Metagenome / Metatranscriptome Family F056732

Basic Information
Family ID	F056732
Family Type	Metagenome / Metatranscriptome
Number of Sequences	137
Average Sequence Length	40 residues
Representative Sequence	MFESIVCFGLHIRHPRVHVPAFPDSYLPGVNSITESRTVYL
Number of Associated Samples	97
Number of Associated Scaffolds	137

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	62.77 %
% of genes near scaffold ends (potentially truncated)	79.56 %
% of genes from short scaffolds (< 2000 bps)	86.86 %
Associated GOLD sequencing projects	90
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.15

Most Common Taxonomy
Group	Bacteria (57.664 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (24.088 % of family members)
Environment Ontology (ENVO)	Unclassified (24.088 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (52.555 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 10.14% β-sheet: 0.00% Coil/Unstructured: 89.86%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 137 Family Scaffolds
PF01548	DEDD_Tnp_IS110	24.82
PF02371	Transposase_20	13.87
PF04392	ABC_sub_bind	1.46
PF14362	DUF4407	1.46
PF13565	HTH_32	1.46
PF01609	DDE_Tnp_1	1.46
PF11746	DUF3303	0.73
PF00795	CN_hydrolase	0.73
PF00583	Acetyltransf_1	0.73
PF13592	HTH_33	0.73
PF11578	DUF3237	0.73
PF00383	dCMP_cyt_deam_1	0.73
PF02771	Acyl-CoA_dh_N	0.73
PF06042	NTP_transf_6	0.73
PF14319	Zn_Tnp_IS91	0.73
PF00872	Transposase_mut	0.73
PF03069	FmdA_AmdA	0.73
PF01408	GFO_IDH_MocA	0.73
PF09707	Cas_Cas2CT1978	0.73
PF13808	DDE_Tnp_1_assoc	0.73
PF13613	HTH_Tnp_4	0.73
PF13546	DDE_5	0.73
PF13650	Asp_protease_2	0.73
PF02452	PemK_toxin	0.73
PF02518	HATPase_c	0.73
PF09339	HTH_IclR	0.73
PF13924	Lipocalin_5	0.73
PF05685	Uma2	0.73
PF03061	4HBT	0.73

COG ID	Name	Functional Category	% Frequency in 137 Family Scaffolds
COG3547	Transposase	Mobilome: prophages, transposons [X]	38.69
COG2984	ABC-type uncharacterized transport system, periplasmic component	General function prediction only [R]	1.46
COG3039	Transposase and inactivated derivatives, IS5 family	Mobilome: prophages, transposons [X]	1.46
COG3293	Transposase	Mobilome: prophages, transposons [X]	1.46
COG3385	IS4 transposase InsG	Mobilome: prophages, transposons [X]	1.46
COG5421	Transposase	Mobilome: prophages, transposons [X]	1.46
COG5433	Predicted transposase YbfD/YdcC associated with H repeats	Mobilome: prophages, transposons [X]	1.46
COG5659	SRSO17 transposase	Mobilome: prophages, transposons [X]	1.46
COG1960	Acyl-CoA dehydrogenase related to the alkylation response protein AidB	Lipid transport and metabolism [I]	0.73
COG2337	mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module	Defense mechanisms [V]	0.73
COG2421	Acetamidase/formamidase	Energy production and conversion [C]	0.73
COG3328	Transposase (or an inactivated derivative)	Mobilome: prophages, transposons [X]	0.73
COG3575	Uncharacterized conserved protein	Function unknown [S]	0.73
COG4636	Endonuclease, Uma2 family (restriction endonuclease fold)	General function prediction only [R]	0.73

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	57.66 %
Unclassified	root	N/A	42.34 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	57.66 %
Unclassified	root	N/A	42.34 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	57.66 %
Unclassified	root	N/A	42.34 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.34 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	26.28 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	6.57 %
Nitrospinae/Tectomicrobia group	clade	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group	2.19 %
Nitrospirae	phylum	All Organisms → cellular organisms → Bacteria → Nitrospirae	1.46 %
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	1.46 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	1.46 %
unclassified Bacteria	no rank	All Organisms → cellular organisms → Bacteria → unclassified Bacteria	0.73 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.34 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	16.79 %
Cyanobacteria/Melainabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group	4.38 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1.46 %
Candidatus Tectomicrobia	phylum	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia	1.46 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	1.46 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.73 %
Verrucomicrobia	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	0.73 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	0.73 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.73 %
Nitrospinae	phylum	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae	0.73 %
Nitrospira	class	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira	0.73 %
Planctomycetes	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	0.73 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.34 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	4.38 %
Candidatus Entotheonella	genus	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella	1.46 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1.46 %
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	0.73 %
Candidatus Stahlbacteria	genus	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Stahlbacteria	0.73 %
unclassified Nitrospinota	no rank	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota	0.73 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	0.73 %
Spartobacteria	class	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria	0.73 %
Neisseriales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales	0.73 %
Planctomycetia	class	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia	0.73 %
Nitrospirales	order	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales	0.73 %
Chromatiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales	0.73 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.73 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.34 %
