NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F056948

Metagenome Family F056948

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F056948
Family Type Metagenome
Number of Sequences 137
Average Sequence Length 43 residues
Representative Sequence VTAADLLVLAPWLIFGAALAVICYRLLARRRASRRHRRDGR
Number of Associated Samples 102
Number of Associated Scaffolds 137

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 69.85 %
% of genes near scaffold ends (potentially truncated) 24.09 %
% of genes from short scaffolds (< 2000 bps) 81.02 %
Associated GOLD sequencing projects 96
AlphaFold2 3D model prediction Yes
3D model pTM-score0.43

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (58.394 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil
(13.139 % of family members)
Environment Ontology (ENVO) Unclassified
(21.168 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(42.336 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 52.17%    β-sheet: 0.00%    Coil/Unstructured: 47.83%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.43
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 137 Family Scaffolds
PF03741TerC 27.01
PF04075F420H2_quin_red 8.03
PF09335SNARE_assoc 2.92
PF08327AHSA1 2.19
PF13631Cytochrom_B_N_2 2.19
PF12698ABC2_membrane_3 2.19
PF00096zf-C2H2 1.46
PF01161PBP 1.46
PF00037Fer4 1.46
PF12840HTH_20 1.46
PF00072Response_reg 0.73
PF13191AAA_16 0.73
PF00496SBP_bac_5 0.73
PF00534Glycos_transf_1 0.73
PF00583Acetyltransf_1 0.73
PF12680SnoaL_2 0.73
PF01156IU_nuc_hydro 0.73
PF00486Trans_reg_C 0.73
PF13826DUF4188 0.73
PF00115COX1 0.73
PF01906YbjQ_1 0.73
PF00005ABC_tran 0.73
PF13344Hydrolase_6 0.73
PF00248Aldo_ket_red 0.73
PF01061ABC2_membrane 0.73
PF13546DDE_5 0.73
PF13683rve_3 0.73
PF09339HTH_IclR 0.73
PF00291PALP 0.73
PF02416TatA_B_E 0.73
PF13411MerR_1 0.73

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 137 Family Scaffolds
COG0861Tellurite resistance membrane protein TerCInorganic ion transport and metabolism [P] 27.01
COG0398Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 familyFunction unknown [S] 2.92
COG0586Membrane integrity protein DedA, putative transporter, DedA/Tvp38 familyCell wall/membrane/envelope biogenesis [M] 2.92
COG1238Uncharacterized membrane protein YqaA, VTT domainFunction unknown [S] 2.92
COG1881Uncharacterized conserved protein, phosphatidylethanolamine-binding protein (PEBP) familyGeneral function prediction only [R] 1.46
COG0393Uncharacterized pentameric protein YbjQ, UPF0145 familyFunction unknown [S] 0.73
COG1826Twin-arginine protein secretion pathway components TatA and TatBIntracellular trafficking, secretion, and vesicular transport [U] 0.73
COG1957Inosine-uridine nucleoside N-ribohydrolaseNucleotide transport and metabolism [F] 0.73


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A58.39 %
All OrganismsrootAll Organisms41.61 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_101742572Not Available745Open in IMG/M
3300004479|Ga0062595_100592675Not Available861Open in IMG/M
3300005093|Ga0062594_102402958Not Available576Open in IMG/M
3300005172|Ga0066683_10215678Not Available1186Open in IMG/M
3300005332|Ga0066388_101106315All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1342Open in IMG/M
3300005332|Ga0066388_104702426Not Available695Open in IMG/M
3300005336|Ga0070680_101323868All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium623Open in IMG/M
3300005434|Ga0070709_10001065All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia15156Open in IMG/M
