Basic Information | |
---|---|
Family ID | F057268 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 136 |
Average Sequence Length | 42 residues |
Representative Sequence | GDLASQELVILERGPAGLVERRAGGVRFVPLISRLAFTEEPWS |
Number of Associated Samples | 111 |
Number of Associated Scaffolds | 136 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.74 % |
% of genes near scaffold ends (potentially truncated) | 99.26 % |
% of genes from short scaffolds (< 2000 bps) | 82.35 % |
Associated GOLD sequencing projects | 104 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.43 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (100.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (25.735 % of family members) |
Environment Ontology (ENVO) | Unclassified (50.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.412 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 8.45% β-sheet: 23.94% Coil/Unstructured: 67.61% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 136 Family Scaffolds |
---|---|---|
PF01261 | AP_endonuc_2 | 88.24 |
PF01297 | ZnuA | 2.94 |
PF13620 | CarboxypepD_reg | 0.74 |
PF10460 | Peptidase_M30 | 0.74 |
PF03949 | Malic_M | 0.74 |
PF00950 | ABC-3 | 0.74 |
PF00413 | Peptidase_M10 | 0.74 |
COG ID | Name | Functional Category | % Frequency in 136 Family Scaffolds |
---|---|---|---|
COG0281 | Malic enzyme | Energy production and conversion [C] | 0.74 |
COG0609 | ABC-type Fe3+-siderophore transport system, permease component | Inorganic ion transport and metabolism [P] | 0.74 |
COG0686 | Alanine dehydrogenase (includes sporulation protein SpoVN) | Amino acid transport and metabolism [E] | 0.74 |
COG1108 | ABC-type Mn2+/Zn2+ transport system, permease component | Inorganic ion transport and metabolism [P] | 0.74 |
COG4606 | ABC-type enterochelin transport system, permease component | Inorganic ion transport and metabolism [P] | 0.74 |
COG5549 | Predicted Zn-dependent protease | Posttranslational modification, protein turnover, chaperones [O] | 0.74 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 100.00 % |
Unclassified | root | N/A | 0.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002558|JGI25385J37094_10171298 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
3300002561|JGI25384J37096_10187665 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 616 | Open in IMG/M |
3300004114|Ga0062593_100173950 | All Organisms → cellular organisms → Bacteria | 1673 | Open in IMG/M |
3300004156|Ga0062589_101619198 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300005167|Ga0066672_10172212 | All Organisms → cellular organisms → Bacteria | 1368 | Open in IMG/M |
3300005174|Ga0066680_10357628 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 930 | Open in IMG/M |
3300005179|Ga0066684_10403716 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
3300005180|Ga0066685_10104964 | All Organisms → cellular organisms → Bacteria | 1890 | Open in IMG/M |
3300005187|Ga0066675_10159904 | All Organisms → cellular organisms → Bacteria | 1553 | Open in IMG/M |
3300005406|Ga0070703_10401061 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
3300005445|Ga0070708_100161408 | All Organisms → cellular organisms → Bacteria | 2088 | Open in IMG/M |
3300005445|Ga0070708_101759375 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300005445|Ga0070708_101901964 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300005446|Ga0066686_10482379 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
3300005451|Ga0066681_10008834 | All Organisms → cellular organisms → Bacteria → Calditrichaeota → Calditrichia → Calditrichales → Calditrichaceae → Caldithrix → Caldithrix abyssi | 4839 | Open in IMG/M |