unclassified Cyanobacteria	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria	2.19 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1.46 %
Nitrospinae bacterium RIFCSPLOWO2_12_FULL_45_22	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium RIFCSPLOWO2_12_FULL_45_22	0.73 %
Chthoniobacterales	order	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales	0.73 %
Synechococcales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales	0.73 %
Pseudanabaenales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales	0.73 %
unclassified Candidatus Stahlbacteria	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Stahlbacteria → unclassified Candidatus Stahlbacteria	0.73 %
unclassified Candidatus Rokubacteria	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria	0.73 %
Candidatus Entotheonella gemina	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina	0.73 %
Chromatiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	0.73 %
Neisseriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Neisseriaceae	0.73 %
Candidatus Entotheonella palauensis	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis	0.73 %
unclassified Deltaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria	0.73 %
Nitrospiraceae	family	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae	0.73 %
Planctomycetales	order	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales	0.73 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.73 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.34 %
Cyanobacteria bacterium 13_1_20CM_4_61_6	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	1.46 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1.46 %
Crenobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Neisseriaceae → Crenobacter	0.73 %
Cyanobacteria bacterium 13_1_40CM_2_61_4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	0.73 %
Candidatus Stahlbacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Stahlbacteria → unclassified Candidatus Stahlbacteria → Candidatus Stahlbacteria bacterium	0.73 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.73 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.73 %
unclassified Chthoniobacterales	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales	0.73 %
Leptolyngbyaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae	0.73 %
Thiocystis	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiocystis	0.73 %
Prochloraceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochloraceae	0.73 %
unclassified Nitrospiraceae	no rank	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae	0.73 %
unclassified Planctomycetales	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → unclassified Planctomycetales	0.73 %
Nitrospinae bacterium RIFCSPLOWO2_12_FULL_45_22	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium RIFCSPLOWO2_12_FULL_45_22	0.73 %
Candidatus Entotheonella gemina	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina	0.73 %
Candidatus Entotheonella palauensis	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis	0.73 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.73 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.34 %
Cyanobacteria bacterium 13_1_20CM_4_61_6	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	1.46 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1.46 %
Crenobacter cavernae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Neisseriaceae → Crenobacter → Crenobacter cavernae	0.73 %
Chthoniobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium	0.73 %
Planctomycetales bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → unclassified Planctomycetales → Planctomycetales bacterium	0.73 %
Nitrospiraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium	0.73 %
Thiocystis violacea	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiocystis → Thiocystis violacea	0.73 %
Prochloron	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochloraceae → Prochloron	0.73 %
Phormidesmis	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Phormidesmis	0.73 %
Cyanobacteria bacterium 13_1_40CM_2_61_4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	0.73 %
Candidatus Stahlbacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Stahlbacteria → unclassified Candidatus Stahlbacteria → Candidatus Stahlbacteria bacterium	0.73 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.73 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.73 %
Nitrospinae bacterium RIFCSPLOWO2_12_FULL_45_22	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium RIFCSPLOWO2_12_FULL_45_22	0.73 %
Candidatus Entotheonella gemina	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina	0.73 %
Candidatus Entotheonella palauensis	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis	0.73 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.73 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	42.34 %
Cyanobacteria bacterium 13_1_20CM_4_61_6	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	1.46 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1.46 %
Prochloron didemni	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochloraceae → Prochloron → Prochloron didemni	0.73 %
Phormidesmis priestleyi	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Phormidesmis → Phormidesmis priestleyi	0.73 %
Crenobacter cavernae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Neisseriaceae → Crenobacter → Crenobacter cavernae	0.73 %
Chthoniobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium	0.73 %
Planctomycetales bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → unclassified Planctomycetales → Planctomycetales bacterium	0.73 %
Nitrospiraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium	0.73 %
Thiocystis violacea	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiocystis → Thiocystis violacea	0.73 %
Cyanobacteria bacterium 13_1_40CM_2_61_4	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	0.73 %