3300005434|Ga0070709_10319807Not Available1138Open in IMG/M
3300005434|Ga0070709_11221655Not Available604Open in IMG/M
3300005435|Ga0070714_100022200All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia5202Open in IMG/M
3300005435|Ga0070714_100237090All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → unclassified Chromatiales → Chromatiales bacterium 21-64-141683Open in IMG/M
3300005437|Ga0070710_10186687Not Available1301Open in IMG/M
3300005440|Ga0070705_100604780Not Available849Open in IMG/M
3300005450|Ga0066682_10978010Not Available500Open in IMG/M
3300005467|Ga0070706_100273164All Organisms → cellular organisms → Bacteria1577Open in IMG/M
3300005468|Ga0070707_100664612All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1005Open in IMG/M
3300005540|Ga0066697_10351615Not Available858Open in IMG/M
3300005548|Ga0070665_102313717Not Available540Open in IMG/M
3300005563|Ga0068855_101591582All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → unclassified Symbiodinium → Symbiodinium sp. KB8669Open in IMG/M
3300005598|Ga0066706_10459194All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1015Open in IMG/M
3300005617|Ga0068859_102005807Not Available639Open in IMG/M
3300005719|Ga0068861_102360956Not Available534Open in IMG/M
3300005764|Ga0066903_100726852All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1757Open in IMG/M
3300005764|Ga0066903_102604503Not Available980Open in IMG/M
3300005764|Ga0066903_104680923Not Available728Open in IMG/M
3300005764|Ga0066903_106776968Not Available595Open in IMG/M
3300006028|Ga0070717_10417360All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1207Open in IMG/M
3300006058|Ga0075432_10286791Not Available679Open in IMG/M
3300006059|Ga0075017_100069746All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales2397Open in IMG/M
3300006163|Ga0070715_10051142All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1777Open in IMG/M
3300006173|Ga0070716_101341395Not Available579Open in IMG/M
3300006174|Ga0075014_100148198Not Available1144Open in IMG/M
3300006845|Ga0075421_100860632Not Available1038Open in IMG/M
3300006854|Ga0075425_100036843All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia5446Open in IMG/M
3300006854|Ga0075425_100563724Not Available1311Open in IMG/M
3300006854|Ga0075425_102154505Not Available622Open in IMG/M
3300006871|Ga0075434_100238517All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1838Open in IMG/M
3300006914|Ga0075436_100075824All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2328Open in IMG/M
3300009012|Ga0066710_103438551Not Available600Open in IMG/M
3300009137|Ga0066709_100275167All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2271Open in IMG/M
3300009174|Ga0105241_10614029All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces984Open in IMG/M
3300010043|Ga0126380_10305869Not Available1134Open in IMG/M
3300010046|Ga0126384_10245619All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1444Open in IMG/M
3300010047|Ga0126382_10005957All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia5526Open in IMG/M
3300010047|Ga0126382_10030026All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2968Open in IMG/M
3300010048|Ga0126373_10382411All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1428Open in IMG/M
3300010360|Ga0126372_10261120All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1494Open in IMG/M
3300010360|Ga0126372_10359516All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium1310Open in IMG/M
