Basic Information | |
---|---|
Family ID | F056948 |
Family Type | Metagenome |
Number of Sequences | 137 |
Average Sequence Length | 43 residues |
Representative Sequence | VTAADLLVLAPWLIFGAALAVICYRLLARRRASRRHRRDGR |
Number of Associated Samples | 102 |
Number of Associated Scaffolds | 137 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 69.85 % |
% of genes near scaffold ends (potentially truncated) | 24.09 % |
% of genes from short scaffolds (< 2000 bps) | 81.02 % |
Associated GOLD sequencing projects | 96 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.43 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (58.394 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (13.139 % of family members) |
Environment Ontology (ENVO) | Unclassified (21.168 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.336 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.17% β-sheet: 0.00% Coil/Unstructured: 47.83% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 137 Family Scaffolds |
---|---|---|
PF03741 | TerC | 27.01 |
PF04075 | F420H2_quin_red | 8.03 |
PF09335 | SNARE_assoc | 2.92 |
PF08327 | AHSA1 | 2.19 |
PF13631 | Cytochrom_B_N_2 | 2.19 |
PF12698 | ABC2_membrane_3 | 2.19 |
PF00096 | zf-C2H2 | 1.46 |
PF01161 | PBP | 1.46 |
PF00037 | Fer4 | 1.46 |
PF12840 | HTH_20 | 1.46 |
PF00072 | Response_reg | 0.73 |
PF13191 | AAA_16 | 0.73 |
PF00496 | SBP_bac_5 | 0.73 |
PF00534 | Glycos_transf_1 | 0.73 |
PF00583 | Acetyltransf_1 | 0.73 |
PF12680 | SnoaL_2 | 0.73 |
PF01156 | IU_nuc_hydro | 0.73 |
PF00486 | Trans_reg_C | 0.73 |
PF13826 | DUF4188 | 0.73 |
PF00115 | COX1 | 0.73 |
PF01906 | YbjQ_1 | 0.73 |
PF00005 | ABC_tran | 0.73 |
PF13344 | Hydrolase_6 | 0.73 |
PF00248 | Aldo_ket_red | 0.73 |
PF01061 | ABC2_membrane | 0.73 |
PF13546 | DDE_5 | 0.73 |
PF13683 | rve_3 | 0.73 |
PF09339 | HTH_IclR | 0.73 |
PF00291 | PALP | 0.73 |
PF02416 | TatA_B_E | 0.73 |
PF13411 | MerR_1 | 0.73 |
COG ID | Name | Functional Category | % Frequency in 137 Family Scaffolds |
---|---|---|---|
COG0861 | Tellurite resistance membrane protein TerC | Inorganic ion transport and metabolism [P] | 27.01 |
COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 2.92 |
COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 2.92 |
COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 2.92 |
COG1881 | Uncharacterized conserved protein, phosphatidylethanolamine-binding protein (PEBP) family | General function prediction only [R] | 1.46 |
COG0393 | Uncharacterized pentameric protein YbjQ, UPF0145 family | Function unknown [S] | 0.73 |
COG1826 | Twin-arginine protein secretion pathway components TatA and TatB | Intracellular trafficking, secretion, and vesicular transport [U] | 0.73 |
COG1957 | Inosine-uridine nucleoside N-ribohydrolase | Nucleotide transport and metabolism [F] | 0.73 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 58.39 % |
All Organisms | root | All Organisms | 41.61 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000364|INPhiseqgaiiFebDRAFT_101742572 | Not Available | 745 | Open in IMG/M |
3300004479|Ga0062595_100592675 | Not Available | 861 | Open in IMG/M |
3300005093|Ga0062594_102402958 | Not Available | 576 | Open in IMG/M |
3300005172|Ga0066683_10215678 | Not Available | 1186 | Open in IMG/M |
3300005332|Ga0066388_101106315 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1342 | Open in IMG/M |
3300005332|Ga0066388_104702426 | Not Available | 695 | Open in IMG/M |
3300005336|Ga0070680_101323868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 623 | Open in IMG/M |
3300005434|Ga0070709_10001065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 15156 | Open in IMG/M |
3300005434|Ga0070709_10319807 | Not Available | 1138 | Open in IMG/M |
3300005434|Ga0070709_11221655 | Not Available | 604 | Open in IMG/M |