Candidatus Stahlbacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Stahlbacteria → unclassified Candidatus Stahlbacteria → Candidatus Stahlbacteria bacterium	0.73 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.73 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.73 %
Nitrospinae bacterium RIFCSPLOWO2_12_FULL_45_22	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium RIFCSPLOWO2_12_FULL_45_22	0.73 %
Candidatus Entotheonella gemina	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina	0.73 %
Candidatus Entotheonella palauensis	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis	0.73 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.73 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000041\|ARcpr5oldR_c002669	Not Available	1630	Open in IMG/M
3300000858\|JGI10213J12805_11043415	Not Available	1444	Open in IMG/M
3300000955\|JGI1027J12803_107963252	Not Available	1805	Open in IMG/M
3300000956\|JGI10216J12902_100517127	Not Available	1074	Open in IMG/M
3300000956\|JGI10216J12902_107933290	Not Available	1677	Open in IMG/M
3300003911\|JGI25405J52794_10160959	Not Available	513	Open in IMG/M
3300004267\|Ga0066396_10105327	Not Available	526	Open in IMG/M
3300005289\|Ga0065704_10095880	Not Available	2468	Open in IMG/M
3300005295\|Ga0065707_10129626	Not Available	1943	Open in IMG/M
3300005332\|Ga0066388_100416439	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1988	Open in IMG/M
3300005332\|Ga0066388_101274430	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4	1264	Open in IMG/M
3300005332\|Ga0066388_102100043	Not Available	1016	Open in IMG/M
3300005332\|Ga0066388_102608828	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	920	Open in IMG/M
3300005343\|Ga0070687_101435508	Not Available	517	Open in IMG/M
3300005445\|Ga0070708_100096655	Not Available	2698	Open in IMG/M
3300005467\|Ga0070706_100075612	All Organisms → cellular organisms → Bacteria	3117	Open in IMG/M
3300005471\|Ga0070698_100081609	All Organisms → cellular organisms → Bacteria → Proteobacteria	3227	Open in IMG/M
3300005552\|Ga0066701_10952951	All Organisms → cellular organisms → Bacteria → Proteobacteria	508	Open in IMG/M
3300005554\|Ga0066661_10461820	Not Available	774	Open in IMG/M
3300005568\|Ga0066703_10808680	All Organisms → cellular organisms → Bacteria → Proteobacteria	536	Open in IMG/M
3300005586\|Ga0066691_10038912	All Organisms → cellular organisms → Bacteria	2499	Open in IMG/M
3300005617\|Ga0068859_100785243	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiocystis → Thiocystis violacea	1040	Open in IMG/M
3300005764\|Ga0066903_100310581	All Organisms → cellular organisms → Bacteria	2506	Open in IMG/M
3300005764\|Ga0066903_100324459	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	2462	Open in IMG/M
3300005764\|Ga0066903_101072553	Not Available	1482	Open in IMG/M
3300005764\|Ga0066903_102005969	All Organisms → cellular organisms → Bacteria	1111	Open in IMG/M
3300005764\|Ga0066903_102294558	Not Available	1042	Open in IMG/M
3300005764\|Ga0066903_102495772	Not Available	1001	Open in IMG/M
3300005764\|Ga0066903_102793018	All Organisms → cellular organisms → Bacteria	947	Open in IMG/M
3300005764\|Ga0066903_102935514	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	924	Open in IMG/M
3300005764\|Ga0066903_107295080	All Organisms → cellular organisms → Bacteria	572	Open in IMG/M
3300006049\|Ga0075417_10241079	Not Available	865	Open in IMG/M
3300006058\|Ga0075432_10064587	Not Available	1307	Open in IMG/M
3300006194\|Ga0075427_10045156	All Organisms → cellular organisms → Bacteria	749	Open in IMG/M
3300006194\|Ga0075427_10071202	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	620	Open in IMG/M
3300006196\|Ga0075422_10041780	All Organisms → cellular organisms → Bacteria	1634	Open in IMG/M
3300006196\|Ga0075422_10121724	All Organisms → cellular organisms → Bacteria → Proteobacteria	1020	Open in IMG/M
3300006844\|Ga0075428_100357749	Not Available	1566	Open in IMG/M
3300006844\|Ga0075428_100689269	Not Available	1088	Open in IMG/M
3300006844\|Ga0075428_102001030	All Organisms → cellular organisms → Bacteria	600	Open in IMG/M
3300006845\|Ga0075421_100450485	All Organisms → cellular organisms → Bacteria	1538	Open in IMG/M
3300006845\|Ga0075421_100455880	All Organisms → cellular organisms → Bacteria	1527	Open in IMG/M
3300006845\|Ga0075421_102749016	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	508	Open in IMG/M
3300006846\|Ga0075430_100438845	Not Available	1078	Open in IMG/M
3300006846\|Ga0075430_100691305	Not Available	841	Open in IMG/M
3300006847\|Ga0075431_100253177	All Organisms → cellular organisms → Bacteria	1789	Open in IMG/M
3300006853\|Ga0075420_100163135	All Organisms → cellular organisms → Bacteria → Proteobacteria	1953	Open in IMG/M
3300006853\|Ga0075420_100393981	Not Available	1198	Open in IMG/M
3300006854\|Ga0075425_102541210	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	567	Open in IMG/M
3300006904\|Ga0075424_100796538	Not Available	1008	Open in IMG/M
3300006904\|Ga0075424_100994169	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium	894	Open in IMG/M
3300006904\|Ga0075424_102736741	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	514	Open in IMG/M
3300006969\|Ga0075419_10381875	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	962	Open in IMG/M
3300006969\|Ga0075419_10756431	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	693	Open in IMG/M
3300007004\|Ga0079218_10648633	Not Available	977	Open in IMG/M
3300007076\|Ga0075435_100138464	All Organisms → cellular organisms → Bacteria → Proteobacteria	2040	Open in IMG/M
3300007255\|Ga0099791_10170037	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina	1023	Open in IMG/M
3300009038\|Ga0099829_10733674	Not Available	821	Open in IMG/M
3300009081\|Ga0105098_10010574	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	3395	Open in IMG/M
3300009088\|Ga0099830_10107522	All Organisms → cellular organisms → Bacteria	2092	Open in IMG/M