3300005540|Ga0066697_10283397 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
3300005545|Ga0070695_100010650 | All Organisms → cellular organisms → Bacteria | 5496 | Open in IMG/M |
3300005552|Ga0066701_10905840 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 522 | Open in IMG/M |
3300005554|Ga0066661_10119106 | All Organisms → cellular organisms → Bacteria | 1594 | Open in IMG/M |
3300005555|Ga0066692_10026792 | All Organisms → cellular organisms → Bacteria | 3004 | Open in IMG/M |
3300005561|Ga0066699_10504000 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
3300005566|Ga0066693_10107766 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
3300005568|Ga0066703_10486227 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
3300005586|Ga0066691_10923108 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300006031|Ga0066651_10276040 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
3300006032|Ga0066696_10714512 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
3300006034|Ga0066656_10180891 | All Organisms → cellular organisms → Bacteria | 1334 | Open in IMG/M |
3300006034|Ga0066656_10181350 | All Organisms → cellular organisms → Bacteria | 1332 | Open in IMG/M |
3300006034|Ga0066656_10386699 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
3300006755|Ga0079222_10478785 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
3300006797|Ga0066659_10648197 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 860 | Open in IMG/M |
3300006844|Ga0075428_100331321 | All Organisms → cellular organisms → Bacteria | 1635 | Open in IMG/M |
3300006845|Ga0075421_102621041 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300006854|Ga0075425_100198552 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2305 | Open in IMG/M |
3300006876|Ga0079217_10620993 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
3300006914|Ga0075436_100056335 | All Organisms → cellular organisms → Bacteria | 2715 | Open in IMG/M |
3300007255|Ga0099791_10517558 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
3300009012|Ga0066710_103199125 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 629 | Open in IMG/M |
3300009089|Ga0099828_11395522 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
3300009090|Ga0099827_10087104 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2454 | Open in IMG/M |
3300009137|Ga0066709_100067610 | All Organisms → cellular organisms → Bacteria | 4173 | Open in IMG/M |
3300009137|Ga0066709_104031533 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 534 | Open in IMG/M |
3300009162|Ga0075423_10054706 | All Organisms → cellular organisms → Bacteria → Calditrichaeota → Calditrichia → Calditrichales → Calditrichaceae → Caldithrix → Caldithrix abyssi | 4119 | Open in IMG/M |
3300010301|Ga0134070_10251100 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
3300010303|Ga0134082_10016860 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2665 | Open in IMG/M |
3300010304|Ga0134088_10589057 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 552 | Open in IMG/M |
3300010322|Ga0134084_10311883 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
3300010323|Ga0134086_10022938 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2012 | Open in IMG/M |
3300010323|Ga0134086_10246049 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
3300010325|Ga0134064_10295398 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → environmental samples → uncultured Gemmatimonadaceae bacterium | 615 | Open in IMG/M |
3300010329|Ga0134111_10528450 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 521 | Open in IMG/M |