3300005435|Ga0070714_100022200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5202 | Open in IMG/M |
3300005435|Ga0070714_100237090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → unclassified Chromatiales → Chromatiales bacterium 21-64-14 | 1683 | Open in IMG/M |
3300005437|Ga0070710_10186687 | Not Available | 1301 | Open in IMG/M |
3300005440|Ga0070705_100604780 | Not Available | 849 | Open in IMG/M |
3300005450|Ga0066682_10978010 | Not Available | 500 | Open in IMG/M |
3300005467|Ga0070706_100273164 | All Organisms → cellular organisms → Bacteria | 1577 | Open in IMG/M |
3300005468|Ga0070707_100664612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1005 | Open in IMG/M |
3300005540|Ga0066697_10351615 | Not Available | 858 | Open in IMG/M |
3300005548|Ga0070665_102313717 | Not Available | 540 | Open in IMG/M |
3300005563|Ga0068855_101591582 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → unclassified Symbiodinium → Symbiodinium sp. KB8 | 669 | Open in IMG/M |
3300005598|Ga0066706_10459194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1015 | Open in IMG/M |
3300005617|Ga0068859_102005807 | Not Available | 639 | Open in IMG/M |
3300005719|Ga0068861_102360956 | Not Available | 534 | Open in IMG/M |
3300005764|Ga0066903_100726852 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1757 | Open in IMG/M |
3300005764|Ga0066903_102604503 | Not Available | 980 | Open in IMG/M |
3300005764|Ga0066903_104680923 | Not Available | 728 | Open in IMG/M |
3300005764|Ga0066903_106776968 | Not Available | 595 | Open in IMG/M |
3300006028|Ga0070717_10417360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1207 | Open in IMG/M |
3300006058|Ga0075432_10286791 | Not Available | 679 | Open in IMG/M |
3300006059|Ga0075017_100069746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 2397 | Open in IMG/M |
3300006163|Ga0070715_10051142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1777 | Open in IMG/M |
3300006173|Ga0070716_101341395 | Not Available | 579 | Open in IMG/M |
3300006174|Ga0075014_100148198 | Not Available | 1144 | Open in IMG/M |
3300006845|Ga0075421_100860632 | Not Available | 1038 | Open in IMG/M |
3300006854|Ga0075425_100036843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5446 | Open in IMG/M |
3300006854|Ga0075425_100563724 | Not Available | 1311 | Open in IMG/M |
3300006854|Ga0075425_102154505 | Not Available | 622 | Open in IMG/M |
3300006871|Ga0075434_100238517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1838 | Open in IMG/M |
3300006914|Ga0075436_100075824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2328 | Open in IMG/M |
3300009012|Ga0066710_103438551 | Not Available | 600 | Open in IMG/M |
3300009137|Ga0066709_100275167 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2271 | Open in IMG/M |
3300009174|Ga0105241_10614029 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 984 | Open in IMG/M |
3300010043|Ga0126380_10305869 | Not Available | 1134 | Open in IMG/M |
3300010046|Ga0126384_10245619 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1444 | Open in IMG/M |
3300010047|Ga0126382_10005957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5526 | Open in IMG/M |
3300010047|Ga0126382_10030026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2968 | Open in IMG/M |
3300010048|Ga0126373_10382411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1428 | Open in IMG/M |
3300010360|Ga0126372_10261120 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1494 | Open in IMG/M |
3300010360|Ga0126372_10359516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 1310 | Open in IMG/M |
3300010360|Ga0126372_10637299 | Not Available | 1029 | Open in IMG/M |
3300010360|Ga0126372_12885404 | Not Available | 533 | Open in IMG/M |