3300009089\|Ga0099828_11341421	All Organisms → cellular organisms → Bacteria → Proteobacteria	632	Open in IMG/M
3300009090\|Ga0099827_11180569	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	665	Open in IMG/M
3300009090\|Ga0099827_11869941	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	523	Open in IMG/M
3300009094\|Ga0111539_12773672	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	568	Open in IMG/M
3300009100\|Ga0075418_10181966	All Organisms → cellular organisms → Bacteria	2238	Open in IMG/M
3300009100\|Ga0075418_11066733	Not Available	875	Open in IMG/M
3300009100\|Ga0075418_12063835	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	621	Open in IMG/M
3300009147\|Ga0114129_10414664	Not Available	1773	Open in IMG/M
3300009147\|Ga0114129_11438687	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochloraceae → Prochloron → Prochloron didemni	849	Open in IMG/M
3300009156\|Ga0111538_10655201	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1331	Open in IMG/M
3300009157\|Ga0105092_10089164	Not Available	1684	Open in IMG/M
3300009691\|Ga0114944_1059126	Not Available	1415	Open in IMG/M
3300009819\|Ga0105087_1057738	All Organisms → cellular organisms → Bacteria	649	Open in IMG/M
3300010046\|Ga0126384_10378326	Not Available	1189	Open in IMG/M
3300010047\|Ga0126382_10990681	Not Available	736	Open in IMG/M
3300010359\|Ga0126376_11105779	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → unclassified Planctomycetales → Planctomycetales bacterium	801	Open in IMG/M
3300010359\|Ga0126376_12275829	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	588	Open in IMG/M
3300010359\|Ga0126376_13211730	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	506	Open in IMG/M
3300010360\|Ga0126372_11561514	All Organisms → cellular organisms → Bacteria	698	Open in IMG/M
3300010360\|Ga0126372_11960035	Not Available	632	Open in IMG/M
3300010362\|Ga0126377_13448495	Not Available	511	Open in IMG/M
3300010366\|Ga0126379_10658597	Not Available	1138	Open in IMG/M
3300010376\|Ga0126381_104970715	All Organisms → cellular organisms → Bacteria	510	Open in IMG/M
3300010398\|Ga0126383_10227134	All Organisms → cellular organisms → Bacteria → Proteobacteria	1813	Open in IMG/M
3300011270\|Ga0137391_10396642	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6	1180	Open in IMG/M
3300012189\|Ga0137388_10654151	Not Available	976	Open in IMG/M
3300012202\|Ga0137363_10987853	Not Available	715	Open in IMG/M
3300012209\|Ga0137379_10863395	Not Available	809	Open in IMG/M
3300012353\|Ga0137367_10032086	All Organisms → cellular organisms → Bacteria	4049	Open in IMG/M
3300012358\|Ga0137368_10052436	All Organisms → cellular organisms → Bacteria	3447	Open in IMG/M
3300012358\|Ga0137368_10595862	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Phormidesmis → Phormidesmis priestleyi	702	Open in IMG/M
3300012361\|Ga0137360_10203733	Not Available	1603	Open in IMG/M
3300012401\|Ga0134055_1079468	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	542	Open in IMG/M
3300012481\|Ga0157320_1001590	Not Available	1173	Open in IMG/M
3300012917\|Ga0137395_10112290	Not Available	1825	Open in IMG/M
3300012925\|Ga0137419_10133962	Not Available	1768	Open in IMG/M
3300012925\|Ga0137419_10140016	Not Available	1734	Open in IMG/M
3300012930\|Ga0137407_10687190	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Neisseriaceae → Crenobacter → Crenobacter cavernae	963	Open in IMG/M
3300012930\|Ga0137407_11055768	All Organisms → cellular organisms → Bacteria	770	Open in IMG/M
3300012948\|Ga0126375_11409090	Not Available	591	Open in IMG/M
3300012948\|Ga0126375_11568332	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	566	Open in IMG/M
3300012948\|Ga0126375_11721459	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	544	Open in IMG/M
3300012948\|Ga0126375_11793427	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	535	Open in IMG/M
3300013306\|Ga0163162_10415821	Not Available	1477	Open in IMG/M
3300015371\|Ga0132258_10036682	All Organisms → cellular organisms → Bacteria	11055	Open in IMG/M
3300015371\|Ga0132258_10797505	All Organisms → cellular organisms → Bacteria	2381	Open in IMG/M
3300015371\|Ga0132258_11045705	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Stahlbacteria → unclassified Candidatus Stahlbacteria → Candidatus Stahlbacteria bacterium	2064	Open in IMG/M
3300015373\|Ga0132257_100216663	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	2275	Open in IMG/M
3300019233\|Ga0184645_1151449	Not Available	701	Open in IMG/M
3300020018\|Ga0193721_1100496	Not Available	741	Open in IMG/M
3300021086\|Ga0179596_10250846	Not Available	874	Open in IMG/M
3300025910\|Ga0207684_11292747	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	601	Open in IMG/M
3300026035\|Ga0207703_10878788	All Organisms → cellular organisms → Bacteria	858	Open in IMG/M
3300026326\|Ga0209801_1259698	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	648	Open in IMG/M
3300027873\|Ga0209814_10455068	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	565	Open in IMG/M
3300027874\|Ga0209465_10068796	Not Available	1714	Open in IMG/M
3300027874\|Ga0209465_10570528	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	562	Open in IMG/M
3300027875\|Ga0209283_10238964	All Organisms → cellular organisms → Bacteria → Proteobacteria	1205	Open in IMG/M
3300027875\|Ga0209283_10605636	Not Available	694	Open in IMG/M
3300027907\|Ga0207428_10242595	All Organisms → cellular organisms → Bacteria	1346	Open in IMG/M
3300028587\|Ga0247828_10348309	Not Available	835	Open in IMG/M
3300028878\|Ga0307278_10060133	Not Available	1715	Open in IMG/M
3300030006\|Ga0299907_11022387	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis	606	Open in IMG/M
3300031094\|Ga0308199_1044693	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium RIFCSPLOWO2_12_FULL_45_22	847	Open in IMG/M
3300031573\|Ga0310915_10100220	Not Available	1956	Open in IMG/M