3300010360|Ga0126372_10637299Not Available1029Open in IMG/M
3300010360|Ga0126372_12885404Not Available533Open in IMG/M
3300010361|Ga0126378_10004670All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia10503Open in IMG/M
3300010361|Ga0126378_10821700Not Available1038Open in IMG/M
3300010398|Ga0126383_10321843All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1555Open in IMG/M
3300010400|Ga0134122_11734186Not Available654Open in IMG/M
3300012198|Ga0137364_10084162All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia2206Open in IMG/M
3300012199|Ga0137383_10545426Not Available849Open in IMG/M
3300012201|Ga0137365_10026794All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4448Open in IMG/M
3300012201|Ga0137365_10417821Not Available989Open in IMG/M
3300012211|Ga0137377_10007525All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia8902Open in IMG/M
3300012285|Ga0137370_10278076Not Available996Open in IMG/M
3300012356|Ga0137371_10042298All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3518Open in IMG/M
3300012356|Ga0137371_10150051All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1827Open in IMG/M
3300012356|Ga0137371_10225399Not Available1465Open in IMG/M
3300012356|Ga0137371_10302638Not Available1245Open in IMG/M
3300012929|Ga0137404_11876548Not Available558Open in IMG/M
3300012960|Ga0164301_11057058Not Available642Open in IMG/M
3300012971|Ga0126369_10237707All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1784Open in IMG/M
3300012971|Ga0126369_11150328Not Available865Open in IMG/M
3300012984|Ga0164309_11159115Not Available646Open in IMG/M
3300015372|Ga0132256_103319967Not Available541Open in IMG/M
3300015373|Ga0132257_101150274Not Available981Open in IMG/M
3300016357|Ga0182032_10098467All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2058Open in IMG/M
3300016404|Ga0182037_11267732All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria649Open in IMG/M
3300016445|Ga0182038_11726175Not Available564Open in IMG/M
3300017654|Ga0134069_1330386Not Available546Open in IMG/M
3300017947|Ga0187785_10532452Not Available591Open in IMG/M
3300017959|Ga0187779_10048075All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2485Open in IMG/M
3300017959|Ga0187779_10111031All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium1660Open in IMG/M
3300017959|Ga0187779_10757723Not Available660Open in IMG/M
3300017973|Ga0187780_10396039Not Available979Open in IMG/M
3300017974|Ga0187777_10124713Not Available1707Open in IMG/M
3300017999|Ga0187767_10058834Not Available974Open in IMG/M
3300017999|Ga0187767_10085516Not Available851Open in IMG/M
3300018058|Ga0187766_10141935All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1486Open in IMG/M
3300018058|Ga0187766_10550385Not Available782Open in IMG/M
3300018060|Ga0187765_10005016All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5592Open in IMG/M
3300018060|Ga0187765_10014480All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3636Open in IMG/M
3300021560|Ga0126371_10669014Not Available1187Open in IMG/M
3300021560|Ga0126371_11611472Not Available775Open in IMG/M
3300021560|Ga0126371_11707770Not Available753Open in IMG/M
3300021560|Ga0126371_12062721Not Available687Open in IMG/M
3300022756|Ga0222622_11091765Not Available587Open in IMG/M
3300025898|Ga0207692_10106029Not Available1551Open in IMG/M
3300025915|Ga0207693_10123691All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae2032Open in IMG/M
3300025917|Ga0207660_11413151Not Available564Open in IMG/M