3300010361|Ga0126378_10004670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 10503 | Open in IMG/M |
3300010361|Ga0126378_10821700 | Not Available | 1038 | Open in IMG/M |
3300010398|Ga0126383_10321843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1555 | Open in IMG/M |
3300010400|Ga0134122_11734186 | Not Available | 654 | Open in IMG/M |
3300012198|Ga0137364_10084162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia | 2206 | Open in IMG/M |
3300012199|Ga0137383_10545426 | Not Available | 849 | Open in IMG/M |
3300012201|Ga0137365_10026794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4448 | Open in IMG/M |
3300012201|Ga0137365_10417821 | Not Available | 989 | Open in IMG/M |
3300012211|Ga0137377_10007525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 8902 | Open in IMG/M |
3300012285|Ga0137370_10278076 | Not Available | 996 | Open in IMG/M |
3300012356|Ga0137371_10042298 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3518 | Open in IMG/M |
3300012356|Ga0137371_10150051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1827 | Open in IMG/M |
3300012356|Ga0137371_10225399 | Not Available | 1465 | Open in IMG/M |
3300012356|Ga0137371_10302638 | Not Available | 1245 | Open in IMG/M |
3300012929|Ga0137404_11876548 | Not Available | 558 | Open in IMG/M |
3300012960|Ga0164301_11057058 | Not Available | 642 | Open in IMG/M |
3300012971|Ga0126369_10237707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1784 | Open in IMG/M |
3300012971|Ga0126369_11150328 | Not Available | 865 | Open in IMG/M |
3300012984|Ga0164309_11159115 | Not Available | 646 | Open in IMG/M |
3300015372|Ga0132256_103319967 | Not Available | 541 | Open in IMG/M |
3300015373|Ga0132257_101150274 | Not Available | 981 | Open in IMG/M |
3300016357|Ga0182032_10098467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2058 | Open in IMG/M |
3300016404|Ga0182037_11267732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 649 | Open in IMG/M |
3300016445|Ga0182038_11726175 | Not Available | 564 | Open in IMG/M |
3300017654|Ga0134069_1330386 | Not Available | 546 | Open in IMG/M |
3300017947|Ga0187785_10532452 | Not Available | 591 | Open in IMG/M |
3300017959|Ga0187779_10048075 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2485 | Open in IMG/M |
3300017959|Ga0187779_10111031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 1660 | Open in IMG/M |
3300017959|Ga0187779_10757723 | Not Available | 660 | Open in IMG/M |
3300017973|Ga0187780_10396039 | Not Available | 979 | Open in IMG/M |
3300017974|Ga0187777_10124713 | Not Available | 1707 | Open in IMG/M |
3300017999|Ga0187767_10058834 | Not Available | 974 | Open in IMG/M |
3300017999|Ga0187767_10085516 | Not Available | 851 | Open in IMG/M |
3300018058|Ga0187766_10141935 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1486 | Open in IMG/M |
3300018058|Ga0187766_10550385 | Not Available | 782 | Open in IMG/M |
3300018060|Ga0187765_10005016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5592 | Open in IMG/M |
3300018060|Ga0187765_10014480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3636 | Open in IMG/M |
3300021560|Ga0126371_10669014 | Not Available | 1187 | Open in IMG/M |
3300021560|Ga0126371_11611472 | Not Available | 775 | Open in IMG/M |
3300021560|Ga0126371_11707770 | Not Available | 753 | Open in IMG/M |
3300021560|Ga0126371_12062721 | Not Available | 687 | Open in IMG/M |
3300022756|Ga0222622_11091765 | Not Available | 587 | Open in IMG/M |
3300025898|Ga0207692_10106029 | Not Available | 1551 | Open in IMG/M |
3300025915|Ga0207693_10123691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae | 2032 | Open in IMG/M |
3300025917|Ga0207660_11413151 | Not Available | 564 | Open in IMG/M |