3300031740\|Ga0307468_101632813	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	604	Open in IMG/M
3300031744\|Ga0306918_10269296	Not Available	1305	Open in IMG/M
3300031892\|Ga0310893_10402905	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	599	Open in IMG/M
3300031901\|Ga0307406_11312763	Not Available	632	Open in IMG/M
3300031908\|Ga0310900_10450443	Not Available	989	Open in IMG/M
3300031945\|Ga0310913_11218037	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium	524	Open in IMG/M
3300032002\|Ga0307416_101607027	Not Available	755	Open in IMG/M
3300032075\|Ga0310890_11192816	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	619	Open in IMG/M
3300032180\|Ga0307471_102917394	All Organisms → cellular organisms → Bacteria → Nitrospirae	607	Open in IMG/M
3300032211\|Ga0310896_10049262	Not Available	1693	Open in IMG/M
3300034668\|Ga0314793_002367	All Organisms → cellular organisms → Bacteria → Proteobacteria	2101	Open in IMG/M
3300034678\|Ga0314803_014602	All Organisms → cellular organisms → Bacteria → Proteobacteria	1098	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	66.42%
Host-Associated	Host-Associated	33.58%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	63.50%
Plants	Host-Associated → Plants	33.58%
Aquatic	Environmental → Aquatic	2.92%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	63.50%
Rhizosphere	Host-Associated → Plants → Rhizosphere	25.55%
Rhizoplane	Host-Associated → Plants → Rhizoplane	8.03%
Freshwater	Environmental → Aquatic → Freshwater	2.19%
Thermal Springs	Environmental → Aquatic → Thermal Springs	0.73%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	47.45%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	25.55%
Loam	Environmental → Terrestrial → Soil → Loam	15.33%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	4.38%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	3.65%
Sediment	Environmental → Aquatic → Freshwater → Sediment	2.19%
Hot (42-90C)	Environmental → Aquatic → Thermal Springs → Hot (42-90C)	0.73%
Sand	Environmental → Terrestrial → Soil → Sand	0.73%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	31.39%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	25.55%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	11.68%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	6.57%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	5.11%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	4.38%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	3.65%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	3.65%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	3.65%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	2.19%
Unclassified	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified	0.73%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	0.73%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	0.73%

Habitat	Taxonomy	Distribution
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	24.09%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	16.06%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	11.68%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	10.95%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	6.57%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	5.11%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	3.65%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	2.92%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	2.92%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	1.46%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	1.46%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	1.46%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.46%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	1.46%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	0.73%
Thermal Springs	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs	0.73%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.73%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere	0.73%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.73%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.73%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.73%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	0.73%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere	0.73%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	0.73%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere	0.73%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.73%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000041	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere	Host-Associated	Open in IMG/M
3300000858	Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil	Environmental	Open in IMG/M
3300000955	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental	Open in IMG/M
3300003911	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Host-Associated	Open in IMG/M
3300004267	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio	Environmental	Open in IMG/M
3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2	Host-Associated	Open in IMG/M
3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Environmental	Open in IMG/M
3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Environmental	Open in IMG/M
3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Environmental	Open in IMG/M
3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Environmental	Open in IMG/M
3300005552	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150	Environmental	Open in IMG/M
3300005554	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110	Environmental	Open in IMG/M
3300005568	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152	Environmental	Open in IMG/M
3300005586	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140	Environmental	Open in IMG/M
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300006049	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1	Host-Associated	Open in IMG/M
