0209486_10921804 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
3300028065|Ga0247685_1042273 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 560 | Open in IMG/M |
3300028536|Ga0137415_10400200 | Not Available | 1177 | Open in IMG/M |
3300031152|Ga0307501_10037021 | Not Available | 1032 | Open in IMG/M |
3300031720|Ga0307469_11028966 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 770 | Open in IMG/M |
3300031962|Ga0307479_12091194 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 27.54% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 20.29% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 20.29% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 15.94% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.35% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.90% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.17% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.45% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.45% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.72% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.72% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.72% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.72% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.72% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300010085 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010117 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010124 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011414 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT266_2 | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012376 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012407 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
3300027181 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027383 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
3300028065 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK26 | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12053J15887_100603011 | 3300001661 | Forest Soil | AQGAEQTSAATEEQIASLGELTTTSQHLSVAAAKLTETIQRFNVNGKG* |
JGI25383J37093_101018972 | 3300002560 | Grasslands Soil | VAGIADSAAHGAEQTSGATELQIASLGDLTTTEQHLSVAAAKLTETIQRFTVDGKA* |
JGI25383J37093_101018973 | 3300002560 | Grasslands Soil | LGELTTTSQQLSVAAARLTETIQRFNVNGAKLPPRNSPASP* |
JGI25383J37093_101062331 | 3300002560 | Grasslands Soil | AATEQQIASLGELTMTSQHLSVAAAKLSETIQRFNVNGKA* |
JGI25383J37093_102089582 | 3300002560 | Grasslands Soil | SAAQGAEQTSAATAEQIASLDELTTTSQQLSAAATKLTETIQRFNVNGKA* |
JGI25384J37096_100030484 | 3300002561 | Grasslands Soil | MEEVAGIADSAAHGAEQTSGATELQIASLGDLTTTEQHLSVAAAKLTETIQRFTVDGKA* |