3300025917|Ga0207660_11734807 | Not Available | 502 | Open in IMG/M |
3300025922|Ga0207646_10063484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3297 | Open in IMG/M |
3300025929|Ga0207664_10533442 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia | 1052 | Open in IMG/M |
3300025939|Ga0207665_10433924 | Not Available | 1006 | Open in IMG/M |
3300026088|Ga0207641_10733134 | Not Available | 975 | Open in IMG/M |
3300026295|Ga0209234_1075666 | Not Available | 1278 | Open in IMG/M |
3300026551|Ga0209648_10615818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 596 | Open in IMG/M |
3300027646|Ga0209466_1012899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1763 | Open in IMG/M |
3300027874|Ga0209465_10375235 | Not Available | 712 | Open in IMG/M |
3300027907|Ga0207428_10090161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2382 | Open in IMG/M |
3300028787|Ga0307323_10050982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1459 | Open in IMG/M |
3300031544|Ga0318534_10123510 | Not Available | 1488 | Open in IMG/M |
3300031546|Ga0318538_10150894 | Not Available | 1228 | Open in IMG/M |
3300031564|Ga0318573_10194581 | Not Available | 1074 | Open in IMG/M |
3300031640|Ga0318555_10090638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1602 | Open in IMG/M |
3300031668|Ga0318542_10047778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1932 | Open in IMG/M |
3300031668|Ga0318542_10079241 | Not Available | 1553 | Open in IMG/M |
3300031770|Ga0318521_10371963 | Not Available | 849 | Open in IMG/M |
3300031795|Ga0318557_10369818 | Not Available | 659 | Open in IMG/M |
3300031797|Ga0318550_10306365 | Not Available | 771 | Open in IMG/M |
3300031819|Ga0318568_10049891 | Not Available | 2410 | Open in IMG/M |
3300031835|Ga0318517_10530520 | Not Available | 530 | Open in IMG/M |
3300031896|Ga0318551_10217075 | Not Available | 1062 | Open in IMG/M |
3300031945|Ga0310913_10267221 | Not Available | 1204 | Open in IMG/M |
3300032076|Ga0306924_10550759 | Not Available | 1309 | Open in IMG/M |
3300032174|Ga0307470_10606704 | Not Available | 819 | Open in IMG/M |
3300032205|Ga0307472_100362653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1195 | Open in IMG/M |
3300032205|Ga0307472_102034453 | Not Available | 576 | Open in IMG/M |
3300032783|Ga0335079_10003326 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 18581 | Open in IMG/M |
3300032783|Ga0335079_10003417 | All Organisms → cellular organisms → Bacteria | 18364 | Open in IMG/M |
3300032783|Ga0335079_11150512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 783 | Open in IMG/M |
3300032783|Ga0335079_11352086 | Not Available | 709 | Open in IMG/M |
3300032805|Ga0335078_10050213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6168 | Open in IMG/M |
3300032805|Ga0335078_10378679 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1867 | Open in IMG/M |
3300032805|Ga0335078_10705967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1248 | Open in IMG/M |
3300032892|Ga0335081_10941808 | Not Available | 1013 | Open in IMG/M |
3300032898|Ga0335072_10387237 | All Organisms → cellular organisms → Bacteria | 1508 | Open in IMG/M |
3300032955|Ga0335076_10004357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 14317 | Open in IMG/M |
3300033290|Ga0318519_10294050 | Not Available | 949 | Open in IMG/M |