3300006058	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Host-Associated	Open in IMG/M
3300006194	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1	Host-Associated	Open in IMG/M
3300006196	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1	Host-Associated	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated	Open in IMG/M
3300006846	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Host-Associated	Open in IMG/M
3300006847	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Host-Associated	Open in IMG/M
3300006853	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4	Host-Associated	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300006969	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3	Host-Associated	Open in IMG/M
3300007004	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost	Environmental	Open in IMG/M
3300007076	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Host-Associated	Open in IMG/M
3300007255	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1	Environmental	Open in IMG/M
3300009038	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG	Environmental	Open in IMG/M
3300009081	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015	Environmental	Open in IMG/M
3300009088	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG	Environmental	Open in IMG/M
3300009089	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG	Environmental	Open in IMG/M
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009157	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015	Environmental	Open in IMG/M
3300009691	Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP2	Environmental	Open in IMG/M
3300009819	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_40_50	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300011270	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG	Environmental	Open in IMG/M
3300012189	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG	Environmental	Open in IMG/M
3300012202	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG	Environmental	Open in IMG/M
3300012209	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG	Environmental	Open in IMG/M
3300012353	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG	Environmental	Open in IMG/M
3300012358	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG	Environmental	Open in IMG/M
3300012361	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG	Environmental	Open in IMG/M
3300012401	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012481	Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610	Host-Associated	Open in IMG/M
3300012917	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG	Environmental	Open in IMG/M
3300012925	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012930	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012948	Tropical forest soil microbial communities from Panama - MetaG Plot_14	Environmental	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300019233	Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300020018	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2	Environmental	Open in IMG/M
3300021086	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026326	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)	Environmental	Open in IMG/M
3300027873	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)	Host-Associated	Open in IMG/M
3300027874	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)	Environmental	Open in IMG/M
3300027875	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027907	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)	Host-Associated	Open in IMG/M
3300028587	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3	Environmental	Open in IMG/M
3300028878	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117	Environmental	Open in IMG/M
3300030006	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67	Environmental	Open in IMG/M
3300031094	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031573	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111	Environmental	Open in IMG/M
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental	Open in IMG/M
3300031744	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)	Environmental	Open in IMG/M
3300031892	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2	Environmental	Open in IMG/M
3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Host-Associated	Open in IMG/M
3300031908	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1	Environmental	Open in IMG/M
3300031945	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082	Environmental	Open in IMG/M
3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Host-Associated	Open in IMG/M
3300032075	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032211	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1	Environmental	Open in IMG/M
3300034668	Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0R1 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300034678	Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R4 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.15
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.15
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F056732

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
ARcpr5oldR_0026692	3300000041	Arabidopsis Rhizosphere	MLESIACYGLHMRPPRVHVPAFPDSYLPGVNSITESRTVYL*
JGI10213J12805_110434151	3300000858	Soil	MFVSIACYGLHIRPPWVHVPAFPDSYLPGVCIITEAGLYTY
JGI1027J12803_1079632521	3300000955	Soil	MFESIMGFGLPMRTPRVPVPACPDSYLPGVDSTTES
JGI10216J12902_1005171272	3300000956	Soil	MFESIVCFGLHIRPLRVHVPAFPDSYLPGVHSITE
JGI10216J12902_1079332902	3300000956	Soil	MLESIMCLGMQTRNPRVHVPAFTDSYLPVVFSITESRTVYL*
JGI25405J52794_101609591	3300003911	Tabebuia Heterophylla Rhizosphere	MLESIRCFGMDTRTLRVHVPALTESYLLAVFSITESSTVYL*
Ga0066396_101053271	3300004267	Tropical Forest Soil	MFVSLAGYAVDIRPLRVHVPAFPDSYLSGVDSITESRTVYL*
Ga0065704_100958803	3300005289	Switchgrass Rhizosphere	MLESIVCFGVHTRTPQVHVPAFPDSYLPGVDSITESRTLYL*