3300025917|Ga0207660_11734807Not Available502Open in IMG/M
3300025922|Ga0207646_10063484All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3297Open in IMG/M
3300025929|Ga0207664_10533442All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia1052Open in IMG/M
3300025939|Ga0207665_10433924Not Available1006Open in IMG/M
3300026088|Ga0207641_10733134Not Available975Open in IMG/M
3300026295|Ga0209234_1075666Not Available1278Open in IMG/M
3300026551|Ga0209648_10615818All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii596Open in IMG/M
3300027646|Ga0209466_1012899All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1763Open in IMG/M
3300027874|Ga0209465_10375235Not Available712Open in IMG/M
3300027907|Ga0207428_10090161All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2382Open in IMG/M
3300028787|Ga0307323_10050982All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1459Open in IMG/M
3300031544|Ga0318534_10123510Not Available1488Open in IMG/M
3300031546|Ga0318538_10150894Not Available1228Open in IMG/M
3300031564|Ga0318573_10194581Not Available1074Open in IMG/M
3300031640|Ga0318555_10090638All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1602Open in IMG/M
3300031668|Ga0318542_10047778All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1932Open in IMG/M
3300031668|Ga0318542_10079241Not Available1553Open in IMG/M
3300031770|Ga0318521_10371963Not Available849Open in IMG/M
3300031795|Ga0318557_10369818Not Available659Open in IMG/M
3300031797|Ga0318550_10306365Not Available771Open in IMG/M
3300031819|Ga0318568_10049891Not Available2410Open in IMG/M
3300031835|Ga0318517_10530520Not Available530Open in IMG/M
3300031896|Ga0318551_10217075Not Available1062Open in IMG/M
3300031945|Ga0310913_10267221Not Available1204Open in IMG/M
3300032076|Ga0306924_10550759Not Available1309Open in IMG/M
3300032174|Ga0307470_10606704Not Available819Open in IMG/M
3300032205|Ga0307472_100362653All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1195Open in IMG/M
3300032205|Ga0307472_102034453Not Available576Open in IMG/M
3300032783|Ga0335079_10003326All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia18581Open in IMG/M
3300032783|Ga0335079_10003417All Organisms → cellular organisms → Bacteria18364Open in IMG/M
3300032783|Ga0335079_11150512All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium783Open in IMG/M
3300032783|Ga0335079_11352086Not Available709Open in IMG/M
3300032805|Ga0335078_10050213All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia6168Open in IMG/M
3300032805|Ga0335078_10378679All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1867Open in IMG/M
3300032805|Ga0335078_10705967All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1248Open in IMG/M
3300032892|Ga0335081_10941808Not Available1013Open in IMG/M
3300032898|Ga0335072_10387237All Organisms → cellular organisms → Bacteria1508Open in IMG/M
3300032955|Ga0335076_10004357All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia14317Open in IMG/M
3300033290|Ga0318519_10294050Not Available949Open in IMG/M