3300033808|Ga0314867_143024 | Not Available | 560 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 13.14% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 10.95% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.22% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 8.76% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.03% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 7.30% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.84% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.84% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.65% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.19% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.19% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.19% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 2.19% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.19% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.46% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.46% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.73% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.73% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.73% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.73% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.73% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.73% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.73% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.73% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.73% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
3300033808 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_20 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
INPhiseqgaiiFebDRAFT_1017425721 | 3300000364 | Soil | VVAITANLLVLAPWIIFGAGLAVICYRLLRRRAFTRRHRRDDR* |
Ga0062595_1005926752 | 3300004479 | Soil | VVAITANLLVLAPWLLFGAGLAVICYRLLRRRAFTRRHRRDDR* |
Ga0062594_1024029583 | 3300005093 | Soil | MEADVTAADLLVLAPWLIFGAAVAVICYRLLTRRGASRRNRRDGR* |
Ga0066683_102156782 | 3300005172 | Soil | VSGANLLVLAPWLIFGACVVAIGYRLLSRRGPDRRRRRDHR* |
Ga0066388_1011063151 | 3300005332 | Tropical Forest Soil | MEAEVTVADLLVLAPWVIFGAALAVICYRLLRRCGPSHRHQRGSR* |
Ga0066388_1047024262 | 3300005332 | Tropical Forest Soil | VTAANLLVLAPWLIFGAGLAVICYRLLARRGTCHRHRRDSR* |
Ga0070680_1013238681 | 3300005336 | Corn Rhizosphere | VVAITANLLVLAPWLIFGAGLAVICYRLLSRRASSHRHRRDDR* |
Ga0070709_1000106518 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VTAADLLVLAPWVIFGAALAVICYRLLARRRASRRHRRDGR* |
Ga0070709_103198072 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VTAADLLVLAPWLIFGAALAAICYRLLVRRRASRRHHRDGR* |
Ga0070709_112216551 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VTAADLLVLAPWLIFGAALAVICYRLLARRRASRRHRRDGR* |
Ga0070714_1000222001 | 3300005435 | Agricultural Soil | VTAADLLVLAPWLIFGAALAAICYRLLARRRASRRHHRDGR* |
Ga0070714_1002370905 | 3300005435 | Agricultural Soil | VTAADLLVLAPWLIFGAALAVICYRLLTRRRASRRHRRGGQ* |
Ga0070710_101866871 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | GGVTAADLLVLAPWLIFGAALAAICYRLLARRRASRRHHRDGR* |
Ga0070701_105266772 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | RHEHRQPRTAAMTGGDLVVLAPWVIFGACLAVICIRLLAWRRASRRHRR* |
Ga0070705_1006047801 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | VTAADLLVLAPWLIFGVALGVICYRLFARRRASRRHRDSR* |
Ga0066682_109780101 | 3300005450 | Soil | GVTAADLLVLAPWLIFGACVVAIGYRLLSRRGPDRRRRDRR* |
Ga0070706_1002731642 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VTAADLLVLAPWLIFGAALAAICYRLLTRRGACRRHRRGGR* |
Ga0070707_1006646122 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VTAADLLMVAPWLIFGGALAAICYRLLSRRSASGRHWRDSR* |
Ga0066697_103516152 | 3300005540 | Soil | MLEAGVSGANLLVLAPWLIFGACVVAIGYRLLSRRGPDRRRRRDHR* |
Ga0070665_1023137171 | 3300005548 | Switchgrass Rhizosphere | VAITANLLVLAPWLIFGAGLAVICYRLLSRRASSHRHRRDDR* |
Ga0068855_1015915821 | 3300005563 | Corn Rhizosphere | MLEAGVNGANLLVLAPWLIFGACVVAIGYRLLSRRGPDRRRRDRR* |
Ga0066706_104591941 | 3300005598 | Soil | VNGANLLVLAPWLIFGACVVAIGYRLLSRRGPDRRRRDRR* |
Ga0068859_1020058072 | 3300005617 | Switchgrass Rhizosphere | VTAADLLVLAPWLIFGAAVAVICYRLLTRRGASRRNRRDGR* |
Ga0068861_1023609561 | 3300005719 | Switchgrass Rhizosphere | VAITANLLVLAPWLIFGAGLAVICYRLLSRRASSHRHRRDD |