3300010333|Ga0134080_10014663 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2838 | Open in IMG/M |
3300010336|Ga0134071_10637131 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300010337|Ga0134062_10234482 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
3300011270|Ga0137391_10922038 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
3300011433|Ga0137443_1092553 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 863 | Open in IMG/M |
3300011443|Ga0137457_1009029 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2374 | Open in IMG/M |
3300012198|Ga0137364_10373505 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
3300012199|Ga0137383_10444400 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
3300012199|Ga0137383_10801167 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 688 | Open in IMG/M |
3300012200|Ga0137382_11174779 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300012202|Ga0137363_11320982 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 610 | Open in IMG/M |
3300012202|Ga0137363_11368354 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
3300012203|Ga0137399_11121354 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
3300012205|Ga0137362_11658738 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300012208|Ga0137376_10141388 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2066 | Open in IMG/M |
3300012208|Ga0137376_10713712 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
3300012208|Ga0137376_11279765 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 623 | Open in IMG/M |
3300012285|Ga0137370_10105481 | All Organisms → cellular organisms → Bacteria | 1591 | Open in IMG/M |
3300012285|Ga0137370_10507463 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 739 | Open in IMG/M |
3300012351|Ga0137386_10146992 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1684 | Open in IMG/M |
3300012351|Ga0137386_10429128 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
3300012353|Ga0137367_10153998 | All Organisms → cellular organisms → Bacteria | 1676 | Open in IMG/M |
3300012353|Ga0137367_10686350 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
3300012355|Ga0137369_10262808 | All Organisms → cellular organisms → Bacteria | 1299 | Open in IMG/M |
3300012401|Ga0134055_1353581 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 772 | Open in IMG/M |
3300012532|Ga0137373_10519402 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 907 | Open in IMG/M |
3300012582|Ga0137358_10573581 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
3300012918|Ga0137396_10786358 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
3300012929|Ga0137404_11668581 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
3300012931|Ga0153915_11169700 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
3300012972|Ga0134077_10328557 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 647 | Open in IMG/M |
3300014154|Ga0134075_10158854 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 967 | Open in IMG/M |
3300014166|Ga0134079_10166322 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 901 | Open in IMG/M |
3300014861|Ga0180061_1083673 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300014865|Ga0180078_1037644 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 783 | Open in IMG/M |
3300015054|Ga0137420_1104516 | All Organisms → cellular organisms → Bacteria | 3743 | Open in IMG/M |
3300015241|Ga0137418_10728885 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
3300015356|Ga0134073_10000810 | All Organisms → cellular organisms → Bacteria → Calditrichaeota → Calditrichia → Calditrichales → Calditrichaceae → Caldithrix | 5845 | Open in IMG/M |