JGI25382J37095_100041281 | 3300002562 | Grasslands Soil | QGAEQTSAATEEQIASLGELTTTSQHLSVAAAKLTETIQRFNVNGKA* |
JGI25382J37095_102723301 | 3300002562 | Grasslands Soil | TGARQTSAATAQQIASLGELTTTSQHLSDAAATLSQTIRRFRVKGNGL* |
Ga0066677_105678802 | 3300005171 | Soil | EVAGIADSAAQGAEQTSAVTEQQIASLGELTTTSQHLSVAAARLTETMQRFTLNGKA* |
Ga0066683_104521393 | 3300005172 | Soil | ATEQQIASLSELTTTTQHLSVAAAKLTETIERFNVNGKAGRSA* |
Ga0066680_100619783 | 3300005174 | Soil | AATEEQIASLGELTTTSQHLSVAAAKLTETIQRFRVNGKS* |
Ga0066680_102655521 | 3300005174 | Soil | AATEQQIASLSELTTTTQHLSVAAAKLTETIERFNVNGKE* |
Ga0066690_101221473 | 3300005177 | Soil | AAQGAEQTSAATEQQIASLGELTTTSQHLSVAAARLTETMQRFNVNGKA* |
Ga0066688_105164171 | 3300005178 | Soil | AETAAQGAERTSAATEQQIASLGELTTTSQQLAVAAAKLTETIQQFNVNGASLPTPE* |
Ga0066688_110269202 | 3300005178 | Soil | AATAQQIAALDELTTTSQQLSAAAAKLTETIQRFVVNGKA* |
Ga0066684_103626041 | 3300005179 | Soil | ERQIASLGELTTTSQQLAVAAARLTETMQRFNVNGASLPAPE* |
Ga0066684_111098091 | 3300005179 | Soil | ERQIASLGELTTTSQQLAVAAARLTETMQRFNVNGASLPASE* |
Ga0066685_100909833 | 3300005180 | Soil | TAAQGAEQTSAATEEQIASLGELTTTSQHLSVAAAKLTETIRRFTVNGKP* |
Ga0066685_110086152 | 3300005180 | Soil | AATEQQIASLSELTTTTQHLSVAAAKLTETIERFNVNGKAGRSA* |
Ga0066676_110653141 | 3300005186 | Soil | AEQTSAATEEQIASLGELTTTSQHLSVAAAKLTETIQRFNVNGKA* |
Ga0066675_105310092 | 3300005187 | Soil | ATEQQIASLGELTTTSQQLAVAAAKLTETIQQFNVNGASLPTPE* |
Ga0070705_1013009261 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | GAQQTSAATEEQIASLGELTATSQHLSNAAAKLTQTIQRFTVNGAGASH* |
Ga0070694_1019068831 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | SAATSEQIASLGELTATSQHLSNAAAKLAETIQRFTVNGAGGPVH* |
Ga0066686_107254153 | 3300005446 | Soil | AATEQQIASLSELTTTTQHLSVAAAKLTETIERFNVNGKA* |
Ga0070697_1000369965 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | AAQGAEQTSAATEEQIASLGELTTTSQHLSVAAAKLTETIQRFNVNGKG* |
Ga0066695_107835681 | 3300005553 | Soil | QQTSAATAQQIVSLSELTTTSQQLSDAAAALARTIQRFRSD* |
Ga0066661_109359221 | 3300005554 | Soil | FGELTTTSQHLSVAAAKLSETIQRFHVNGEGSDSPAPQ* |
Ga0066707_100064861 | 3300005556 | Soil | SLGELTTTSQHLSVAAARLTETMQRFNVNGLATARGR* |
Ga0066698_104650981 | 3300005558 | Soil | TAAQGAEQTSAATEQQIASLGELTMTSQHLSVAAAKLSETIQRFNVNGKA* |
Ga0066700_105153512 | 3300005559 | Soil | AGIAETAAQGAEQTSAATAQQIASLSELTTTTQHLSVAAAKLTETIEHFTVNGKA* |
Ga0066670_101618323 | 3300005560 | Soil | AERTSAATEQQIASLGELTTTSQQLAVAAAKLTETIQQFNVNGASLPTPE* |
Ga0066694_105787152 | 3300005574 | Soil | QIASLGELTTTSQQLAVAAAKLTETIQQFNVNGASLPTPE* |
Ga0066691_105991122 | 3300005586 | Soil | SSFGELTTTSQHLSVAAAKLSETIQRFHVNGEGAASPPVQ* |