3300033808|Ga0314867_143024Not Available560Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil13.14%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere10.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil10.22%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland8.76%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.03%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil7.30%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil5.84%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere5.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.65%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.19%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.19%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.19%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil2.19%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.19%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.46%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.46%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.73%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.73%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.73%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.73%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.73%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.73%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.73%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.73%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.73%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017654Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300017999Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MGEnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026295Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300027646Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300033808Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_20EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10174257213300000364SoilVVAITANLLVLAPWIIFGAGLAVICYRLLRRRAFTRRHRRDDR*
Ga0062595_10059267523300004479SoilVVAITANLLVLAPWLLFGAGLAVICYRLLRRRAFTRRHRRDDR*
Ga0062594_10240295833300005093SoilMEADVTAADLLVLAPWLIFGAAVAVICYRLLTRRGASRRNRRDGR*
Ga0066683_1021567823300005172SoilVSGANLLVLAPWLIFGACVVAIGYRLLSRRGPDRRRRRDHR*
Ga0066388_10110631513300005332Tropical Forest SoilMEAEVTVADLLVLAPWVIFGAALAVICYRLLRRCGPSHRHQRGSR*
Ga0066388_10470242623300005332Tropical Forest SoilVTAANLLVLAPWLIFGAGLAVICYRLLARRGTCHRHRRDSR*
Ga0070680_10132386813300005336Corn RhizosphereVVAITANLLVLAPWLIFGAGLAVICYRLLSRRASSHRHRRDDR*
Ga0070709_10001065183300005434Corn, Switchgrass And Miscanthus RhizosphereVTAADLLVLAPWVIFGAALAVICYRLLARRRASRRHRRDGR*
Ga0070709_1031980723300005434Corn, Switchgrass And Miscanthus RhizosphereVTAADLLVLAPWLIFGAALAAICYRLLVRRRASRRHHRDGR*
Ga0070709_1122165513300005434Corn, Switchgrass And Miscanthus RhizosphereVTAADLLVLAPWLIFGAALAVICYRLLARRRASRRHRRDGR*
Ga0070714_10002220013300005435Agricultural SoilVTAADLLVLAPWLIFGAALAAICYRLLARRRASRRHHRDGR*
Ga0070714_10023709053300005435Agricultural SoilVTAADLLVLAPWLIFGAALAVICYRLLTRRRASRRHRRGGQ*
Ga0070710_1018668713300005437Corn, Switchgrass And Miscanthus RhizosphereGGVTAADLLVLAPWLIFGAALAAICYRLLARRRASRRHHRDGR*
Ga0070701_1052667723300005438Corn, Switchgrass And Miscanthus RhizosphereRHEHRQPRTAAMTGGDLVVLAPWVIFGACLAVICIRLLAWRRASRRHRR*
Ga0070705_10060478013300005440Corn, Switchgrass And Miscanthus RhizosphereVTAADLLVLAPWLIFGVALGVICYRLFARRRASRRHRDSR*
Ga0066682_1097801013300005450SoilGVTAADLLVLAPWLIFGACVVAIGYRLLSRRGPDRRRRDRR*
Ga0070706_10027316423300005467Corn, Switchgrass And Miscanthus RhizosphereVTAADLLVLAPWLIFGAALAAICYRLLTRRGACRRHRRGGR*
Ga0070707_10066461223300005468Corn, Switchgrass And Miscanthus RhizosphereVTAADLLMVAPWLIFGGALAAICYRLLSRRSASGRHWRDSR*
Ga0066697_1035161523300005540SoilMLEAGVSGANLLVLAPWLIFGACVVAIGYRLLSRRGPDRRRRRDHR*
Ga0070665_10231371713300005548Switchgrass RhizosphereVAITANLLVLAPWLIFGAGLAVICYRLLSRRASSHRHRRDDR*
Ga0068855_10159158213300005563Corn RhizosphereMLEAGVNGANLLVLAPWLIFGACVVAIGYRLLSRRGPDRRRRDRR*
Ga0066706_1045919413300005598SoilVNGANLLVLAPWLIFGACVVAIGYRLLSRRGPDRRRRDRR*
Ga0068859_10200580723300005617Switchgrass RhizosphereVTAADLLVLAPWLIFGAAVAVICYRLLTRRGASRRNRRDGR*
Ga0068861_10236095613300005719Switchgrass RhizosphereVAITANLLVLAPWLIFGAGLAVICYRLLSRRASSHRHRRDD
Ga0066903_10072685213300005764Tropical Forest SoilVSGTDLLVLAPWLIFGACIIAICYRLFTRRGAARRRRRDGRE*
Ga0066903_10260450323300005764Tropical Forest SoilMEAEVTVADLLVLAPWVIFGAGLAVICYRLLRRCGPSHRHQRGSR*
Ga0066903_10468092323300005764Tropical Forest SoilVTAADLLVLAPWLIFGAGLAVICYRLLARRGACHRHRRDSR*
Ga0066903_10677696813300005764Tropical Forest SoilMEAEVTVADLLVLAPWVIFGAALAVICYRLLRSCGASHRHQRGSR*
Ga0070717_1041736023300006028Corn, Switchgrass And Miscanthus RhizosphereVTAADLLMVAPWLIFGGALAAICYRLLSRRSASGRR*
Ga0075432_1028679123300006058Populus RhizosphereVTAADLLVLAPWLIFGAALAVICYRLLARRRASRRHRRGGR*
Ga0075017_10006974633300006059WatershedsVTVADLLVLAPWVIFGAGLAVICYRLFSRCGPSHRHQRDSR*
Ga0070715_1005114233300006163Corn, Switchgrass And Miscanthus RhizosphereGGGVTAADLLVLAPWLIFGAALAVICYRLLARRRASRRHRRDGR*
Ga0070716_10134139513300006173Corn, Switchgrass And Miscanthus RhizosphereRATCDGGGVTAADLLVLAPWLIFGAALAVICYRLLARRRASRRHRDSR*
Ga0075014_10014819823300006174WatershedsGKQRASDGGGVTVAELLVLAPWVIFGAGLAVICYRLFSRCGPSHRHQRDSR*
Ga0075421_10086063213300006845Populus RhizosphereVTAADLLVLAPWLIFGAALAVICYRLLARRRASRRHRRGG
Ga0075425_10003684363300006854Populus RhizosphereVTAADLLVLAPWLIFGAALAVICYRLLARRRASRRHRDSR*
Ga0075425_10056372443300006854Populus RhizosphereVTAADLLVLAPWLIFGAALAAICYRLLTRRGAPRRHRRGRR*
Ga0075425_10215450513300006854Populus RhizosphereVTAADLLVLAPWLIFGAALAAICYRLLTRRGASRRHRRNGQ*
Ga0075434_10023851743300006871Populus RhizosphereGVNGANLLVLAPWLIFGACVVAIGYRLLSRRGPDRRRRDRR*
Ga0075436_10007582453300006914Populus RhizosphereVNGASLLVLAPWLIFGACVVAIGYRLLSRRGPDRRRRDRR*
Ga0066710_10343855113300009012Grasslands SoilVTAADLLVLAPWLIFGAALAVICYRLLARRRASRRHSLGGR
Ga0066709_10027516733300009137Grasslands SoilMLEAGVSGANLLVLAPWLIFGACVVAIGYRLLSRRGPDRRRRDRR*
Ga0105241_1061402913300009174Corn RhizosphereVTAADLLVLAPWLIFGAAVAAICYRLLARRRASRRHHRDGR*
Ga0126380_1030586933300010043Tropical Forest SoilVTAADLLVLAPWLIFGAALAVICYRLLARRGACHRHRRDSR*
Ga0126384_1024561923300010046Tropical Forest SoilMVQQRAGGGVSGANLLVLVPWLIFGACVVAICCRLFTRRGAARRRRRDGRE*
Ga0126382_1000595713300010047Tropical Forest SoilGGGVSGANLLVLVPWLIFGACVVAICCRLFTRRGAARRRRRDGRE*
Ga0126382_1003002653300010047Tropical Forest SoilMVQQRAGGGVSGANLLVLVPWLIFGACVVAICCRLFTRRGAARRRR
Ga0126373_1038241133300010048Tropical Forest SoilVTAVDLLVLAPWLVFGAGLSVLGYRLLAHRGRPRRHGR*
Ga0126372_1026112013300010360Tropical Forest SoilVSGADLLVLAPWLIFGACVVAICYRLFTRRGAARRRRR
Ga0126372_1035951613300010360Tropical Forest SoilFSRGIRMEAQVTVADLLVLAPWVIFGAGLAVICYRLLRRCGASHGHQRDSR*
Ga0126372_1063729923300010360Tropical Forest SoilVTAANLLVLAPWLIFGAGLAVICYRLLARRGPCHRHRRDSR*
Ga0126372_1288540423300010360Tropical Forest SoilVTAGDVLMVAPWLIFGGALAAICYRLLSRRSASGRH*
Ga0126378_1000467023300010361Tropical Forest SoilVTAAHLLVLAPWLIFAAGLAVICGRLLIHRSASRRHHHDGR*
Ga0126378_1082170013300010361Tropical Forest SoilVTAADLLVLAPWLIFGAGLAVICYRLLARRGTCHRHRRDSR*
Ga0126383_1032184333300010398Tropical Forest SoilVLAPWVIFGAGLAVICYRLLRRCGASHGHQRDSR*
Ga0134122_1173418623300010400Terrestrial SoilGQHVMEADVTAADLLVLAPWLIFGAAVAVICYRLLTRRGASRRNRRDGR*
Ga0137364_1008416243300012198Vadose Zone SoilMEAEVTRADLLVLAPWLIFGAALAAICYRLLARRRASRRHRRGGR*
Ga0137383_1054542623300012199Vadose Zone SoilVTAADLLVLAPWLIFGAALAVICYRLLTRRRASRRHRRDGR*
Ga0137365_1002679453300012201Vadose Zone SoilVLEAGVTAANLLVLAPWLIFGACVVAISYRLLSRRRPDRRRRRDHR*
Ga0137365_1041782113300012201Vadose Zone SoilMEAEVTAADLLVLAPWLIFGAALAAICYRLLARRRASRRHRRCGR*
Ga0137377_1000752593300012211Vadose Zone SoilVTAANLLVLAPWLIFVAGLAAVCYRLLSHRSASHRHRRDSR*
Ga0137370_1027807613300012285Vadose Zone SoilMEAEVTGADLLVLAPWLIFGAALAAICYRLLTRRRASRRHRRGDR*
Ga0137371_1004229813300012356Vadose Zone SoilMEAEVTGADLLVLAPWLIFGAALAAICYRLLARRRASRRHRRGGR*
Ga0137371_1015005133300012356Vadose Zone SoilMLEARVSGANLLVLAPWLIFGACVVAIGYRLLSRRGPDRRRRRDHR*
Ga0137371_1022539913300012356Vadose Zone SoilMEAEVTAADLLVLAPWLIFGAALAAICYRLLARRGASRRHRRGGR*
Ga0137371_1030263823300012356Vadose Zone SoilVTAANLLVLAPWLIFGAGLAVICYRLLARRGACHRHRRDSR*
Ga0137404_1187654813300012929Vadose Zone SoilMEADVTAADLLVLAPWLIFGAALAAICYRLLARRRASRRHHRDGQ*
Ga0164301_1105705813300012960SoilVTAADLLVLAPWLIFGAALAVICYRLLARRRASRRHHHRDGR*
Ga0126369_1023770733300012971Tropical Forest SoilMEAEVTVADLLVLAPWVIFGAGLAVICYRLLRRCDASHRHQRGSR*
Ga0126369_1115032813300012971Tropical Forest SoilAEGGGVTAANLLVLAPWLIFGAGLAVICYRLLARRGACHRHRRDSR*
Ga0164309_1115911513300012984SoilMEADVTAADLLVLAPWLIFGAALAAICYRLLTRRGASRRNRRDGR*
Ga0132256_10331996713300015372Arabidopsis RhizosphereMEADVTAADLVVLAPWLIFGAAVAVICYRLLTRRGASRRNRRDGR*
Ga0132257_10115027433300015373Arabidopsis RhizosphereMEADVTAADLVVLAPWLIFGAALAVICYRLLARRRASRRHRDSR*
Ga0182032_1009846713300016357SoilDMQCGKRMEAQVTVADLLVLAPWVIFGAGLAVICYRLLRRCGASHRHQRDSR
Ga0182037_1126773223300016404SoilMEAQVTVADLLVLAPWVIFGAGLAVICYRLLRRCDASHRHQRDSR
Ga0182038_1172617513300016445SoilVTVADLLVLAPWVIFGAGLAVICYRLLRRCNACHGHQ
Ga0134069_133038613300017654Grasslands SoilVNGANLLVLAPWLIFGACVVAIGYRLLSRRGPDRRRR
Ga0187785_1053245213300017947Tropical PeatlandMEAQVTVADLLVLAPWVIFGAGLAVICYRLLRRCGASHRHQRDSR
Ga0187779_1004807523300017959Tropical PeatlandVEEAEVTVADLLLLAPWVIFGAGLAVICYRLQRRCGAADRHQRDSR
Ga0187779_1011103123300017959Tropical PeatlandLTVADLLVLAPWVVFGAGLAVICYRLFSRCGASHRHQRDSR
Ga0187779_1075772313300017959Tropical PeatlandMEAEVTVADLLVLAPWVIFGAALAVICYQLLRRCGASHRHQRDSR
Ga0187780_1039603923300017973Tropical PeatlandVTVADLLLLAPWVIFGAGLAVICYRLQRRCGAADRHQRDSR
Ga0187777_1012471333300017974Tropical PeatlandVTAANLLVLAPWLIFGAALAAICYRLLIHRGASRRHRRDSR
Ga0187767_1005883423300017999Tropical PeatlandVTVADLLVLAPWVIFGAALAVICYRLLRRCGASHRHQRDSR
Ga0187767_1008551613300017999Tropical PeatlandVTVADLLLVAPWVIFGAGLAVICYRLQRRCGAADRHQRDSR
Ga0187766_1014193523300018058Tropical PeatlandMTTADLLVLAPWLIFGGGLGAIGYRLLSLRGRTHRDRRDTR
Ga0187766_1055038523300018058Tropical PeatlandVTVADLLVLAPWVIFGAGLAVICYRLQRRGGASDRHQRDSR
Ga0187765_1000501653300018060Tropical PeatlandVTVADLLVLVPWVIFGAGLAVICYRLYSRGASHRHQRDSR
Ga0187765_1001448033300018060Tropical PeatlandMTTADLLVLAPWLIFGGGLGAIGYRLLSLRGRAHRDRRDTR
Ga0126371_1066901413300021560Tropical Forest SoilVTAANLLVLAPWLIFGAGLAVICYRLLARRGTCHRHRRDSR
Ga0126371_1161147213300021560Tropical Forest SoilMEAEVTVADLLVLAPWVIFGAALAVICYRLLRSCGASHRHQRGSR
Ga0126371_1170777023300021560Tropical Forest SoilVTAVDLLVLAPWLVFGAGLSVLGYRLLAHRGRPRRHGR
Ga0126371_1206272123300021560Tropical Forest SoilMEAEVTVADLLVLAPWVIFGAGLAVICYRLLRRCGPSHRHQRGSR
Ga0222622_1109176513300022756Groundwater SedimentMLEAGVSGANLLVLAPWLIFGACVVAIGYRLLSRRGPDRRRRRRDHR
Ga0207692_1010602913300025898Corn, Switchgrass And Miscanthus RhizosphereTAADLLVLAPWLIFGAALAAICYRLLARRRASRRHHRDGR
Ga0207693_1012369143300025915Corn, Switchgrass And Miscanthus RhizosphereVTAADLLVLAPWLIFWAALAVICYRLLARRRASRRHRRD
Ga0207660_1141315113300025917Corn RhizosphereVTAADLLVLAPWLIFGAAVAVICYRLLTRRGASRRNRRDGR
Ga0207660_1173480723300025917Corn RhizosphereVAITANLLVLAPWLIFGAGLAVICYRLLSRRASSHRHRRDDR
Ga0207646_1006348423300025922Corn, Switchgrass And Miscanthus RhizosphereVTAADLLMVAPWLIFGGALAAICYRLLSRRSASGRHWRDSR
Ga0207664_1053344213300025929Agricultural SoilVTAADLLVLAPWLIFGAALAVICYRLLARRRASRRHRRGGR
Ga0207665_1043392423300025939Corn, Switchgrass And Miscanthus RhizosphereMLEAGVNGANLLVLAPWLIFGACVVAIGYRLLSRRGPDRRRRDRR
Ga0207641_1073313413300026088Switchgrass RhizosphereVTAADLLVLAPWLIFGAALAAICYRLLARRRTSRRHRRGGR
Ga0209234_107566623300026295Grasslands SoilMLEAGVSGANLLVLAPWLIFGACVVAIGYRLLSRRGPDRRRRRDHR
Ga0209648_1061581823300026551Grasslands SoilMEDAGLTGGDLVVLAPWLIFGAGLAAIGYGLMSRRRTSHR
Ga0209466_101289923300027646Tropical Forest SoilMVQQRAGGGVSGANLLVLVPWLIFGACVVAICCRLFTRRGAARRRRRDGRE
Ga0209465_1037523513300027874Tropical Forest SoilVTAADLLVLAPWLIFGAGLAVICYRLLARRGACHRHRRDSR
Ga0207428_1009016153300027907Populus RhizosphereVNGANLLVLAPWLIFGACVVAIGYRLLSRRGPDRRRRDRR
Ga0307323_1005098213300028787SoilVSGANLLVLAPWLIFGACVVAIGYRLLSRRGPDRRRRRDHR
Ga0318534_1012351023300031544SoilVTVADLLVLAPWVIFGAGLAVICYRLLRRCSASHGHQ
Ga0318538_1015089423300031546SoilVTVADLLVLAPWVIFGAGLAVICYRLLRRCSASHGHQRDIR
Ga0318573_1019458113300031564SoilMEAQVTVADLLVLAPWVIFGAGLAVICYRLLRRCGASHGHQRDIR
Ga0318555_1009063823300031640SoilMQCGKRMEAQVTVADLLVLAPWVIFGAGLAVICYRLLRRCSASHGHQRDIR
Ga0318542_1004777813300031668SoilCPGTDMQCGKRMEAQVTVADLLVLAPWVIFGAGLAVICYRLLRRCGASHRHQRDSR
Ga0318542_1007924123300031668SoilMQCGKRMEAQVTVADLLVLAPWVIFGAGLAVICYRLLRRCNACHGHQRDSR
Ga0318521_1037196323300031770SoilVTVADLLVLAPWVIFGAGLAVICYRLLRRCSASHGH
Ga0318557_1036981823300031795SoilMQCGKRMEAQVTVADLLVLAPWVIFGAGLAVICYRLLRRCGASHGHQRDIR
Ga0318550_1030636523300031797SoilVLGPTVQPRQRMEAQVTVADLLVLAPWVIFGAGLAVICYRLLRRCGASHRHQRDSR
Ga0318568_1004989123300031819SoilMQCGKRMEAQVTVADLLVLAPWVIFGAGLAVICYRLLRRCGASHGHQRDSR
Ga0318517_1053052013300031835SoilGPTVQPRQRMEAQVTVADLLVLAPWVIFGAGLAVICYRLLRRCSASHGHQRDIR
Ga0318551_1021707513300031896SoilMEAQVTVADLLVLAPWVIFGAGLAVICYRLLRRCNACHGHQRDSR
Ga0310913_1026722123300031945SoilVTVADLLVLAPWVIFGAGLAVICYRLLRRCGASHGHQRDSR
Ga0306924_1055075923300032076SoilMEAQVTVADLLVLAPWVIFGAGLAVICYRLLRRCGASHGHQRDSR
Ga0307470_1060670413300032174Hardwood Forest SoilMEADVTAADLLVLAPWLIFGAAVAVICYRLLARRRASRRHRDGR
Ga0307472_10036265323300032205Hardwood Forest SoilVTVADLLVLAPWVIFGAGLAVICYRLLHRCGASHRHQRDSR
Ga0307472_10203445313300032205Hardwood Forest SoilVTAADLLVLAPWLIFGAALAVICYRLLTRRRASRRHRRGGQ
Ga0335079_10003326163300032783SoilMEAEVTVADLLVLAPWMIFGAALAVICYRLLRRCGTSGRHQRDSR
Ga0335079_10003417203300032783SoilVNAADLLVLAPWLLFGAGLAVIGYRLSRRGATSRRHRRRIR
Ga0335079_1115051213300032783SoilMTTADLLVLAPWLIFGGGLGAIGCRLLSLRGRAHRDRRDTR
Ga0335079_1135208623300032783SoilITANLLVLAPWLIFGAGLAVICYRLLSRRAAAHRHRRDRR
Ga0335078_1005021363300032805SoilVNAADLIVLAPWLLFGAGLGVIGYRLFHLRVTSHRRRRQIR
Ga0335078_1037867923300032805SoilMAITANLLVLAPWLIFGAGLAAICYRLLSRRAARRRRRDHR
Ga0335078_1070596723300032805SoilVTAITANLLVLAPWLIFGAGLAVICYRLLSRRAAAHRHRRDRR
Ga0335081_1094180813300032892SoilMTTADLLVLAPWLIFGGGLGAIGYRLLSLRGRAHRDRRDTS
Ga0335072_1038723733300032898SoilMADLLVLTPWLIFGAGLGAIGFRLLSQRGTTRRHRRDTRLRH
Ga0335076_10004357103300032955SoilVTAANLLVLAPWLIFGAALAAICYRLLTHRGASRRHRRDSR
Ga0318519_1029405023300033290SoilVTVADLLVLAPWVIFGAGLAVICYRLLRRCGASHG
Ga0314867_143024_57_1823300033808PeatlandVNAADLIVLAPWLLFGAGLGVIGYRLFHPRVTSHRRHRQIR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.