3300015356|Ga0134073_10009109 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2181 | Open in IMG/M |
3300015358|Ga0134089_10352015 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
3300017659|Ga0134083_10134382 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 994 | Open in IMG/M |
3300017659|Ga0134083_10260955 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
3300018056|Ga0184623_10146538 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
3300018056|Ga0184623_10453840 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300018431|Ga0066655_11292826 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300018468|Ga0066662_12314864 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 564 | Open in IMG/M |
3300018482|Ga0066669_10678623 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 907 | Open in IMG/M |
3300018482|Ga0066669_11628113 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
3300020170|Ga0179594_10067154 | All Organisms → cellular organisms → Bacteria | 1243 | Open in IMG/M |
3300024330|Ga0137417_1054025 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300025922|Ga0207646_10256827 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1579 | Open in IMG/M |
3300025922|Ga0207646_10365439 | All Organisms → cellular organisms → Bacteria | 1304 | Open in IMG/M |
3300026277|Ga0209350_1008691 | All Organisms → cellular organisms → Bacteria | 3362 | Open in IMG/M |
3300026300|Ga0209027_1136822 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
3300026300|Ga0209027_1268937 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 548 | Open in IMG/M |
3300026310|Ga0209239_1245325 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 619 | Open in IMG/M |
3300026327|Ga0209266_1003643 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 9384 | Open in IMG/M |
3300026329|Ga0209375_1007712 | All Organisms → cellular organisms → Bacteria → Calditrichaeota → Calditrichia → Calditrichales → Calditrichaceae → Caldithrix | 6923 | Open in IMG/M |
3300026342|Ga0209057_1030000 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2872 | Open in IMG/M |
3300026527|Ga0209059_1161035 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 807 | Open in IMG/M |
3300026527|Ga0209059_1203424 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 669 | Open in IMG/M |
3300026532|Ga0209160_1000837 | All Organisms → cellular organisms → Bacteria | 25640 | Open in IMG/M |
3300026532|Ga0209160_1038871 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2893 | Open in IMG/M |
3300026536|Ga0209058_1105284 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1418 | Open in IMG/M |
3300026538|Ga0209056_10345247 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
3300026538|Ga0209056_10515264 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 620 | Open in IMG/M |
3300026540|Ga0209376_1075451 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1814 | Open in IMG/M |
3300026540|Ga0209376_1138948 | All Organisms → cellular organisms → Bacteria | 1180 | Open in IMG/M |
3300027655|Ga0209388_1032975 | All Organisms → cellular organisms → Bacteria | 1485 | Open in IMG/M |
3300027725|Ga0209178_1310452 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300027748|Ga0209689_1022715 | All Organisms → cellular organisms → Bacteria | 3851 | Open in IMG/M |
3300027748|Ga0209689_1284037 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 649 | Open in IMG/M |
3300027765|Ga0209073_10397242 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300027875|Ga0209283_10403606 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 891 | Open in IMG/M |
3300027875|Ga0209283_10485371 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
3300027909|Ga0209382_11690486 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
3300028536|Ga0137415_11272443 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 553 | Open in IMG/M |
3300031152|Ga0307501_10030043 | All Organisms → cellular organisms → Bacteria | 1104 | Open in IMG/M |
3300031720|Ga0307469_11836146 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 586 | Open in IMG/M |
3300031820|Ga0307473_10462967 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
3300031962|Ga0307479_11336314 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
3300031965|Ga0326597_10427376 | All Organisms → cellular organisms → Bacteria | 1464 | Open in IMG/M |
3300032205|Ga0307472_101571845 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 645 | Open in IMG/M |
3300034164|Ga0364940_0039031 | All Organisms → cellular organisms → Bacteria | 1255 | Open in IMG/M |
3300034178|Ga0364934_0390776 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 25.74% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 25.00% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 14.71% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 9.56% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.15% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.41% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.94% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.94% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.94% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.47% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.47% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.47% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.47% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.74% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011433 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT300_2 | Environmental | Open in IMG/M |
3300011443 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2 | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012401 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
3300014861 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT27_16_10D | Environmental | Open in IMG/M |
3300014865 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT499_16_10D | Environmental | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300034164 | Sediment microbial communities from East River floodplain, Colorado, United States - 14_s17 | Environmental | Open in IMG/M |
3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI25385J37094_101712981 | 3300002558 | Grasslands Soil | GDLASQELVILQRGPAGLVERRAGGVRFVPLISRLAFTEEPWM* |
JGI25384J37096_101876652 | 3300002561 | Grasslands Soil | DLASQELVIWERGSDGTPRERRAGGVRFVPLISRLAFTEEPEWR* |
Ga0062593_1001739504 | 3300004114 | Soil | LVIPVGDLAAQELVILERPTSGEHLVQREAGGVRFVPLISRLAFTEES* |
Ga0062589_1016191981 | 3300004156 | Soil | PIGDLGTQELVIYRRTAEGLEERRAGSVRFVPLISRFAFSGRDWR* |
Ga0066672_101722123 | 3300005167 | Soil | SQELVILQRGPAGLVERRAGGVRFVPLISRLAFTEEPWL* |
Ga0066680_103576282 | 3300005174 | Soil | GDLSGQELVILQRGPGGRLTERRAGGVRFVPLISRLAFTEEPWS* |
Ga0066684_104037162 | 3300005179 | Soil | GDLGAQELVILQRTAAELVERHAGGVRFVPLISRLAFTEGEWG* |
Ga0066685_101049644 | 3300005180 | Soil | PIGDLASQELVILQRGPAGLVERRAGGVRFVPLISRLAFTEEPWT* |
Ga0066675_101599041 | 3300005187 | Soil | GDLASQELVILQRGPAGMVERRAGGVRFVPLISRLAFTEEPWT* |
Ga0070703_104010611 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | AAQELVILERPTSGEHLVQREAGGVRFVPLISRLAFTEES* |
Ga0070708_1001614084 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | SGQELVILQRGPGGRLTERRAGGVRFVPLISRLAFTEEPWS* |
Ga0070708_1017593752 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | GDLASQELVILERGARGELLPRYAGGVRFVPLISRLAFTEEPSP* |
Ga0070708_1019019642 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | IGDLASQELVILQRGPAGLVERRAGGVRFVPLISRLAFTEEPWR* |
Ga0066686_104823792 | 3300005446 | Soil | GDLASQELVILERSTRGELVQRNAGGVRFVPLISRLAFTEEPSA* |
Ga0066681_100088341 | 3300005451 | Soil | DLSTQELVIVTRGRDGWTERRAGGVRFVPLVSSLAFTEPVEP* |
Ga0066697_102833972 | 3300005540 | Soil | ASQELVILQRGPNGLVERRAGGVRFVPLISRLAFTEEPWT* |
Ga0070695_1000106501 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | VIPVGDLASQELVILQRSASGELLYRNAGGVRFVPLISRLAFTEQSP* |
Ga0066701_109058401 | 3300005552 | Soil | VIWERGSDGTPRERRAGGVRFVPLISRLAFTEEPEWR* |
Ga0066661_101191064 | 3300005554 | Soil | VGDLTGQELVILRRGPEGGLTERRAGGVRFVPLISRLAFTEEPWS* |
Ga0066692_100267921 | 3300005555 | Soil | IPVGDLASQELVILQRGSTGLVERRAGGVRFVPLISRLAFTEEPWA* |
Ga0066699_105040002 | 3300005561 | Soil | VGDLASQELVILERPMSGEPLVQRQAGGVRFVPLISRFAFTEEG* |
Ga0066693_101077662 | 3300005566 | Soil | SQELVILQRPASGEGLTQRQMGGVRFVPLISRLAFTDEL* |
Ga0066703_104862271 | 3300005568 | Soil | VGDLSSQELVILERPTSGERLVQHQAGGVRFVPLISRFAFTEEN* |
Ga0066691_109231081 | 3300005586 | Soil | LVIPIGDLASQELVIWERGSDGTPRERRAGGVRFVPLISRLAFTEEPEWR* |
Ga0066651_102760402 | 3300006031 | Soil | IPIGDLTSQELVILERPMNGGAITQRGVGGVRFVPLISRLAFTEEP* |
Ga0066696_107145122 | 3300006032 | Soil | LVIPIGDLGAQELVILQRTAAELVERHTGGVRFVTLISRLAFTEGEWG* |
Ga0066656_101808913 | 3300006034 | Soil | GDLVTQELFIIERGASGLTERRAGGVRFVPLISRLGFSEEPWL* |
Ga0066656_101813501 | 3300006034 | Soil | GDLASQELVILERSARGELLQRQAGGVRFVPLISRLGFTEEPSP* |
Ga0066656_103866992 | 3300006034 | Soil | VILQRTAAELVERHAGGVRFVPLISRLAFTEGEWG* |
Ga0079222_104787851 | 3300006755 | Agricultural Soil | IPIGDLVTQELFIIERRPTGLTERRAGGVRFVPLISRLAFTEEPLV* |
Ga0066659_106481972 | 3300006797 | Soil | ELVILQRGSTGLVEWRAGGVRFVPLISRLAFTEEPWA* |
Ga0075428_1003313211 | 3300006844 | Populus Rhizosphere | EQELVILERLATGWREQRMGGVRFVPLVSRLGFPEDPW* |
Ga0075421_1026210411 | 3300006845 | Populus Rhizosphere | IGDLASQELVVLQRSERGLEERSAGAVRFVPLISRLAFMDESRHP* |
Ga0075425_1001985524 | 3300006854 | Populus Rhizosphere | VILERPRSGERIVERQAGGVRFVPLISRLAFTED* |
Ga0079217_106209932 | 3300006876 | Agricultural Soil | ERPASGAGGGLLRRHAGGVRFVPLISRHAFTEEP* |
Ga0075436_1000563351 | 3300006914 | Populus Rhizosphere | AVDQELVVLRRTSAGFEERRVGGVRFVPLISRHAFLPDGA* |
Ga0099791_105175581 | 3300007255 | Vadose Zone Soil | IGDLASQELVILERGPAGLVERRAGSVRFVPLISRLAFTEEPWR* |
Ga0066710_1031991252 | 3300009012 | Grasslands Soil | GDLASQELVILQRGPNGLVERRAGGVRFVPLISRLAFTEEPWT |
Ga0099828_113955222 | 3300009089 | Vadose Zone Soil | RLVIPVGDLSSQELVILERPTSGERLVQHQAGGVRFVPLISRFAFTEER* |
Ga0099827_100871044 | 3300009090 | Vadose Zone Soil | ELVIWERGPEGTLRERRAGGVRFVPLISRLAFTEEPEWR* |
Ga0066709_1000676101 | 3300009137 | Grasslands Soil | GDLASQELVILQRGPNGLVERRAGGVRFVPLISRLAFTEEPWT* |
Ga0066709_1040315331 | 3300009137 | Grasslands Soil | AQELVIITRTPAGLDERRAGGVRFVPLISQLAFREGDRN* |
Ga0075423_100547061 | 3300009162 | Populus Rhizosphere | LALQELVILERPRSGERIVERQAGGVRFVPLISRLAFTED* |
Ga0134070_102511002 | 3300010301 | Grasslands Soil | QELVILERPTNGGAVQQRGAGGVRFVPLISRLAFTDEL* |
Ga0134082_100168604 | 3300010303 | Grasslands Soil | ELVILQRGPAGMVERRAGGVRFVPLISRLAFTEEPWT* |
Ga0134088_105890571 | 3300010304 | Grasslands Soil | LVILQRGPAGMVERRAGGVRFVPLISRLAFTEEPWT* |
Ga0134084_103118832 | 3300010322 | Grasslands Soil | VGDLASQELVILERPATGERLLQRQAGGVRFVPLISRLAFSEES* |
Ga0134086_100229384 | 3300010323 | Grasslands Soil | ASQELVVLERGPAGLVARRAGGVRFVPLISRLAFTEEPWG* |
Ga0134086_102460492 | 3300010323 | Grasslands Soil | LVIPVGDLASQELVILERPRSGEGLLQQLAGGVRFVPLISRLAFTEER* |
Ga0134064_102953981 | 3300010325 | Grasslands Soil | QELVILRRGPEGSLTERRAGGVRFVPLISHLAFTEEPWS* |