Ga0065707_101296261	3300005295	Switchgrass Rhizosphere	MLESIVCFGVHTRTPQVHVPAFPDSYLPGVDSITESRTL*
Ga0066388_1004164392	3300005332	Tropical Forest Soil	MLESIMCFGLHIRTPRVHVPAFPDSYLPGVDSITESRTVYL*
Ga0066388_1012744301	3300005332	Tropical Forest Soil	RTWGVENMLESIVCFGLHTRTPQVHVPAFPDSYLPGVDSITESRTLYL*
Ga0066388_1021000431	3300005332	Tropical Forest Soil	MLVSITCFGVHTRTPRVHVPAFPDSYLPGVHSITEAGLITY
Ga0066388_1026088281	3300005332	Tropical Forest Soil	VSITCFGVHTRTPRVHVPAFPDSYLPGVHSITESRTNYL*
Ga0070687_1014355081	3300005343	Switchgrass Rhizosphere	MLESIVCFGLHIRHPRVHVPAFPDSSLPSVNSITESRTVYL*
Ga0070708_1000966553	3300005445	Corn, Switchgrass And Miscanthus Rhizosphere	MFVSLTGYAVDIRPLRVHVPAFPDSYLPGVYSITESRTVYL*
Ga0070706_1000756124	3300005467	Corn, Switchgrass And Miscanthus Rhizosphere	MLESIACFGLHTRNPQVHVPAFPDSYLPGVYSITESRTLYL*
Ga0070698_1000816093	3300005471	Corn, Switchgrass And Miscanthus Rhizosphere	MFESIVCFGVHMRHPRVHVPAFPDSYLPGVLSITESRTVYL*
Ga0066701_109529512	3300005552	Soil	MFVSIACYGLDIRHPRVHVPAFPVSYLPGVDSITESRTVYL*
Ga0066661_104618202	3300005554	Soil	MFESIVCFGLHIRHPRVHVPAFPDSYLPGVNSITESRTVYL*
Ga0066703_108086802	3300005568	Soil	MFVSIACYGLDIRHPRVHVPAFPDSYLPGVNSITESRTVYL*
Ga0066691_100389122	3300005586	Soil	MFVSLTGYAVDIRPLRVHIPAFPDSYLSGVFSITESRTVYL*
Ga0068859_1007852434	3300005617	Switchgrass Rhizosphere	CFALHIRHPQVHVPAFPDSYLSGVHSITESRTVYL*
Ga0066903_1003105811	3300005764	Tropical Forest Soil	ESIACFGLHTRNPRVHVPAFPDSYLPGVYSITESRALYL*
Ga0066903_1003244592	3300005764	Tropical Forest Soil	MLESIACFGLHTRNPRVHVPAFPDSYLPGVYSITESRALYL*
Ga0066903_1010725532	3300005764	Tropical Forest Soil	MLESRRCFGLHMRHPQGHVPAFPDSYLPGVLSITESRTVYL*
Ga0066903_1020059693	3300005764	Tropical Forest Soil	MFVSLTGYAVDIRPLRVHVPAFPDSYLPGVCIITESRTVYL*
Ga0066903_1022945581	3300005764	Tropical Forest Soil	ERIGCFGLHMRHPRVHVPAFPDSSLPGVHSITESRTVYL*
Ga0066903_1024957722	3300005764	Tropical Forest Soil	MFVSIACYGLHIRPSWVHVPAFPDSYLPGVDSITESRT
Ga0066903_1027930183	3300005764	Tropical Forest Soil	MFESIVCFGLDTRTLRVHVPAVPDSYLSGVHSITESRIVYL*
Ga0066903_1029355142	3300005764	Tropical Forest Soil	ENMFESIACFGLHARTPRVHVPAFPDSYLPGVDRITESRTLYL*
Ga0066903_1072950801	3300005764	Tropical Forest Soil	SIVCFGLHIRHPRVHVPAFPDSYLPSVNSITESRTVYL*
Ga0075417_102410792	3300006049	Populus Rhizosphere	MFVSIACYSLHIRPPWVHVPAFPDSYLPGVDSITESRTL
Ga0075432_100645871	3300006058	Populus Rhizosphere	VFKSVMCFALHIRHPQVHVPAFPDSYLPGVHSITESRT
Ga0075427_100451562	3300006194	Populus Rhizosphere	MLESIACYGLHIRPPRVHVPAFPDSYLPGVNSITESRT
Ga0075427_100712022	3300006194	Populus Rhizosphere	MLESIVCLGLHTRTPQVHVPAFPDSYLPGVDSITESRT
Ga0075422_100417801	3300006196	Populus Rhizosphere	QCESLGCCGWHIRPPRVQVPACPDRYLPGVDRITESRTIYLLL*
Ga0075422_101217242	3300006196	Populus Rhizosphere	MFVSLAGYAVDIRPLRVHGPAVTGSYLPAVESTTENRTVYL*
Ga0075428_1003577491	3300006844	Populus Rhizosphere	MFESIRCCGLHIRTPRVHVPAFPDSYLPGVYSTTESR
Ga0075428_1006892691	3300006844	Populus Rhizosphere	MFVSIACFGVHIRTPRVHVPAFPDSYLPGVHSITESRTL
Ga0075428_1020010301	3300006844	Populus Rhizosphere	MFVSLTGYAVDIRPLRVHVPAFPDSYLSGVFSITESRTVYL
Ga0075421_1004504851	3300006845	Populus Rhizosphere	ESIACFGLHIRHPRVHVPAFSDSYLPGVHSITESRTVYL*
Ga0075421_1004558803	3300006845	Populus Rhizosphere	MFVSIVCFGLHMRHPQVHVPAFPDSYLPGGHSIPESRTIYL*
Ga0075421_1027490162	3300006845	Populus Rhizosphere	MLESVMCFSLPIRHPRVHVPAFPDSYLPGVNSITE
Ga0075430_1004388451	3300006846	Populus Rhizosphere	MLESIVCFGVHTRTPQVHGPAFPDSYLPGVDSITEAGLFTY
Ga0075430_1006913052	3300006846	Populus Rhizosphere	MFVSLSGYAVDIHPLRVHVPAFAESYLPAVNSITESRTEYL*
Ga0075431_1002531772	3300006847	Populus Rhizosphere	FVSLAGYAVDIRPLRVHVPAFPDSYLPGVYSITESRTEYL*
Ga0075420_1001631351	3300006853	Populus Rhizosphere	MLVSIACFGVHTRTPRVHVPAFPDSYLPGVHSITESRTLYL
Ga0075420_1003939811	3300006853	Populus Rhizosphere	MFVSLAGYALDMRHPRVQVPACADSYPPGVNSITESRTV
Ga0075425_1025412101	3300006854	Populus Rhizosphere	MFVSIACFGLHIRTPQVHVPAFPDSYLPGVDSITESRT
Ga0075424_1007965382	3300006904	Populus Rhizosphere	MLESVMCFGLHIRHPRVHVPAFPDSYLPGVHSITESR
Ga0075424_1009941692	3300006904	Populus Rhizosphere	IACCGLHMRHPRVHGPAVPGSYLPAVESTTENRTVYL*
Ga0075424_1027367412	3300006904	Populus Rhizosphere	MLVSIACFGVHTRTPRVHVPAFPDSYLPGVHSITESRT
Ga0075419_103818751	3300006969	Populus Rhizosphere	MLESIGCFGLHTRTPQVHVPAFPDSYLPGVDSITESRTLY
Ga0075419_107564312	3300006969	Populus Rhizosphere	GVENMLESIVCFGLHTRTPQVHGPAFPDSYLPGVDSITESRTLYL*
Ga0079218_106486331	3300007004	Agricultural Soil	KSIVCSPLVIRHPRAHGPAFTGSYLPAVISITESRTVYLYPHWR*
Ga0075435_1001384641	3300007076	Populus Rhizosphere	MFESIACFGLHIRHPRVHVPAFSDSYLPGVHSITESRTLY
Ga0099791_101700373	3300007255	Vadose Zone Soil	FVRIVCFGLPMRHPQVHVPAFPDSYLPGVHSITESRTLYL*
Ga0099829_107336742	3300009038	Vadose Zone Soil	CYGLDIRHPRVHVPAFPVSYLPGVDSITESRTVYL*
Ga0105098_100105745	3300009081	Freshwater Sediment	MLASILCLGMDTRTPRVHVPAVTGSYLPAVLNITESRTVYL*
Ga0099830_101075224	3300009088	Vadose Zone Soil	MLESIVCFGVHTRTPRVHVPAFPDSYLPGVDSITESRTVYL*
Ga0099828_113414212	3300009089	Vadose Zone Soil	MFGSITCFGVHTRTPRVHVPAFPDSYLPGVHSITESRTNYL
Ga0099827_111805692	3300009090	Vadose Zone Soil	MRFGLHIRTPRVHVPAFPDSYLPGVCIITESRTVY
Ga0099827_118699412	3300009090	Vadose Zone Soil	MFESVMGFGLHIRHPQGHVPAFPDSYLPGVCIITESR
Ga0111539_127736722	3300009094	Populus Rhizosphere	MFVSLVGHAVDIRPLRVHVPAFPDSYLSGVFSITESRT
Ga0075418_101819663	3300009100	Populus Rhizosphere	MFVSIRCFGLHIRHPQVHVPAFPDSYLPGVHSITESR
Ga0075418_110667332	3300009100	Populus Rhizosphere	FVSLAGSAVDIRPLRVHVPAFTGSDLPAVLSVTESRTVYL*
Ga0075418_120638352	3300009100	Populus Rhizosphere	MFVSIACYSLHIRPPWVHVPAFPDSYLPGVDSITESRTVYL
Ga0114129_104146643	3300009147	Populus Rhizosphere	MFESIACFGVHIRHPRVHVPAFSDSYLPGVHSITESR
Ga0114129_114386873	3300009147	Populus Rhizosphere	TCGGEAMFVSIVCFGLHMRHPQVHVPAFPDSYLPGGHSIPESRTIYL*
Ga0111538_106552011	3300009156	Populus Rhizosphere	PRTCGVEDMFVSIACFGLHMRTPQVHVPAFPDSYLPGVDSITESRTLYL*
Ga0105092_100891644	3300009157	Freshwater Sediment	MLASILCLGMDTRTPRVHVPDVTGSYLLAVLNITESRTVYL*