Ga0066691_108180902 | 3300005586 | Soil | QQIASLGELTTTSQHLSVAAAKLTETTQRFNVNGTA* |
Ga0066654_105312772 | 3300005587 | Soil | QMEEVAGIADSAAQGAEQTSAVTEQQIASLGELTTTSQHLSVAAARLTETMQRFTLNGKA |
Ga0066706_101244621 | 3300005598 | Soil | AERTSAATEQQIASLGELTTTSQQLAVAAAKLTQTIHQFNVNGASLPTPE* |
Ga0066651_100518293 | 3300006031 | Soil | TAQQIASLNALTATSQHISDAAATLSETIQRFRA* |
Ga0070715_108721852 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | ETAAQGAEQTSAATEQQIASLSELTTTSQHLSVAAAKLSETIQRFNVNGKA* |
Ga0066665_114267032 | 3300006796 | Soil | SAATEQQIASLSELTTTTQHLSVAAAKLTETIERFNVNGKA* |
Ga0066665_116811493 | 3300006796 | Soil | AATEQQIASLGELTTTSQHLSVAAARLTETMQRFTVNGKA* |
Ga0066659_112101941 | 3300006797 | Soil | GAQRTSAATEQQIASLGELTTTSQQLAVAAAKLPETIQQFNVNGASLPTPE* |
Ga0079221_100593463 | 3300006804 | Agricultural Soil | QQIASLGELSMTSQHLSVAAAKLSETIQRFNVNGKA* |
Ga0075431_1011077842 | 3300006847 | Populus Rhizosphere | QIASLGELTTTSQHLSTAASTLTETIQRFNVNGSR* |
Ga0075425_1000845015 | 3300006854 | Populus Rhizosphere | TSAATAKQMSSLNDLTTTSQHLSDAAAALSETIQRFRA* |
Ga0075436_1000474861 | 3300006914 | Populus Rhizosphere | EQASAATQQQIASLGELTTTSQQLSVAAAKLSETIQRFSVNGGSSPPTR* |
Ga0066710_1023094273 | 3300009012 | Grasslands Soil | SAATEQQIASLSELTTTTQHLSVAAAKLTETIERFNVNGKA |
Ga0066710_1047975012 | 3300009012 | Grasslands Soil | EQTSAATEQQIASLSELTTTTQHLSVAVAKLTETIERFNVNGKA |
Ga0099829_101037101 | 3300009038 | Vadose Zone Soil | QGAEQTSAATQQQIASLGELTTTSQHLSVAAAKLSETIQRFNVNGKA* |
Ga0099828_119961292 | 3300009089 | Vadose Zone Soil | AQGAQQTTAATQQQIASLGELTATSQHLSVAAAKLTETIQRFTVNGKSKP* |
Ga0099828_120008822 | 3300009089 | Vadose Zone Soil | AQGAQQTTAATQQQIASLGELTATSQHLSVAAAKLTETIQRFTVNGKSGP* |
Ga0099827_100433611 | 3300009090 | Vadose Zone Soil | TEEQIASLSELTTTSQHLSVAAAKLTETIQRFRVNGKS* |
Ga0066709_1029969153 | 3300009137 | Grasslands Soil | QASAATAEQIASLGELTATSQHLSVAAAKLTETIRRFNVDGRA* |
Ga0099792_108525151 | 3300009143 | Vadose Zone Soil | SAATEQQIASLGELTMTSQHLSVAAAKLTETIQRFNVNGKA* |
Ga0114129_119133431 | 3300009147 | Populus Rhizosphere | AAQGAEQTSAATEQQIASLGELTTTSQHLSVAAAQLSETIQRFNVNGKA* |
Ga0127445_10454271 | 3300010085 | Grasslands Soil | IASLGELTMTSQHLSVAAAKLSETIQRFNVNGKA* |
Ga0127449_11144162 | 3300010117 | Grasslands Soil | AEQTSAATEQQIASLGELTMTSQHLSVAAAKLSETIQRFNVNGKA* |
Ga0127498_11547841 | 3300010124 | Grasslands Soil | EEQIASLGELTTTSQHLSVAAAKLTETIQRFRVNGKS* |
Ga0134070_100221351 | 3300010301 | Grasslands Soil | TAQQIASLSELTTTSEHLSDAAATLSVTIQRFRIKANGG* |
Ga0134088_100274464 | 3300010304 | Grasslands Soil | GAEQTSAATEQQIASLSELTTTTQHLSVAAAKLTETIERFNVNGKA* |
Ga0134088_103648281 | 3300010304 | Grasslands Soil | QQIASLSELTTTTQHLSVAAAKLTETIERFNVNGKAGRSA* |
Ga0134088_105545401 | 3300010304 | Grasslands Soil | EQQIASLGELTTTSQHLSVAAARLTETMQRFNVNGLATARGR* |
Ga0134109_103859592 | 3300010320 | Grasslands Soil | AATEEQIASLSELTTTSQHLSVAAAKLTETIQRFRVNGKS* |
Ga0134067_100685543 | 3300010321 | Grasslands Soil | IASLGELTTTSQQLAVAAARLTETMQRFNVNGASLPAPE* |
Ga0134067_103003241 | 3300010321 | Grasslands Soil | QGAEQTSAATERQIASLGELSTTSQQLAVAAAKLIETIQHFNVNGASLPAAE* |
Ga0134063_100038267 | 3300010335 | Grasslands Soil | IASLGELTTTSQHLSVAAARLTETIQRFNVNGKA* |
Ga0134063_100128895 | 3300010335 | Grasslands Soil | QQIASLGQLTTTSQHLSVAAAKLTETIQRFHVNGKA* |
Ga0134063_105197821 | 3300010335 | Grasslands Soil | HGAEQTSAATEQQIASLGELTTTSQQLAVAAARLTETIQRFNVDGAKLPPPQ* |
Ga0134071_100482461 | 3300010336 | Grasslands Soil | ASLSELTTTTQHLSVAAAKLTETIERFNVNGKAGRSA* |
Ga0134071_100523873 | 3300010336 | Grasslands Soil | AQQIASLSELTSTSQRLSDAATVLAQTIKRFRISGNGGGAP* |
Ga0134066_101383271 | 3300010364 | Grasslands Soil | VCSAPCIAETAAQGAEQTSAATERQIASLGELTTTSQQLAVAAAKLTETIQQFNVNGASLPTPE* |
Ga0134126_108383412 | 3300010396 | Terrestrial Soil | GAEQTSAATEQQIASLSELTTTSQHLSVAAAKLSETIQRFNVNGKA* |
Ga0137392_101191141 | 3300011269 | Vadose Zone Soil | QTSAATQQQIASLGELTTTSQHLSVAAAKLSETIQRFNVNGKA* |
Ga0137391_104756681 | 3300011270 | Vadose Zone Soil | QIASLGELTTTSQHLAVAAAKLAQTIQRFSANGGRLPPPQ* |
Ga0137442_11306601 | 3300011414 | Soil | TEEQIASLGELTATSQHLSVAASKLAQTIKRFTVNGAGPGAKH* |
Ga0137383_110293282 | 3300012199 | Vadose Zone Soil | QTSAATAQQILSLNELTTTSQHLSDAAAALSETIQRFRA* |
Ga0137365_100920063 | 3300012201 | Vadose Zone Soil | AEQTSAATEQQIAALGELTTTSQQLSVAAARLTETIQRFNVDGRT* |
Ga0137365_105790401 | 3300012201 | Vadose Zone Soil | AEQTSAATEQQIAALGELTTTSQQLSVAAARLTETIQRFNVNGAKLPPPK* |
Ga0137399_116505352 | 3300012203 | Vadose Zone Soil | AATEQQIASLSELTTTSQHLSVAAAKLTETIQRFNVSGKA* |
Ga0137374_110998402 | 3300012204 | Vadose Zone Soil | EQASAATEQQIASLGELTTTSQHLSVAAAKLTETIQRFNVNGKE* |
Ga0137387_100891202 | 3300012349 | Vadose Zone Soil | AAHGAEQTSAATEQQIASLGELTTTSQHLSVAAAKLSETIQRFNVNGKA* |
Ga0137367_106021451 | 3300012353 | Vadose Zone Soil | AAQGAEQASAATQEQIASLGELTATSQHLSVAAAKLTETIQRFHVNGTA* |
Ga0137384_107891382 | 3300012357 | Vadose Zone Soil | AEQTSAATEQQIASLGELTTTSQHLSVAAAKLTETIQRFKVNGKA* |
Ga0137385_115600101 | 3300012359 | Vadose Zone Soil | SAATEQQIASLGELTTTSQHLSVAAAKLSETIQRFNVNGKA* |
Ga0137375_105179261 | 3300012360 | Vadose Zone Soil | EQIASLGELTATSQHLSVAAAKLTETIQRFNVNGTA* |
Ga0137361_115212792 | 3300012362 | Vadose Zone Soil | AQQIASLSELTTTSQHLSDAAATLTETIRRFRINGKSG* |
Ga0137390_104784453 | 3300012363 | Vadose Zone Soil | AATEQQIASLGELTTTSQHLAVAAAKLAQTIQRFSANGGRLPPPQ* |
Ga0134032_11319321 | 3300012376 | Grasslands Soil | EQIASLGELTTTSQHLSVAAAKLTETIQRFNVNGKA* |
Ga0134050_13772851 | 3300012407 | Grasslands Soil | QQIASLGELTMTSQHLAVAAAKLSETIQRFNVNGKA* |
Ga0137397_108354792 | 3300012685 | Vadose Zone Soil | QIASLSELTTTSQHLSVAAAKLSETIQRFNVNGKT* |
Ga0137395_109920541 | 3300012917 | Vadose Zone Soil | AATERQIASLGELTAVSQQLSATATALTETIRRFRTNGAA* |
Ga0137396_100885521 | 3300012918 | Vadose Zone Soil | AATAEQIASLDELSTTSQHLSTAAAKLTETIQRFVVNGKT* |
Ga0137394_101443084 | 3300012922 | Vadose Zone Soil | QIASLSELTTTSQHLSVAAAKLTETIQRFNVNGKT* |
Ga0137419_104881561 | 3300012925 | Vadose Zone Soil | TATEGAQQTSAATEEQIASLGELTTTSQHLSVAAAKLTETIQRFRVNGKS* |
Ga0137404_108147731 | 3300012929 | Vadose Zone Soil | ETAAQGAEQTSAATEQQIASLGELTTTSQHLSVAAAKLSETIQRFNVNGKV* |
Ga0137407_111927471 | 3300012930 | Vadose Zone Soil | HIAAGAADGAQQTSAATQEQIASLGELTATSQHLSNAAAKLAQTIQRFTVNGAGASH* |
Ga0134077_104793411 | 3300012972 | Grasslands Soil | IASLGELTTTTQHLSVAAAKLTETIERFNVNGKAGRSA* |
Ga0134076_104795191 | 3300012976 | Grasslands Soil | ATAQQIASLSELTSTSQRLSDAATVLAQTIKRFRISGNGGGAP* |
Ga0134075_101756731 | 3300014154 | Grasslands Soil | GAEQASAATAQQIAALDELTTTSQHLSAAAAKLTETIQQFVVNGKA* |
Ga0134075_103010712 | 3300014154 | Grasslands Soil | SAATEQQIASLAQLTTTSQQLSVAAAKLAQTIQRFNVNGGSSPAPQ* |
Ga0134078_105029802 | 3300014157 | Grasslands Soil | AAQGAEQTSAATEQQIASLGEFTTTSQHLSVAAAKLIETIQLFNVNGKA* |
Ga0134085_103964201 | 3300015359 | Grasslands Soil | ASAATAEQITSLGELTATSRHLSVGAAQLAETIRPFNVDGRA* |
Ga0134112_100353523 | 3300017656 | Grasslands Soil | LGELTTTTQHLSVAAAKLTETIQRFNVDGAKSPPSQ |
Ga0134112_100687953 | 3300017656 | Grasslands Soil | SAATEQQIASLGELTTTSQHLSVAAAKLSETIQRFNVNGKA |
Ga0134112_101104402 | 3300017656 | Grasslands Soil | AATQQQIASLGELTTTSQQLSVAAAKLSETIQRFNLNGKA |
Ga0134074_10290451 | 3300017657 | Grasslands Soil | ASLSDLTTTSQHLSDAAATLSQTIQRFRVSGNGLPASE |
Ga0066655_107248782 | 3300018431 | Grasslands Soil | ATAQQIAALDELTTTSQHLSAAAAKLTETIQRFVVNGKA |
Ga0066667_108443701 | 3300018433 | Grasslands Soil | CGSIGELTTTPQHLSVAAAKLSKTIQRCHVNGEGSDSPAPQ |
Ga0066662_107818361 | 3300018468 | Grasslands Soil | TEEQIASLGELTTTSHHLSVAAAKLTETIQRFTVNGKA |
Ga0066669_116143561 | 3300018482 | Grasslands Soil | AATAQQIASLIELTATSEHLSDAAATLSETIQRFRA |
Ga0066669_120328051 | 3300018482 | Grasslands Soil | ATEQQIASLGELTTTSQQLAVAAAKLTETIQQFNVNGASLPTPE |
Ga0207685_102485502 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | ETAAQGAEQTSAATEQQIASLSELTTTSQHLSVAAAKLSETIQRFNVNGKA |
Ga0207685_103670662 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | GAEQTSAATEQQIASLGELTMTSQHLSVAAAKLSETIQRFHVNGKA |
Ga0209350_10342703 | 3300026277 | Grasslands Soil | AEQTSAATEQQIASLSELTTTTQHLSVAAAKLTETIERFNVNGKE |
Ga0209235_10002083 | 3300026296 | Grasslands Soil | MEEVAGIADSAAHGAEQTSGATELQIASLGDLTTTEQHLSVAAAKLTETIQRFTVDGKA |
Ga0209235_12082941 | 3300026296 | Grasslands Soil | QTSAATEQQIASLSELTTTTQHLSVAAAKLTETIERFNVNGKA |
Ga0209235_12599461 | 3300026296 | Grasslands Soil | AHGAEQTSAATEQQIASLGQLTTTSQHLSVAAAKLTETIQRFHVNGAKLPPPK |
Ga0209237_11596382 | 3300026297 | Grasslands Soil | QQIASLGELTTTSQHLSVAAAKLTETIQRFNVNGKA |
Ga0209238_10173691 | 3300026301 | Grasslands Soil | QIASLGELTTTSQHLSVAAARLTETMQRFTLNGKA |
Ga0209761_11522901 | 3300026313 | Grasslands Soil | QTSAATEQQIASLSELTTTTQHLSVAAAKLTETIERFNVNGKE |
Ga0209154_12862221 | 3300026317 | Soil | EQTSAATAEQIASLDELTTTSQQLSAAATKLTETIQRFNVNGKA |
Ga0209471_10105971 | 3300026318 | Soil | TAQQIASLDELTTTSRHLSAAATKLTETIQRFVVNGKA |
Ga0209470_10207131 | 3300026324 | Soil | TEQQIASLGELTMTSQHLSVAAAKLSETIQRFNVNGKA |
Ga0209152_102390141 | 3300026325 | Soil | QRQIASLGELSTTSQQLAVAAAKLSETIERFNVNGASLPASE |
Ga0209473_10049391 | 3300026330 | Soil | SAATEEQIASLGELTTTSQHLSVAAAKLTETIQRFNVNGKA |
Ga0209267_100500410 | 3300026331 | Soil | ASLGELTTTSQQLAVAAAKLTETIQQFNVNGASLPTPE |
Ga0209377_12560141 | 3300026334 | Soil | AAQGAEQTSAATEQQIASLGELTTTSQHLSVAAARLTETIQRFTVNGKA |
Ga0209056_1000756312 | 3300026538 | Soil | AEQTSAATEQQIASLGELTTTSQHLSVAAARLTETMQRFNVNGLATARGR |
Ga0209376_10944793 | 3300026540 | Soil | TAAQGAEQTSAATEQQIASLGELTMTSQHLSVAAAKLSETIQRFNVNGKA |
Ga0209805_11122633 | 3300026542 | Soil | VRRMDEAAGIAETAAQGAEQTSAATERQIVSLGELSTTSQQLAVAAAKLIETIQHFNVNGASLPAAE |
Ga0208997_10653322 | 3300027181 | Forest Soil | DTAAQGAEQTSAATEEQIASLGELTTTSQHLSVAAAKLTETIQRFNVNGKG |
Ga0209213_10423252 | 3300027383 | Forest Soil | EQIASLSELTTTSQHLSVAAAKLTETIQRFNVNGKG |
Ga0209590_108039881 | 3300027882 | Vadose Zone Soil | EQTSAATEQQIASLSELTATSQQLSVAAAKLTDTIQRFNVNGKA |
Ga0209486_109218042 | 3300027886 | Agricultural Soil | MEEVAGIADGAAQGAEQASTATQQQIASLGELATTSRHLSAAAAKLTETIQRLNVDGKV |
Ga0247685_10422732 | 3300028065 | Soil | EQASAATQQQIASLGELTTTSQQLSVAAAKLSETIQRFSVNGSSSPPTS |
Ga0137415_104002002 | 3300028536 | Vadose Zone Soil | TEQQIASLSELTTTSQHLSVAAAKLSETIQRFNVNGKG |
Ga0307501_100370212 | 3300031152 | Soil | TEEQIASLGELTTTSQHLSVAAAKLTETIRRFNVNGKG |
Ga0307469_110289662 | 3300031720 | Hardwood Forest Soil | QQIASLGELTTTSQQLSVAAAKLSETIQRFNVNGSSSPPPR |
Ga0307479_120911942 | 3300031962 | Hardwood Forest Soil | VATEQQIASLGELTTTSQQLAVAAAKLIETMQRFNVNGASLPASQ |
⦗Top⦘ |