Ga0066903_1007268521 | 3300005764 | Tropical Forest Soil | VSGTDLLVLAPWLIFGACIIAICYRLFTRRGAARRRRRDGRE* |
Ga0066903_1026045032 | 3300005764 | Tropical Forest Soil | MEAEVTVADLLVLAPWVIFGAGLAVICYRLLRRCGPSHRHQRGSR* |
Ga0066903_1046809232 | 3300005764 | Tropical Forest Soil | VTAADLLVLAPWLIFGAGLAVICYRLLARRGACHRHRRDSR* |
Ga0066903_1067769681 | 3300005764 | Tropical Forest Soil | MEAEVTVADLLVLAPWVIFGAALAVICYRLLRSCGASHRHQRGSR* |
Ga0070717_104173602 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VTAADLLMVAPWLIFGGALAAICYRLLSRRSASGRR* |
Ga0075432_102867912 | 3300006058 | Populus Rhizosphere | VTAADLLVLAPWLIFGAALAVICYRLLARRRASRRHRRGGR* |
Ga0075017_1000697463 | 3300006059 | Watersheds | VTVADLLVLAPWVIFGAGLAVICYRLFSRCGPSHRHQRDSR* |
Ga0070715_100511423 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | GGGVTAADLLVLAPWLIFGAALAVICYRLLARRRASRRHRRDGR* |
Ga0070716_1013413951 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | RATCDGGGVTAADLLVLAPWLIFGAALAVICYRLLARRRASRRHRDSR* |
Ga0075014_1001481982 | 3300006174 | Watersheds | GKQRASDGGGVTVAELLVLAPWVIFGAGLAVICYRLFSRCGPSHRHQRDSR* |
Ga0075421_1008606321 | 3300006845 | Populus Rhizosphere | VTAADLLVLAPWLIFGAALAVICYRLLARRRASRRHRRGG |
Ga0075425_1000368436 | 3300006854 | Populus Rhizosphere | VTAADLLVLAPWLIFGAALAVICYRLLARRRASRRHRDSR* |
Ga0075425_1005637244 | 3300006854 | Populus Rhizosphere | VTAADLLVLAPWLIFGAALAAICYRLLTRRGAPRRHRRGRR* |
Ga0075425_1021545051 | 3300006854 | Populus Rhizosphere | VTAADLLVLAPWLIFGAALAAICYRLLTRRGASRRHRRNGQ* |
Ga0075434_1002385174 | 3300006871 | Populus Rhizosphere | GVNGANLLVLAPWLIFGACVVAIGYRLLSRRGPDRRRRDRR* |
Ga0075436_1000758245 | 3300006914 | Populus Rhizosphere | VNGASLLVLAPWLIFGACVVAIGYRLLSRRGPDRRRRDRR* |
Ga0066710_1034385511 | 3300009012 | Grasslands Soil | VTAADLLVLAPWLIFGAALAVICYRLLARRRASRRHSLGGR |
Ga0066709_1002751673 | 3300009137 | Grasslands Soil | MLEAGVSGANLLVLAPWLIFGACVVAIGYRLLSRRGPDRRRRDRR* |
Ga0105241_106140291 | 3300009174 | Corn Rhizosphere | VTAADLLVLAPWLIFGAAVAAICYRLLARRRASRRHHRDGR* |
Ga0126380_103058693 | 3300010043 | Tropical Forest Soil | VTAADLLVLAPWLIFGAALAVICYRLLARRGACHRHRRDSR* |
Ga0126384_102456192 | 3300010046 | Tropical Forest Soil | MVQQRAGGGVSGANLLVLVPWLIFGACVVAICCRLFTRRGAARRRRRDGRE* |
Ga0126382_100059571 | 3300010047 | Tropical Forest Soil | GGGVSGANLLVLVPWLIFGACVVAICCRLFTRRGAARRRRRDGRE* |
Ga0126382_100300265 | 3300010047 | Tropical Forest Soil | MVQQRAGGGVSGANLLVLVPWLIFGACVVAICCRLFTRRGAARRRR |
Ga0126373_103824113 | 3300010048 | Tropical Forest Soil | VTAVDLLVLAPWLVFGAGLSVLGYRLLAHRGRPRRHGR* |
Ga0126372_102611201 | 3300010360 | Tropical Forest Soil | VSGADLLVLAPWLIFGACVVAICYRLFTRRGAARRRRR |
Ga0126372_103595161 | 3300010360 | Tropical Forest Soil | FSRGIRMEAQVTVADLLVLAPWVIFGAGLAVICYRLLRRCGASHGHQRDSR* |
Ga0126372_106372992 | 3300010360 | Tropical Forest Soil | VTAANLLVLAPWLIFGAGLAVICYRLLARRGPCHRHRRDSR* |
Ga0126372_128854042 | 3300010360 | Tropical Forest Soil | VTAGDVLMVAPWLIFGGALAAICYRLLSRRSASGRH* |
Ga0126378_100046702 | 3300010361 | Tropical Forest Soil | VTAAHLLVLAPWLIFAAGLAVICGRLLIHRSASRRHHHDGR* |
Ga0126378_108217001 | 3300010361 | Tropical Forest Soil | VTAADLLVLAPWLIFGAGLAVICYRLLARRGTCHRHRRDSR* |
Ga0126383_103218433 | 3300010398 | Tropical Forest Soil | VLAPWVIFGAGLAVICYRLLRRCGASHGHQRDSR* |
Ga0134122_117341862 | 3300010400 | Terrestrial Soil | GQHVMEADVTAADLLVLAPWLIFGAAVAVICYRLLTRRGASRRNRRDGR* |
Ga0137364_100841624 | 3300012198 | Vadose Zone Soil | MEAEVTRADLLVLAPWLIFGAALAAICYRLLARRRASRRHRRGGR* |
Ga0137383_105454262 | 3300012199 | Vadose Zone Soil | VTAADLLVLAPWLIFGAALAVICYRLLTRRRASRRHRRDGR* |
Ga0137365_100267945 | 3300012201 | Vadose Zone Soil | VLEAGVTAANLLVLAPWLIFGACVVAISYRLLSRRRPDRRRRRDHR* |
Ga0137365_104178211 | 3300012201 | Vadose Zone Soil | MEAEVTAADLLVLAPWLIFGAALAAICYRLLARRRASRRHRRCGR* |
Ga0137377_100075259 | 3300012211 | Vadose Zone Soil | VTAANLLVLAPWLIFVAGLAAVCYRLLSHRSASHRHRRDSR* |
Ga0137370_102780761 | 3300012285 | Vadose Zone Soil | MEAEVTGADLLVLAPWLIFGAALAAICYRLLTRRRASRRHRRGDR* |
Ga0137371_100422981 | 3300012356 | Vadose Zone Soil | MEAEVTGADLLVLAPWLIFGAALAAICYRLLARRRASRRHRRGGR* |
Ga0137371_101500513 | 3300012356 | Vadose Zone Soil | MLEARVSGANLLVLAPWLIFGACVVAIGYRLLSRRGPDRRRRRDHR* |
Ga0137371_102253991 | 3300012356 | Vadose Zone Soil | MEAEVTAADLLVLAPWLIFGAALAAICYRLLARRGASRRHRRGGR* |
Ga0137371_103026382 | 3300012356 | Vadose Zone Soil | VTAANLLVLAPWLIFGAGLAVICYRLLARRGACHRHRRDSR* |
Ga0137404_118765481 | 3300012929 | Vadose Zone Soil | MEADVTAADLLVLAPWLIFGAALAAICYRLLARRRASRRHHRDGQ* |
Ga0164301_110570581 | 3300012960 | Soil | VTAADLLVLAPWLIFGAALAVICYRLLARRRASRRHHHRDGR* |
Ga0126369_102377073 | 3300012971 | Tropical Forest Soil | MEAEVTVADLLVLAPWVIFGAGLAVICYRLLRRCDASHRHQRGSR* |
Ga0126369_111503281 | 3300012971 | Tropical Forest Soil | AEGGGVTAANLLVLAPWLIFGAGLAVICYRLLARRGACHRHRRDSR* |
Ga0164309_111591151 | 3300012984 | Soil | MEADVTAADLLVLAPWLIFGAALAAICYRLLTRRGASRRNRRDGR* |
Ga0132256_1033199671 | 3300015372 | Arabidopsis Rhizosphere | MEADVTAADLVVLAPWLIFGAAVAVICYRLLTRRGASRRNRRDGR* |
Ga0132257_1011502743 | 3300015373 | Arabidopsis Rhizosphere | MEADVTAADLVVLAPWLIFGAALAVICYRLLARRRASRRHRDSR* |
Ga0182032_100984671 | 3300016357 | Soil | DMQCGKRMEAQVTVADLLVLAPWVIFGAGLAVICYRLLRRCGASHRHQRDSR |
Ga0182037_112677322 | 3300016404 | Soil | MEAQVTVADLLVLAPWVIFGAGLAVICYRLLRRCDASHRHQRDSR |
Ga0182038_117261751 | 3300016445 | Soil | VTVADLLVLAPWVIFGAGLAVICYRLLRRCNACHGHQ |
Ga0134069_13303861 | 3300017654 | Grasslands Soil | VNGANLLVLAPWLIFGACVVAIGYRLLSRRGPDRRRR |
Ga0187785_105324521 | 3300017947 | Tropical Peatland | MEAQVTVADLLVLAPWVIFGAGLAVICYRLLRRCGASHRHQRDSR |
Ga0187779_100480752 | 3300017959 | Tropical Peatland | VEEAEVTVADLLLLAPWVIFGAGLAVICYRLQRRCGAADRHQRDSR |
Ga0187779_101110312 | 3300017959 | Tropical Peatland | LTVADLLVLAPWVVFGAGLAVICYRLFSRCGASHRHQRDSR |
Ga0187779_107577231 | 3300017959 | Tropical Peatland | MEAEVTVADLLVLAPWVIFGAALAVICYQLLRRCGASHRHQRDSR |
Ga0187780_103960392 | 3300017973 | Tropical Peatland | VTVADLLLLAPWVIFGAGLAVICYRLQRRCGAADRHQRDSR |
Ga0187777_101247133 | 3300017974 | Tropical Peatland | VTAANLLVLAPWLIFGAALAAICYRLLIHRGASRRHRRDSR |
Ga0187767_100588342 | 3300017999 | Tropical Peatland | VTVADLLVLAPWVIFGAALAVICYRLLRRCGASHRHQRDSR |
Ga0187767_100855161 | 3300017999 | Tropical Peatland | VTVADLLLVAPWVIFGAGLAVICYRLQRRCGAADRHQRDSR |
Ga0187766_101419352 | 3300018058 | Tropical Peatland | MTTADLLVLAPWLIFGGGLGAIGYRLLSLRGRTHRDRRDTR |
Ga0187766_105503852 | 3300018058 | Tropical Peatland | VTVADLLVLAPWVIFGAGLAVICYRLQRRGGASDRHQRDSR |
Ga0187765_100050165 | 3300018060 | Tropical Peatland | VTVADLLVLVPWVIFGAGLAVICYRLYSRGASHRHQRDSR |
Ga0187765_100144803 | 3300018060 | Tropical Peatland | MTTADLLVLAPWLIFGGGLGAIGYRLLSLRGRAHRDRRDTR |
Ga0126371_106690141 | 3300021560 | Tropical Forest Soil | VTAANLLVLAPWLIFGAGLAVICYRLLARRGTCHRHRRDSR |
Ga0126371_116114721 | 3300021560 | Tropical Forest Soil | MEAEVTVADLLVLAPWVIFGAALAVICYRLLRSCGASHRHQRGSR |
Ga0126371_117077702 | 3300021560 | Tropical Forest Soil | VTAVDLLVLAPWLVFGAGLSVLGYRLLAHRGRPRRHGR |
Ga0126371_120627212 | 3300021560 | Tropical Forest Soil | MEAEVTVADLLVLAPWVIFGAGLAVICYRLLRRCGPSHRHQRGSR |
Ga0222622_110917651 | 3300022756 | Groundwater Sediment | MLEAGVSGANLLVLAPWLIFGACVVAIGYRLLSRRGPDRRRRRRDHR |
Ga0207692_101060291 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | TAADLLVLAPWLIFGAALAAICYRLLARRRASRRHHRDGR |
Ga0207693_101236914 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VTAADLLVLAPWLIFWAALAVICYRLLARRRASRRHRRD |
Ga0207660_114131511 | 3300025917 | Corn Rhizosphere | VTAADLLVLAPWLIFGAAVAVICYRLLTRRGASRRNRRDGR |
Ga0207660_117348072 | 3300025917 | Corn Rhizosphere | VAITANLLVLAPWLIFGAGLAVICYRLLSRRASSHRHRRDDR |
Ga0207646_100634842 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VTAADLLMVAPWLIFGGALAAICYRLLSRRSASGRHWRDSR |
Ga0207664_105334421 | 3300025929 | Agricultural Soil | VTAADLLVLAPWLIFGAALAVICYRLLARRRASRRHRRGGR |
Ga0207665_104339242 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MLEAGVNGANLLVLAPWLIFGACVVAIGYRLLSRRGPDRRRRDRR |
Ga0207641_107331341 | 3300026088 | Switchgrass Rhizosphere | VTAADLLVLAPWLIFGAALAAICYRLLARRRTSRRHRRGGR |
Ga0209234_10756662 | 3300026295 | Grasslands Soil | MLEAGVSGANLLVLAPWLIFGACVVAIGYRLLSRRGPDRRRRRDHR |
Ga0209648_106158182 | 3300026551 | Grasslands Soil | MEDAGLTGGDLVVLAPWLIFGAGLAAIGYGLMSRRRTSHR |
Ga0209466_10128992 | 3300027646 | Tropical Forest Soil | MVQQRAGGGVSGANLLVLVPWLIFGACVVAICCRLFTRRGAARRRRRDGRE |
Ga0209465_103752351 | 3300027874 | Tropical Forest Soil | VTAADLLVLAPWLIFGAGLAVICYRLLARRGACHRHRRDSR |
Ga0207428_100901615 | 3300027907 | Populus Rhizosphere | VNGANLLVLAPWLIFGACVVAIGYRLLSRRGPDRRRRDRR |
Ga0307323_100509821 | 3300028787 | Soil | VSGANLLVLAPWLIFGACVVAIGYRLLSRRGPDRRRRRDHR |
Ga0318534_101235102 | 3300031544 | Soil | VTVADLLVLAPWVIFGAGLAVICYRLLRRCSASHGHQ |
Ga0318538_101508942 | 3300031546 | Soil | VTVADLLVLAPWVIFGAGLAVICYRLLRRCSASHGHQRDIR |
Ga0318573_101945811 | 3300031564 | Soil | MEAQVTVADLLVLAPWVIFGAGLAVICYRLLRRCGASHGHQRDIR |
Ga0318555_100906382 | 3300031640 | Soil | MQCGKRMEAQVTVADLLVLAPWVIFGAGLAVICYRLLRRCSASHGHQRDIR |
Ga0318542_100477781 | 3300031668 | Soil | CPGTDMQCGKRMEAQVTVADLLVLAPWVIFGAGLAVICYRLLRRCGASHRHQRDSR |
Ga0318542_100792412 | 3300031668 | Soil | MQCGKRMEAQVTVADLLVLAPWVIFGAGLAVICYRLLRRCNACHGHQRDSR |
Ga0318521_103719632 | 3300031770 | Soil | VTVADLLVLAPWVIFGAGLAVICYRLLRRCSASHGH |
Ga0318557_103698182 | 3300031795 | Soil | MQCGKRMEAQVTVADLLVLAPWVIFGAGLAVICYRLLRRCGASHGHQRDIR |
Ga0318550_103063652 | 3300031797 | Soil | VLGPTVQPRQRMEAQVTVADLLVLAPWVIFGAGLAVICYRLLRRCGASHRHQRDSR |
Ga0318568_100498912 | 3300031819 | Soil | MQCGKRMEAQVTVADLLVLAPWVIFGAGLAVICYRLLRRCGASHGHQRDSR |
Ga0318517_105305201 | 3300031835 | Soil | GPTVQPRQRMEAQVTVADLLVLAPWVIFGAGLAVICYRLLRRCSASHGHQRDIR |
Ga0318551_102170751 | 3300031896 | Soil | MEAQVTVADLLVLAPWVIFGAGLAVICYRLLRRCNACHGHQRDSR |
Ga0310913_102672212 | 3300031945 | Soil | VTVADLLVLAPWVIFGAGLAVICYRLLRRCGASHGHQRDSR |
Ga0306924_105507592 | 3300032076 | Soil | MEAQVTVADLLVLAPWVIFGAGLAVICYRLLRRCGASHGHQRDSR |
Ga0307470_106067041 | 3300032174 | Hardwood Forest Soil | MEADVTAADLLVLAPWLIFGAAVAVICYRLLARRRASRRHRDGR |
Ga0307472_1003626532 | 3300032205 | Hardwood Forest Soil | VTVADLLVLAPWVIFGAGLAVICYRLLHRCGASHRHQRDSR |
Ga0307472_1020344531 | 3300032205 | Hardwood Forest Soil | VTAADLLVLAPWLIFGAALAVICYRLLTRRRASRRHRRGGQ |
Ga0335079_1000332616 | 3300032783 | Soil | MEAEVTVADLLVLAPWMIFGAALAVICYRLLRRCGTSGRHQRDSR |
Ga0335079_1000341720 | 3300032783 | Soil | VNAADLLVLAPWLLFGAGLAVIGYRLSRRGATSRRHRRRIR |
Ga0335079_111505121 | 3300032783 | Soil | MTTADLLVLAPWLIFGGGLGAIGCRLLSLRGRAHRDRRDTR |
Ga0335079_113520862 | 3300032783 | Soil | ITANLLVLAPWLIFGAGLAVICYRLLSRRAAAHRHRRDRR |
Ga0335078_100502136 | 3300032805 | Soil | VNAADLIVLAPWLLFGAGLGVIGYRLFHLRVTSHRRRRQIR |
Ga0335078_103786792 | 3300032805 | Soil | MAITANLLVLAPWLIFGAGLAAICYRLLSRRAARRRRRDHR |
Ga0335078_107059672 | 3300032805 | Soil | VTAITANLLVLAPWLIFGAGLAVICYRLLSRRAAAHRHRRDRR |
Ga0335081_109418081 | 3300032892 | Soil | MTTADLLVLAPWLIFGGGLGAIGYRLLSLRGRAHRDRRDTS |
Ga0335072_103872373 | 3300032898 | Soil | MADLLVLTPWLIFGAGLGAIGFRLLSQRGTTRRHRRDTRLRH |
Ga0335076_1000435710 | 3300032955 | Soil | VTAANLLVLAPWLIFGAALAAICYRLLTHRGASRRHRRDSR |
Ga0318519_102940502 | 3300033290 | Soil | VTVADLLVLAPWVIFGAGLAVICYRLLRRCGASHG |
Ga0314867_143024_57_182 | 3300033808 | Peatland | VNAADLIVLAPWLLFGAGLGVIGYRLFHPRVTSHRRHRQIR |
⦗Top⦘ |