Ga0114944_10591261	3300009691	Thermal Springs	MFVSIACYGLHIRPPWVHVPAFPDSYLPGVDSITESRTVYL
Ga0105087_10577381	3300009819	Groundwater Sand	MFVSLGGYAVDIRPLRVHVPAFPESYLPGVYSITESRT
Ga0126384_103783261	3300010046	Tropical Forest Soil	MFESIVCCGVHIRHPRVHVPAFPDSYLSGGYSITESRT
Ga0126382_109906811	3300010047	Tropical Forest Soil	MLASIVCFGVHTRTPRVHVPAFPDSYLPGVDSITESRT
Ga0126376_111057791	3300010359	Tropical Forest Soil	MLESIVCFGLHTRTPQVHVPAFPDSYLPGVDRITESRTLYL*
Ga0126376_122758292	3300010359	Tropical Forest Soil	MFESIVFFGLDTRTLRVHVPAFPDSYLQGVHSITESR
Ga0126376_132117302	3300010359	Tropical Forest Soil	MFESITCLRVHARTPRVHVPTFPDSYLPGVYSITESR
Ga0126372_115615141	3300010360	Tropical Forest Soil	NMLESIVCFGLHTRTPQVHVPAFPDSYLPGVHSITESRTLYL*
Ga0126372_119600352	3300010360	Tropical Forest Soil	PRTCGVENMLESIMCFGVHARTPRVHDPAFPDSYLPGVDSITESRTLYL*
Ga0126377_134484951	3300010362	Tropical Forest Soil	MCASIACFGLPIRHPRVHVPAFSDSYLPGMNSITESRT
Ga0126379_106585973	3300010366	Tropical Forest Soil	ESIVCFGLHIRHPRVHVPAFPYSYLPGVYSITESRTVYL*
Ga0126381_1049707152	3300010376	Tropical Forest Soil	MFVSLMGYAVDIRPLRVPVPVFLDSYLPGGYSITESRTVYL
Ga0126383_102271344	3300010398	Tropical Forest Soil	NMFESIACFGLHTRPLRVHVPAFPDSDLPGVYSITESRTEYL*
Ga0137391_103966422	3300011270	Vadose Zone Soil	FVSIACYGLDIRHPRVHVPAFPVSYLPGVDSITESRTVYL*
Ga0137388_106541511	3300012189	Vadose Zone Soil	MLESVMRFGLHIRTPRVHVPAFPDSYLPGVCIITESRTVY
Ga0137363_109878532	3300012202	Vadose Zone Soil	MFVSITCFGVHTRTPRVHVPAFPDSYLPGVDSITE
Ga0137379_108633951	3300012209	Vadose Zone Soil	MFESIMGFGLPMRTPRVHVPAFPDSYLLGVCIITESRT
Ga0137367_100320864	3300012353	Vadose Zone Soil	MCESLVCFGVPLRHPRVHVPAFPASSLPGVTVIITESRTVYL*
Ga0137368_100524366	3300012358	Vadose Zone Soil	FESVMCFGLHIRTPRVHVPAFPDSYLPDVNSITESRTLYL*
Ga0137368_105958621	3300012358	Vadose Zone Soil	SLVCFGVPLRHPRVHVPAFPASSLPGVTVMITESRTVYL*
Ga0137360_102037332	3300012361	Vadose Zone Soil	MFESGMCFGVHIRHPRVHVPAFPDSYLPGVDSITESR
Ga0134055_10794682	3300012401	Grasslands Soil	MFESIRCFGLHIRPPRVPVPAFPDSYLPGVDSITE
Ga0157320_10015902	3300012481	Arabidopsis Rhizosphere	MFVSIVGFGLPMRHPQVPVPAFPDRSLPGVHSITESRTVYL*
Ga0137395_101122901	3300012917	Vadose Zone Soil	MFESVMCFGVHIRHPRVHVPAFPDSYLPGVDSITESRT
Ga0137419_101339622	3300012925	Vadose Zone Soil	MFVSITCFGVHTRTPRVHVPAFPDSYLPGVHSITESR
Ga0137419_101400162	3300012925	Vadose Zone Soil	CFGLPIRHPRVHVPAFPDSYLTGVDSITESRTLYL*
Ga0137407_106871901	3300012930	Vadose Zone Soil	TCGVEDMLVSIACFGVHIRTPRVHVPAFPDSYLPGVDSITESRTLYL*
Ga0137407_110557682	3300012930	Vadose Zone Soil	VMCFGLHIRTPRVHVPAFPDSYLPDVNSITESRTLYL*
Ga0126375_114090901	3300012948	Tropical Forest Soil	MLESLRCFGLHIRTPRVHVPAFPDSYLPGVCIITESRT
Ga0126375_115683321	3300012948	Tropical Forest Soil	MCVSIAGDGWHMRPPWVHVPAFPGSSLPGMDSITAS
Ga0126375_117214591	3300012948	Tropical Forest Soil	MFVSIRCFGVHSRHPQVHVPAFPDSYLPGVDSLTESRTLY
Ga0126375_117934272	3300012948	Tropical Forest Soil	MFESIACCGVHIRHPRVHVPAFSGSYLPGVHSITESR
Ga0163162_104158211	3300013306	Switchgrass Rhizosphere	MFVSLVGYAVDIRPLRVHVPAFPDSYLPSVNSITE
Ga0132258_1003668213	3300015371	Arabidopsis Rhizosphere	MFVSLVGSAVDIRPLRVHVPAFPDSFLPGVYSITESRTVYL*
Ga0132258_107975053	3300015371	Arabidopsis Rhizosphere	VSIVGFGLPMRHPQVPVPAFPDRSLPGVHSITESRTVYL*
Ga0132258_110457055	3300015371	Arabidopsis Rhizosphere	FVSIVGFGLPMRHPQVPVPAFPDRSLPGVHSITESRTVYL*
Ga0132257_1002166634	3300015373	Arabidopsis Rhizosphere	VGFGLPMRHPQVPVPAFPDRSLPGVHSITESRTVYL*
Ga0184645_11514491	3300019233	Groundwater Sediment	HKRTRGFEDMLESILCCGLDIRNLRVHVPALTESYLSAVFSITESRTVYL
Ga0193721_11004961	3300020018	Soil	MFVSIACYGLDIRHPRVHVPAFPDSYLPGVNSITES
Ga0179596_102508462	3300021086	Vadose Zone Soil	MLESIMCFGVHTRTPRVHVPAFPDSYLPGVDSITESRTLYL
Ga0207684_112927472	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	MFVSIACYGLDIRHPRVHVPAFPVSYLPGVNSITES
Ga0207703_108787881	3300026035	Switchgrass Rhizosphere	IVCFGLHIRHPRVHVPAFPDSSLPSVNSITESRTVYL
Ga0209801_12596981	3300026326	Soil	MFVSLTGYAVDIRPLRVHIPAFPDSYLSGVFSITESRTVYL
Ga0209814_104550681	3300027873	Populus Rhizosphere	MFVSIACFGLHMRTPQVHVPAFPDSYLPGVDSITESRTLY
Ga0209465_100687961	3300027874	Tropical Forest Soil	MFESITCFGLHTRTPRVHVPAFPDSYLPGVDSITES
Ga0209465_105705281	3300027874	Tropical Forest Soil	MLESILCFGLHIRNPRVHVPAFPDSYLPGVDSITESRT
Ga0209283_102389643	3300027875	Vadose Zone Soil	MFGSITCFGVHTRTPRVHVPAFPDSYLPGVHSITESRTNYLTR
Ga0209283_106056362	3300027875	Vadose Zone Soil	FVSIACYGLDIRHPRVHVPAFPVSYLPGVDSITESRTVYL
Ga0207428_102425953	3300027907	Populus Rhizosphere	EDMCVSIRCFGLHIRHPQVHVPAFPDSYLPGVHSITESRTLYL
Ga0247828_103483091	3300028587	Soil	MFVSLAGYAVDIRPLRVHVSAFPESYLPGVDSITESR
Ga0307278_100601331	3300028878	Soil	MFVSLACFGVHIRPLRVYVPAFPDSDLPGVDSITER
Ga0299907_110223871	3300030006	Soil	MFVSIACYGLDIRHPRVHVPAFPVSYLPGVDSITESRTVYL
Ga0308199_10446932	3300031094	Soil	EDMFVSIACYGLDIRHPRVHVPAFPVSYLPGVDSITESRTEYL
Ga0310915_101002201	3300031573	Soil	MEREGVLHIRHPQVHVPAFPDSYLSGVHSITESRTVY
Ga0307468_1016328132	3300031740	Hardwood Forest Soil	MFESVMCFGLHIRHPQVHVPAFPDSYLPGVCIITASRPVYL
Ga0306918_102692961	3300031744	Soil	FKSVMCFALHIRHPQVHVPAFPDSYLSGVHSITESRTVYL
Ga0310893_104029052	3300031892	Soil	MFVSLVGYAVDIRPLRVHVPAFPDSYLSGVFSITE
Ga0307406_113127631	3300031901	Rhizosphere	LERIMCFGMQIRHPRVHVPAFTDSYLPVVFSITESRTVYL
Ga0310900_104504432	3300031908	Soil	MFESITCLCLHARTPRVHVPAFPASYLPGVYSITESRTVYL
Ga0310913_112180371	3300031945	Soil	VFKSVMCFALHIRHPQVHVPAFPDSYLSGVHSITESRTVYL
Ga0307416_1016070272	3300032002	Rhizosphere	MSIVCYALEIRNPRAHVPAFTGNYLPAVFSITESRTVYLYPHWSR
Ga0310890_111928162	3300032075	Soil	MFVSIACFGVHIRTPRVHVPAFPDSYLPGVHSITESRTVYL
Ga0307471_1029173941	3300032180	Hardwood Forest Soil	ESIRCFGVHIRTPRVHVPAFPDSYLPGVDIITESRTLYL
Ga0310896_100492621	3300032211	Soil	MFVSIACYGLHIRPPWVHVPAFPDSYLPGVDSITESR
Ga0314793_002367_50_175	3300034668	Soil	MFVSLAGYAVDIRPLRVHVPAFPESYLPGVDSITENRTVYL
Ga0314803_014602_17_142	3300034678	Soil	MFVSLAGYAVDIRPLRVHGPAVTGSYLPAVESTTENRTVYL

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign