Basic Information | |
---|---|
Family ID | F057255 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 136 |
Average Sequence Length | 39 residues |
Representative Sequence | MSQIGEPLRIIEVEPLEEPVPEKEVPFEQPADPVKEPA |
Number of Associated Samples | 113 |
Number of Associated Scaffolds | 136 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 77.94 % |
% of genes near scaffold ends (potentially truncated) | 21.32 % |
% of genes from short scaffolds (< 2000 bps) | 91.91 % |
Associated GOLD sequencing projects | 106 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (69.118 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil (13.235 % of family members) |
Environment Ontology (ENVO) | Unclassified (27.206 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.059 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 136 Family Scaffolds |
---|---|---|
PF08811 | DUF1800 | 2.94 |
PF00589 | Phage_integrase | 1.47 |
PF13414 | TPR_11 | 1.47 |
PF13432 | TPR_16 | 0.74 |
PF00034 | Cytochrom_C | 0.74 |
PF00127 | Copper-bind | 0.74 |
PF07609 | DUF1572 | 0.74 |
PF00486 | Trans_reg_C | 0.74 |
PF04986 | Y2_Tnp | 0.74 |
PF00654 | Voltage_CLC | 0.74 |
PF07676 | PD40 | 0.74 |
PF13683 | rve_3 | 0.74 |
PF01872 | RibD_C | 0.74 |
PF13505 | OMP_b-brl | 0.74 |
PF12697 | Abhydrolase_6 | 0.74 |
PF02641 | DUF190 | 0.74 |
PF13577 | SnoaL_4 | 0.74 |
PF13453 | zf-TFIIB | 0.74 |
PF11954 | DUF3471 | 0.74 |
COG ID | Name | Functional Category | % Frequency in 136 Family Scaffolds |
---|---|---|---|
COG5267 | Uncharacterized conserved protein, DUF1800 family | Function unknown [S] | 2.94 |
COG0038 | H+/Cl- antiporter ClcA | Inorganic ion transport and metabolism [P] | 0.74 |
COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.74 |
COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.74 |
COG1993 | PII-like signaling protein | Signal transduction mechanisms [T] | 0.74 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 69.85 % |
Unclassified | root | N/A | 30.15 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459010|GIO7OMY02JWIBD | Not Available | 501 | Open in IMG/M |
3300004025|Ga0055433_10086029 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
3300004633|Ga0066395_10776478 | Not Available | 573 | Open in IMG/M |
3300005332|Ga0066388_100251211 | All Organisms → cellular organisms → Bacteria | 2407 | Open in IMG/M |
3300005332|Ga0066388_100394744 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2029 | Open in IMG/M |
3300005332|Ga0066388_108610361 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300005334|Ga0068869_100717978 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
3300005367|Ga0070667_100720330 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 924 | Open in IMG/M |
3300005434|Ga0070709_10956260 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 680 | Open in IMG/M |
3300005507|Ga0074259_10892405 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
3300005537|Ga0070730_10701985 | Not Available | 641 | Open in IMG/M |
3300005617|Ga0068859_101711714 | Not Available | 694 | Open in IMG/M |
3300005713|Ga0066905_101238294 | Not Available | 669 | Open in IMG/M |
3300005764|Ga0066903_100466790 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2119 | Open in IMG/M |
3300005764|Ga0066903_101721460 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1194 | Open in IMG/M |
3300005764|Ga0066903_102029359 | All Organisms → cellular organisms → Bacteria | 1105 | Open in IMG/M |
3300005764|Ga0066903_102798267 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 946 | Open in IMG/M |
3300005764|Ga0066903_103143255 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 893 | Open in IMG/M |
3300005764|Ga0066903_103667138 | Not Available | 826 | Open in IMG/M |
3300005764|Ga0066903_105723318 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 653 | Open in IMG/M |
3300005764|Ga0066903_106173175 | Not Available | 626 | Open in IMG/M |
3300005764|Ga0066903_106303193 | Not Available | 619 | Open in IMG/M |
3300005764|Ga0066903_108446976 | Not Available | 525 | Open in IMG/M |
3300005829|Ga0074479_10269394 | Not Available | 830 | Open in IMG/M |
3300006047|Ga0075024_100362122 | Not Available | 728 | Open in IMG/M |
3300006059|Ga0075017_101662205 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300006086|Ga0075019_10576382 | Not Available | 704 | Open in IMG/M |
3300006791|Ga0066653_10045491 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1804 | Open in IMG/M |
3300006797|Ga0066659_10616822 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 881 | Open in IMG/M |
3300006844|Ga0075428_100527803 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1262 | Open in IMG/M |
3300006845|Ga0075421_100030268 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6845 | Open in IMG/M |
3300006854|Ga0075425_100935142 | Not Available | 990 | Open in IMG/M |
3300006854|Ga0075425_102263941 | Not Available | 604 | Open in IMG/M |
3300006969|Ga0075419_10215680 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1274 | Open in IMG/M |
3300009092|Ga0105250_10319092 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
3300009094|Ga0111539_10096984 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3463 | Open in IMG/M |
3300009094|Ga0111539_10866847 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1050 | Open in IMG/M |
3300009098|Ga0105245_11543133 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
3300009100|Ga0075418_10106772 | All Organisms → cellular organisms → Bacteria | 2973 | Open in IMG/M |
3300009147|Ga0114129_12566966 | Not Available | 608 | Open in IMG/M |
3300010043|Ga0126380_10738253 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 797 | Open in IMG/M |
3300010048|Ga0126373_10021804 | All Organisms → cellular organisms → Bacteria | 5427 | Open in IMG/M |
3300010329|Ga0134111_10331352 | Not Available | 640 | Open in IMG/M |
3300010360|Ga0126372_10202044 | All Organisms → cellular organisms → Bacteria | 1656 | Open in IMG/M |
3300010360|Ga0126372_12446615 | Not Available | 573 | Open in IMG/M |
3300010366|Ga0126379_11217695 | Not Available | 859 | Open in IMG/M |
3300010366|Ga0126379_12886573 | Not Available | 575 | Open in IMG/M |
3300010366|Ga0126379_13545978 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300010376|Ga0126381_101366558 | Not Available | 1024 | Open in IMG/M |
3300010379|Ga0136449_101223710 | Not Available | 1180 | Open in IMG/M |
3300010398|Ga0126383_10701641 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1090 | Open in IMG/M |
3300010398|Ga0126383_11642274 | Not Available | 732 | Open in IMG/M |
3300010937|Ga0137776_1849832 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1576 | Open in IMG/M |
3300011120|Ga0150983_10387828 | Not Available | 587 | Open in IMG/M |
3300012189|Ga0137388_12017279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 505 | Open in IMG/M |
3300012203|Ga0137399_10181641 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1699 | Open in IMG/M |
3300012211|Ga0137377_10545654 | All Organisms → cellular organisms → Bacteria | 1097 | Open in IMG/M |
3300012469|Ga0150984_103022433 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1116 | Open in IMG/M |
3300012469|Ga0150984_108154214 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
3300012498|Ga0157345_1018873 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
3300012505|Ga0157339_1006894 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
3300012506|Ga0157324_1013366 | Not Available | 741 | Open in IMG/M |
3300012511|Ga0157332_1036145 | Not Available | 653 | Open in IMG/M |
3300012515|Ga0157338_1010014 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 949 | Open in IMG/M |
3300012683|Ga0137398_11132716 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300012905|Ga0157296_10086264 | Not Available | 827 | Open in IMG/M |
3300012917|Ga0137395_10265433 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1209 | Open in IMG/M |
3300012944|Ga0137410_10868328 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 761 | Open in IMG/M |
3300012951|Ga0164300_10160760 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1063 | Open in IMG/M |
3300012971|Ga0126369_10996387 | Not Available | 925 | Open in IMG/M |
3300012971|Ga0126369_12392535 | Not Available | 614 | Open in IMG/M |
3300012986|Ga0164304_10589868 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 827 | Open in IMG/M |
3300013296|Ga0157374_11012969 | Not Available | 850 | Open in IMG/M |
3300015251|Ga0180070_1025828 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 725 | Open in IMG/M |
3300015356|Ga0134073_10199762 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
3300015359|Ga0134085_10137202 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1033 | Open in IMG/M |
3300015371|Ga0132258_10301411 | All Organisms → cellular organisms → Bacteria | 3941 | Open in IMG/M |
3300015371|Ga0132258_13519834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1072 | Open in IMG/M |
3300015372|Ga0132256_101108469 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
3300015373|Ga0132257_100742861 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1222 | Open in IMG/M |
3300015374|Ga0132255_104073852 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 620 | Open in IMG/M |
3300015374|Ga0132255_106068404 | Not Available | 511 | Open in IMG/M |
3300016294|Ga0182041_10500264 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 1054 | Open in IMG/M |
3300016341|Ga0182035_10645074 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
3300016371|Ga0182034_10409522 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
3300016387|Ga0182040_10795186 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 779 | Open in IMG/M |
3300017792|Ga0163161_10714436 | Not Available | 835 | Open in IMG/M |
3300017823|Ga0187818_10083488 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1379 | Open in IMG/M |
3300017928|Ga0187806_1045227 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1330 | Open in IMG/M |
3300017961|Ga0187778_10190816 | Not Available | 1303 | Open in IMG/M |
3300017961|Ga0187778_10249081 | All Organisms → cellular organisms → Bacteria | 1140 | Open in IMG/M |
3300017966|Ga0187776_10184054 | All Organisms → cellular organisms → Bacteria | 1305 | Open in IMG/M |
3300017972|Ga0187781_10348194 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1054 | Open in IMG/M |
3300017995|Ga0187816_10431941 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
3300018028|Ga0184608_10431736 | Not Available | 569 | Open in IMG/M |
3300018053|Ga0184626_10354394 | Not Available | 597 | Open in IMG/M |
3300018060|Ga0187765_10240544 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1062 | Open in IMG/M |
3300018469|Ga0190270_10143098 | All Organisms → cellular organisms → Bacteria | 1927 | Open in IMG/M |
3300019264|Ga0187796_1332162 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300020580|Ga0210403_10463321 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1032 | Open in IMG/M |
3300022532|Ga0242655_10101588 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 791 | Open in IMG/M |
3300022533|Ga0242662_10055706 | All Organisms → cellular organisms → Bacteria | 1033 | Open in IMG/M |
3300024219|Ga0247665_1024019 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
3300025313|Ga0209431_10511482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Baekduiaceae → Baekduia → Baekduia soli | 913 | Open in IMG/M |
3300025915|Ga0207693_11286576 | Not Available | 548 | Open in IMG/M |
3300025921|Ga0207652_10737435 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 877 | Open in IMG/M |
3300025925|Ga0207650_11281615 | Not Available | 624 | Open in IMG/M |
3300025933|Ga0207706_10815193 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
3300025942|Ga0207689_10694235 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
3300025947|Ga0210067_1024898 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 800 | Open in IMG/M |
3300025972|Ga0207668_10870287 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 801 | Open in IMG/M |
3300025986|Ga0207658_10705869 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 912 | Open in IMG/M |
3300026548|Ga0209161_10274728 | Not Available | 849 | Open in IMG/M |
3300027018|Ga0208475_1009599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium etli → Rhizobium etli CNPAF512 | 949 | Open in IMG/M |
3300027041|Ga0209876_1007607 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
3300027527|Ga0209684_1054191 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
3300027654|Ga0209799_1024943 | All Organisms → cellular organisms → Bacteria | 1317 | Open in IMG/M |
3300027824|Ga0209040_10499659 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300027842|Ga0209580_10286247 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
3300027873|Ga0209814_10228340 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 806 | Open in IMG/M |
3300027874|Ga0209465_10355566 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 734 | Open in IMG/M |
3300027909|Ga0209382_10038872 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5706 | Open in IMG/M |
3300027909|Ga0209382_10207135 | All Organisms → cellular organisms → Bacteria | 2244 | Open in IMG/M |
3300028145|Ga0247663_1055937 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
3300028803|Ga0307281_10288105 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 611 | Open in IMG/M |
3300031547|Ga0310887_10222612 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1038 | Open in IMG/M |
3300031573|Ga0310915_11090089 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 555 | Open in IMG/M |
3300031716|Ga0310813_11811492 | Not Available | 573 | Open in IMG/M |
3300031744|Ga0306918_11365479 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 544 | Open in IMG/M |
3300031753|Ga0307477_10719644 | Not Available | 667 | Open in IMG/M |
3300031946|Ga0310910_10460119 | All Organisms → Viruses → Predicted Viral | 1010 | Open in IMG/M |
3300032000|Ga0310903_10210635 | Not Available | 915 | Open in IMG/M |
3300032261|Ga0306920_100283909 | All Organisms → cellular organisms → Bacteria | 2468 | Open in IMG/M |
3300032782|Ga0335082_10395849 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1246 | Open in IMG/M |
3300033004|Ga0335084_10724417 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
3300033158|Ga0335077_12088111 | Not Available | 524 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 13.24% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.82% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.82% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.15% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.15% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.41% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.41% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 4.41% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.68% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 2.94% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.94% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.21% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.21% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.21% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.21% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.21% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.47% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.47% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.47% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.47% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.47% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.47% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.47% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.74% |
Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.74% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.74% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.74% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.74% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.74% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.74% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.74% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.74% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.74% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.74% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.74% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.74% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.74% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.74% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.74% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.74% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.74% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.74% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.74% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
3300004025 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D1 | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005507 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 | Host-Associated | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Host-Associated | Open in IMG/M |
3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Host-Associated | Open in IMG/M |
3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Host-Associated | Open in IMG/M |
3300012511 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_10 | Environmental | Open in IMG/M |
3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Host-Associated | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012905 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2 | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300015251 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT293_16_10D | Environmental | Open in IMG/M |
3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300019264 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300024219 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK06 | Environmental | Open in IMG/M |
3300025313 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025947 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqB_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
3300027018 | Grasslands soil microbial communities from Kansas, USA, that are Nitrogen fertilized - NN575 (SPAdes) | Environmental | Open in IMG/M |
3300027041 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_30_40 (SPAdes) | Environmental | Open in IMG/M |
3300027527 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028145 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK04 | Environmental | Open in IMG/M |
3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
F62_07230990 | 2170459010 | Grass Soil | MSQIGEPLRIIEVEPREEPVPEKEVPFEEPADPVEEPA |
Ga0055433_100860292 | 3300004025 | Natural And Restored Wetlands | KEYSMSEIGEPLRIIEVEPREEPVPEKEIPFEQPADPVKEPA* |
Ga0066395_107764781 | 3300004633 | Tropical Forest Soil | MSQIGEPLRIIEVEPLEEPVPEKELPEKEVPFEQPADPVKEPA* |
Ga0066388_1002512112 | 3300005332 | Tropical Forest Soil | MSQIGEPLRIIEVEPREEPVPERDVPFEQPADPVAVPVKEPA* |
Ga0066388_1003947442 | 3300005332 | Tropical Forest Soil | MSQIGEPLRIIEVEPLEEPVPQKEVPFEQPADPIKEPAW* |
Ga0066388_1086103611 | 3300005332 | Tropical Forest Soil | KEYSMSQIGEPLRIIEVEPLEEPVPEKEVPFEQPADPVKEPA* |
Ga0068869_1007179781 | 3300005334 | Miscanthus Rhizosphere | MSQIGEPLRIIEVEPLQEPVPEKEVPFEQPADPVKQPADPVKEPA* |
Ga0070667_1007203302 | 3300005367 | Switchgrass Rhizosphere | YSMSQIGEPLRIIEVEPLEEPVPEKEVPFEQPAYPVKEPA* |
Ga0070709_109562602 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | YSMSQIGEPLRIIEVEPREEPVPEKEVPFEQPADPVKEPA* |
Ga0074259_108924051 | 3300005507 | Arabidopsis Rhizosphere | MSQIGEPLRIIEVEPLEEPVPEKEVPFEQPADPVKEPA* |
Ga0070730_107019851 | 3300005537 | Surface Soil | MSQIGEPLRIIEVEPREEPVPEKEVPFEQPADPVEEPA* |
Ga0068859_1017117142 | 3300005617 | Switchgrass Rhizosphere | MSQIGEPLRIIEVEPLEEPVPEKEVPFEQPVDPVKEPA* |
Ga0066905_1012382942 | 3300005713 | Tropical Forest Soil | MSQIGEPLRIIEVEPLEEPVPEKEVPFVQPADPVKEPA* |
Ga0066903_1004667904 | 3300005764 | Tropical Forest Soil | MSQIGEPLRIIEVEPLEEPVPEKEVPFEQPADPVREPA* |
Ga0066903_1017214603 | 3300005764 | Tropical Forest Soil | MSQIGEPLRIIEVEPLEEPVPQREVPFEEPADPVKEPA* |
Ga0066903_1020293592 | 3300005764 | Tropical Forest Soil | MSQIGEPVRIIEVEPLEEPVPEKEVPFEQPADPVKEPA* |
Ga0066903_1027982671 | 3300005764 | Tropical Forest Soil | MSQIGEPLRIIEVEPLEEPVPQKEVPFEQPADPVKEPA* |
Ga0066903_1031432552 | 3300005764 | Tropical Forest Soil | MSQIGEPLRIIEVEPLEEPVPEKEVPFEQPAHPVKEPA* |
Ga0066903_1036671382 | 3300005764 | Tropical Forest Soil | MEYSMSQIGEPLRIIEVQPLEEPVPEKEVPFEQPADPVKEPA* |
Ga0066903_1057233182 | 3300005764 | Tropical Forest Soil | MSQIGEPLRIIEVEPLEEPVPEKEVPFEQPPNPIKEPDDPVKEPA* |
Ga0066903_1061731752 | 3300005764 | Tropical Forest Soil | MSEIGEPLRIIEVEPREEPVPEKEVPFEQPADPVKEPAE* |
Ga0066903_1063031931 | 3300005764 | Tropical Forest Soil | MSQMGEPLRIIEVEPLKEPVPEKEVPFEQPADPVKEPA* |
Ga0066903_1084469762 | 3300005764 | Tropical Forest Soil | MSQIGEPLRIIEVEPLDEPVPEKEVPFELPADPVKEPA* |
Ga0074479_102693942 | 3300005829 | Sediment (Intertidal) | MSQIGEPLRIIEVEPQEEPVPEKEVPFEQPADPVKEPA* |
Ga0075024_1003621222 | 3300006047 | Watersheds | MSQIGEPLRIIEVEPREEPVPEREVPFEQPADPIKEPA* |
Ga0075017_1016622052 | 3300006059 | Watersheds | IGEPLRIIEVEPREEPVPEREVPFEQPADPVKEPA* |
Ga0075019_105763822 | 3300006086 | Watersheds | MSQIGEPLRIIEVEPREEPVPEREVPFEQPADPVKEPA* |
Ga0066653_100454912 | 3300006791 | Soil | MSQIGEPLRIIKVEPLEEPVPEKEVPFEQPADPVKEPA* |
Ga0066659_106168222 | 3300006797 | Soil | QIGEPLRIIEVEPLEEPVPEKEVPFEQPADPVKETA* |
Ga0075428_1005278031 | 3300006844 | Populus Rhizosphere | MSQIGEPLRIIEVEPLEEPVPEKEVPFEQPADPVKE |
Ga0075421_1000302685 | 3300006845 | Populus Rhizosphere | MSQIGEPLRIIEVKPLEEPVPEKEVPFEQPADPVKEPA* |
Ga0075425_1009351424 | 3300006854 | Populus Rhizosphere | VSQIGEPLRIIEVEPLEEPVPEKEVPFEQPADPVKE |
Ga0075425_1022639411 | 3300006854 | Populus Rhizosphere | MSQIGEPLRIIEVEPLEEPVPEKEVPFEQPADPVKEP |
Ga0075419_102156803 | 3300006969 | Populus Rhizosphere | MSQIGEPLRIIEVEPLEEPVPEKEIPFEQPADPVKEPA* |
Ga0105250_103190922 | 3300009092 | Switchgrass Rhizosphere | MSQIGEPLRIIEVEPREEPVPEKEVPFEQPADPVKEPA* |
Ga0111539_100969844 | 3300009094 | Populus Rhizosphere | MSQIGEPLRIIEVEPLEEPVPEKEVPFEQPADPIKQPADPVKEPA* |
Ga0111539_108668472 | 3300009094 | Populus Rhizosphere | MSEIGEPLRIIEVEPLEEPVPEKEVPLEQPVDPVKEPA* |
Ga0105245_115431332 | 3300009098 | Miscanthus Rhizosphere | MSQIGEPLRIIEVEPRQEPVPEKEVPFEQPADPVEEPA* |
Ga0075418_101067723 | 3300009100 | Populus Rhizosphere | MSQIGEPLRIIEVEPLEEPIPEKEVPFEQPADPVKEPA* |
Ga0114129_125669661 | 3300009147 | Populus Rhizosphere | MSQIGEPLRIIEVEPLEEPVPEKEVPFEQPADPVK |
Ga0126380_107382532 | 3300010043 | Tropical Forest Soil | MSQIGEPLRIIEVEPLEEPVPQKEVPFEQPTDPVKEPA* |
Ga0126373_100218042 | 3300010048 | Tropical Forest Soil | MANIGEPLRIIEVEPREEPVPEKEVPFEQPADPVKEPA* |
Ga0134111_103313522 | 3300010329 | Grasslands Soil | MSQIGEPLRIIEVEPLEEPVPEKEVPFEEPAEPVKEPA* |
Ga0126372_102020442 | 3300010360 | Tropical Forest Soil | MSQIGEPLRIIEVEPLEEPVPERELPFEQPADPVKEPA* |
Ga0126372_124466152 | 3300010360 | Tropical Forest Soil | MEYSMAQIGEPVRIIEVKPLEEPVPEKEVPFEQPADPVKEPA* |
Ga0126379_112176951 | 3300010366 | Tropical Forest Soil | MSQIGEPLRIIEVEPIEEPVPEKEVPFEQPADPVKEPA* |
Ga0126379_128865732 | 3300010366 | Tropical Forest Soil | MSQIGEPLRIIEVEPLEEPVPEKEVPFEQPGDPVKEPA* |
Ga0126379_135459782 | 3300010366 | Tropical Forest Soil | GEPLRIIEVEPLEEPVPEKEVPFEQPADPVKEPA* |
Ga0126381_1013665583 | 3300010376 | Tropical Forest Soil | MSQLGEPLRVIEVEPLEEPVPEKEVPFEQPADPVK |
Ga0136449_1012237101 | 3300010379 | Peatlands Soil | MSQIGEPLRIIEVEPREEPVPEKELPFEQPADPVKEPAE* |
Ga0126383_107016412 | 3300010398 | Tropical Forest Soil | MSQIGEPLRIIEIEPLEEPVPEKEVPFEQPAYPVK |
Ga0126383_116422742 | 3300010398 | Tropical Forest Soil | MSQIGEPLKIIEVEPLEEPVPEKEVPFEQPADPVKEPA* |
Ga0137776_18498323 | 3300010937 | Sediment | MSQIGEPLRIIEVEPLEEPVPEKEPFEQPADPVKEPA* |
Ga0150983_103878281 | 3300011120 | Forest Soil | MSQIGEPLRIIAVEPLEEPVPQKEVPFEQPADPVKEPA* |
Ga0137388_120172792 | 3300012189 | Vadose Zone Soil | MSQIGEPLRVIEVEPLEEPVPEKEVPFEQPVDPVREPA* |
Ga0137399_101816412 | 3300012203 | Vadose Zone Soil | MSQIGEPLTIIEVEPLEEPVPEKEVPFEQPADPVKEPA* |
Ga0137377_105456541 | 3300012211 | Vadose Zone Soil | MSQIGEPQRIIEVEPLEEPVPEKEVPFEQPADPVKEPA* |
Ga0150984_1030224332 | 3300012469 | Avena Fatua Rhizosphere | MSQIGEPLRIIEVEPLEEPVPQKEVPFEQPAHPVKEPA* |
Ga0150984_1081542142 | 3300012469 | Avena Fatua Rhizosphere | MEYSMAQIGEPLRIIEVKPLEEPVPEKEVPFEQPVDPVKEPA* |
Ga0157345_10188731 | 3300012498 | Arabidopsis Rhizosphere | MSQIGEPLRIIEVEPLEEPVPEREVPVPEKEVPFEQPADPVKEPA* |
Ga0157339_10068942 | 3300012505 | Arabidopsis Rhizosphere | MSQMGEPVRIIEVEPLEEPVPEKEVPFEQPADPVKEPA* |
Ga0157324_10133661 | 3300012506 | Arabidopsis Rhizosphere | MSQIGEPLRIIEVEPLKEPVPEKEVPFEQPADPVKEPA* |
Ga0157332_10361452 | 3300012511 | Soil | MSQIGEPLRIIEVEPLEEPVPEKEVPFEQPADPAKEPA* |
Ga0157338_10100142 | 3300012515 | Arabidopsis Rhizosphere | MSQIGEPIRIIEVEPLEEPVPEKEVPFEQPADPVKEPA* |
Ga0137398_111327161 | 3300012683 | Vadose Zone Soil | KEYSMSQIGEPLRIIEVEPREEPVPEREVPFEQPADPVKEPA* |
Ga0157296_100862642 | 3300012905 | Soil | MSQIGEPLRIIEVEPLEEPVPEKEVPFEQPADPVKQPADPVKEPA* |
Ga0137395_102654332 | 3300012917 | Vadose Zone Soil | MSQIGEPLRIIEVEPLEEPVPEKEVPFEQPAAPVKEPA* |
Ga0137410_108683282 | 3300012944 | Vadose Zone Soil | MSQIGEPLRIIEVEPLGEPVPEKEVPFEQPADPVKEPA* |
Ga0164300_101607603 | 3300012951 | Soil | MSQIGEPLRIIEIEPLEEPVPGKEVPFEQPADPVKEPA* |
Ga0126369_109963872 | 3300012971 | Tropical Forest Soil | MANIGEPLRIIEVEPREEPVPEKEVPFEQPADPVEEPA* |
Ga0126369_123925351 | 3300012971 | Tropical Forest Soil | MAQIGNPLKIIEVEPLEEPVPEKEVPFDQPADPFKEPV* |
Ga0164304_105898682 | 3300012986 | Soil | IGEPLRIIEVEPLEEPVPEKEVPFEQPVDPVKEPA* |
Ga0157374_110129692 | 3300013296 | Miscanthus Rhizosphere | MSQIGGPVRIIEVEPLEEPVPEKEVPFEQPADPVKEPA* |
Ga0180070_10258281 | 3300015251 | Soil | QIGEPLRIIEVEPLEEPVPEKEVPFEQPADPVKEPA* |
Ga0134073_101997621 | 3300015356 | Grasslands Soil | SQIGEPLRIIEVEPLQEPVPEKEVPFEQPADPVKEPA* |
Ga0134085_101372022 | 3300015359 | Grasslands Soil | MSQIGEPLRIIEVEPLEEPVPEKEVPFEQPAYPVKEPA* |
Ga0132258_103014112 | 3300015371 | Arabidopsis Rhizosphere | MSQIGEPLRIIEVEPLEEPVPEKEVPFEQPADPIKEPA* |
Ga0132258_135198342 | 3300015371 | Arabidopsis Rhizosphere | MSQMGEPVRIIEVEPLEEPVPEKEVPFEQPADPAKEPA* |
Ga0132256_1011084691 | 3300015372 | Arabidopsis Rhizosphere | MSQIGEPLRIIEVEPLEEPVPEKEVPFEQPDDPVKEPA* |
Ga0132257_1007428613 | 3300015373 | Arabidopsis Rhizosphere | MSQIGEPVRIIEVEPLEEPVPQKEAPFEQPADPVKEPA* |
Ga0132255_1040738522 | 3300015374 | Arabidopsis Rhizosphere | MSQIGEPLRIIEVEPLEEPVPEKEVPFEQPADPVKEPV* |
Ga0132255_1060684042 | 3300015374 | Arabidopsis Rhizosphere | MSQIGEPLRTIEVEPLKDPVPEKEVPFEQPADPVREPA* |
Ga0182041_105002643 | 3300016294 | Soil | MSQIGEPLRVIEVEPLEEPVPEKEVPFEQPAAPVKEPA |
Ga0182035_106450741 | 3300016341 | Soil | MSEIGEPLRIIEVEPREEPVPEKEVPFEQPADPVKEPAE |
Ga0182034_104095223 | 3300016371 | Soil | MSQIGEPLRIIEVEPIEEPVPEKEVPFEQPADPVKEPA |
Ga0182040_107951862 | 3300016387 | Soil | MSQIGEPLRVIEVEPLEEPVPEKEVPFEQPADPVKEPA |
Ga0163161_107144362 | 3300017792 | Switchgrass Rhizosphere | MSQIGEPLRIIEVEPLEEPVPEKEVPFEQPADPVKEPA |
Ga0187818_100834881 | 3300017823 | Freshwater Sediment | MSQIGEPLRIIEVEPREEPVPEREVPFEQPADPVKEPA |
Ga0187806_10452271 | 3300017928 | Freshwater Sediment | EYSMSQIGEPLRIIEVEPREEPVPEREVPFEQPADPVKEPA |
Ga0187778_101908161 | 3300017961 | Tropical Peatland | MSQIGEPIRIIEVEPREEPVPEKEVPFEQPADPVT |
Ga0187778_102490812 | 3300017961 | Tropical Peatland | MANIGEPLRIIEVEPREEPVPEKEVPFEQPADPVKEPE |
Ga0187776_101840541 | 3300017966 | Tropical Peatland | MSQIGEPLRVIEVEPLEEPVPAKEVPFEQPADPVKEPA |
Ga0187781_103481942 | 3300017972 | Tropical Peatland | MSQIGEPLRIIEVEPREEPVPEREAPFEQPADPVKEPA |
Ga0187816_104319411 | 3300017995 | Freshwater Sediment | MSQIGEPLRIIEVEPFEEPVPEREVPFEQPADPVKEPA |
Ga0184608_104317362 | 3300018028 | Groundwater Sediment | MSEIGEPLRIIEVEPLEEPVPEKEVPLEQPADPVKE |
Ga0184626_103543941 | 3300018053 | Groundwater Sediment | MSEIGEPLRIIEVEPLEEPVPEKEVPFEQPADPVKEPA |
Ga0187765_102405443 | 3300018060 | Tropical Peatland | MSQIGEPVKIIEVEPREEPVPEKEIPFEEPADPVKEPA |
Ga0190270_101430984 | 3300018469 | Soil | MSQIGEPIRIIEVEPLEEPVPEKEVPFEQPADPVKEPA |
Ga0187796_13321621 | 3300019264 | Peatland | MSQIGEPLRIIEVEPREEPVPERDVPFEQPADPVAVPVKEPA |
Ga0210403_104633213 | 3300020580 | Soil | MSQIGEPLRIIEVEPREEPVPEKEVPFEQPADPVKEPAY |
Ga0242655_101015882 | 3300022532 | Soil | MSQIGEPLRIIEVEPREEPVPEKEVPFELPADPVEEPA |
Ga0242662_100557061 | 3300022533 | Soil | MSQIGEPLRIIEVEPREEPVPEREVPFEQPSDPVKEPA |
Ga0247665_10240191 | 3300024219 | Soil | KEYSMSQIGEPLRIIEVEPLEEPVPEKEVPFEQPADPVKEPA |
Ga0209431_105114822 | 3300025313 | Soil | MEIGEPEREIEVWPLEEPVPEEMPVEAPEPVRIPA |
Ga0207693_112865762 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MSQIGEPLRVIEVEPLEEPVPQKEVPFEQPADPVKEPA |
Ga0207652_107374352 | 3300025921 | Corn Rhizosphere | MAQIGEPLRIIEVEPLEEPVPEKEVPFEQPADPVKEPA |
Ga0207650_112816152 | 3300025925 | Switchgrass Rhizosphere | MSQIGEPVRIIEVEPLEEPVPEKEVPFEQPADPVKEPA |
Ga0207706_108151932 | 3300025933 | Corn Rhizosphere | MSQIGEPLIIIEVEPLEEPVPEKEVPFEQPADPVKEPA |
Ga0207689_106942351 | 3300025942 | Miscanthus Rhizosphere | MSQIGEPLRIIEVEPLQEPVPEKEVPFEQPADPVKQPADPVKEPA |
Ga0210067_10248981 | 3300025947 | Natural And Restored Wetlands | MSQIGEPLRIIEVEPLEKPVPEKEVPFEQPADPVKEPA |
Ga0207668_108702872 | 3300025972 | Switchgrass Rhizosphere | MSQIGEPLRIIEVEPLEEPVPEKQVPFEQPADPVKEPA |
Ga0207658_107058691 | 3300025986 | Switchgrass Rhizosphere | SSDLLRIIEVEPLEEPVPEKEVPFEQPAYPVKEPA |
Ga0209161_102747282 | 3300026548 | Soil | MSQIGEPLRIIVVEPLEEPVPEKEVPFEQPADPVKEPA |
Ga0208475_10095991 | 3300027018 | Soil | SMSQIGEPLRIIEVEPLEEPVPEKEVPFEQPADPVKEPA |
Ga0209876_10076072 | 3300027041 | Groundwater Sand | MSQIGEPLRIIEVEPLEEPVPEKEVPFEQPADPVKQPANPVKEPA |
Ga0209684_10541911 | 3300027527 | Tropical Forest Soil | GHARIIMKYSMSQIGEPLRIIEVEPLEEPVPEKEVPFEQPADPVKEPA |
Ga0209799_10249432 | 3300027654 | Tropical Forest Soil | MSQIGEPLRIIEVEPLEEPVPEKELPFEQPADPVKEPA |
Ga0209040_104996592 | 3300027824 | Bog Forest Soil | IGEPLRIIEVEPREEPVPEREVPFEQPADPVKEPA |
Ga0209580_102862473 | 3300027842 | Surface Soil | SQIGEPLRIIEVEPREEPVPEKEVPFEQPADPVEEPA |
Ga0209814_102283402 | 3300027873 | Populus Rhizosphere | MSQIGEPLRIIEVEPLEEPIPEKEVPFEQPADPVKEPA |
Ga0209465_103555662 | 3300027874 | Tropical Forest Soil | MSQIGEPLRIIEVEPLEEPVPEKEVPFVQPADPVKEPA |
Ga0209382_100388723 | 3300027909 | Populus Rhizosphere | MSQIGEPLRIIEVKPLEEPVPEKEVPFEQPADPVKEPA |
Ga0209382_102071351 | 3300027909 | Populus Rhizosphere | MSQIGDPLRIIEVEPLEEPVPEKEVPFEQPADPVKEPA |
Ga0247663_10559372 | 3300028145 | Soil | MSQIGEPLRIIEVEPLKEPVPEKEVPFEQPADPVKEPA |
Ga0307281_102881052 | 3300028803 | Soil | MSQIGEPLRIIEVEPLEEPVPEKEVPFEQPADPVQEPA |
Ga0310887_102226122 | 3300031547 | Soil | MSEIGEPLRIIEVEPLEEPVPEKEVPLEQPVDPVKEPA |
Ga0310915_110900892 | 3300031573 | Soil | MSQIGEPLRIIEVEPLEEPVPEKEVPFEQPADPIKEPA |
Ga0310813_118114922 | 3300031716 | Soil | MSQIGEPLRIIEVQPLEEPVPEKEVPFEQPADPVKEPA |
Ga0306918_113654791 | 3300031744 | Soil | RFCRKECGMSQIGEPLRIIEVEPLEEPVPQKEVPFEQPADPVKEPA |
Ga0307477_107196442 | 3300031753 | Hardwood Forest Soil | MSQIGEPLRIIEVEPLREPVPEKEVPFEQPADPVKEPA |
Ga0310910_104601192 | 3300031946 | Soil | ECSMSQIGEPLRIIEVEPLEEPVPEKEVPFEQPADPVKEPA |
Ga0310903_102106351 | 3300032000 | Soil | MSEIGEPLRIIEVEPLEEPVPEKEVPLEQPVDPVK |
Ga0306920_1002839092 | 3300032261 | Soil | MSQIGEPLRIIEVEPLEEPVPEKEVPFEQPADPVKDPA |
Ga0335082_103958492 | 3300032782 | Soil | MSQIGEPIRIIEVEPREEPVPEKEVPFEQPADPVKEPA |
Ga0335084_107244173 | 3300033004 | Soil | MSQIGEPLRIIEVEPLEEPVPEKEVPFEQPAYPVKEPA |
Ga0335077_120881112 | 3300033158 | Soil | MSQIGEPLRIIEVKPREEPVPERDVPFEQPADPVAVPVKEPAQ |
⦗Top⦘ |