Ga0134111_105284502 | 3300010329 | Grasslands Soil | IGDLASQELVILERPVGGPGNGGGLVQREAGAVRFVPLISRLAFTEDQ* |
Ga0134080_100146635 | 3300010333 | Grasslands Soil | VILERSEHGGGELVQRQAGGVRFFPLISRLAFPEQPLP* |
Ga0134071_106371312 | 3300010336 | Grasslands Soil | DLASQELVILQRGPAGLVERRAGGVRFVPLISRLAFTEEPWR* |
Ga0134062_102344822 | 3300010337 | Grasslands Soil | GDLATQELVIVTRGASGWTERRAGGVRFVPLVSSLAFTEPVEP* |
Ga0137391_109220381 | 3300011270 | Vadose Zone Soil | SQELVILERPTSGERLVQHQAGGVRFVPLISRFAFTEER* |
Ga0137443_10925531 | 3300011433 | Soil | QDLVVYRRTPNGLEERSAGSVRFVPLISRFAFAEREWR* |
Ga0137457_10090294 | 3300011443 | Soil | DLASQDLVVVRRTATGFEERRAGGVRFVPLISRLAFTDER* |
Ga0137364_103735052 | 3300012198 | Vadose Zone Soil | QELVIITRTPAGLDERRAGGVRFVPLISQLAFREGDRN* |
Ga0137383_104444001 | 3300012199 | Vadose Zone Soil | DQELVVLRRTARGFEERRMGGVRFVPLISRHAFLPEGA* |
Ga0137383_108011672 | 3300012199 | Vadose Zone Soil | GDLASQELVILERGPAGLVERRAGGVRFVPLISRLAFTEEPWS* |
Ga0137382_111747791 | 3300012200 | Vadose Zone Soil | QDLVILERPRSGVGLEQRHAGGVRFVPLISRLAFTEDL* |
Ga0137363_113209822 | 3300012202 | Vadose Zone Soil | GDLASQELVIIQRTARGFEERSAGGVRFVPLISRLAFMEESRS* |
Ga0137363_113683541 | 3300012202 | Vadose Zone Soil | LVILERPASGAGLVQHQAGGVRFVPLISRFAFTEEP* |
Ga0137399_111213542 | 3300012203 | Vadose Zone Soil | DLATQELVILERSKNGEGLVQEQAGGVRFVPLISRLAFTEER* |
Ga0137362_116587381 | 3300012205 | Vadose Zone Soil | LSSQELVILERPTSGERLVQHRAGGVRFVPLISRFAFTEEN* |
Ga0137376_101413884 | 3300012208 | Vadose Zone Soil | GDLASQELVILERPASGDQLLQRQAGGVRFVPLISRLAFTED* |
Ga0137376_107137121 | 3300012208 | Vadose Zone Soil | LVILERPRSGVGLEQRHAGGVRFVPLISRLAFTEDL* |
Ga0137376_112797652 | 3300012208 | Vadose Zone Soil | QELVILQRGSTGLVERRAGGVRFVPLISRLAFTEEPWA* |
Ga0137370_101054814 | 3300012285 | Vadose Zone Soil | DLASQELVILERPADGGALVHKQAGAVRFVPLISRLAFTEGL* |
Ga0137370_105074631 | 3300012285 | Vadose Zone Soil | LASQELVILQRGPAGLVERRAGGVRFVPLISRLAFTEEPWL* |
Ga0137386_101469924 | 3300012351 | Vadose Zone Soil | IGDLVAQELVILEREPTGLVERRAGGVRFVPLISRLAFTEGPWG* |
Ga0137386_104291282 | 3300012351 | Vadose Zone Soil | DLATQELVIVTRGPDGWTERRAGGVRFVPLVSSLAFTEPVEP* |
Ga0137367_101539984 | 3300012353 | Vadose Zone Soil | PIGDLAAQELVILQRAPNGALVERRAGGVRFVPLISRLAFTEGPWG* |
Ga0137367_106863502 | 3300012353 | Vadose Zone Soil | GDLGAQELVILRRAPAGLEERHAGGVRFVPLISRLAFTEGDWG* |
Ga0137369_102628083 | 3300012355 | Vadose Zone Soil | PIGDLAAQELVILQRGPNGALVERRAGGVRFVPLISRLAFTEGPWG* |
Ga0134055_13535811 | 3300012401 | Grasslands Soil | LASQELVILQRGPAGMVERRAGGVRFVPLISRLAFTEEPWT* |
Ga0137373_105194022 | 3300012532 | Vadose Zone Soil | VILQRGPAGVAERRAGGVRFVPLISRLAFTEEPWA* |
Ga0137358_105735811 | 3300012582 | Vadose Zone Soil | RLVIPVGDLSSQELVILERPTGGERLVQHQAGGVRFVPLISRFAFTEEN* |
Ga0137396_107863582 | 3300012918 | Vadose Zone Soil | RLVIPVGDLASQELVILERPTSGERLVQRQAGGVRFVPLISRFAFTEEG* |
Ga0137404_116685811 | 3300012929 | Vadose Zone Soil | ILERGPAGLVERRAGGVRFVPLISRLAFTEEPWR* |
Ga0153915_111697001 | 3300012931 | Freshwater Wetlands | AEQELVILERRADGWAERSAGGVRFVPLISRLAFPAESP* |
Ga0134077_103285572 | 3300012972 | Grasslands Soil | LVIPVGDLGAQELVILQRTAVGGGLGGGGLEERRAGGVRFVPLISRLAFTEGT* |
Ga0134075_101588541 | 3300014154 | Grasslands Soil | LVILQRTAVGGGLGGGGLEERRAGGVRFVPLISRLAFTEGT* |
Ga0134079_101663222 | 3300014166 | Grasslands Soil | GQELVILQRGPGGSLTERHAGGVRFVPLISRLAFTEEPWT* |
Ga0180061_10836732 | 3300014861 | Soil | ASQELVILERAGDGDRLVQQQAGGVRFVPLISRLAFSEEP* |
Ga0180078_10376442 | 3300014865 | Soil | LGAQDLVVYRRTPNGLEERSAGSVRFVPLISRFAFAEREWR* |
Ga0137420_11045161 | 3300015054 | Vadose Zone Soil | RKSWSGDLASQELVILERPRSGAGLLQHHAGGVRFVPLISRLAFTEER* |
Ga0137418_107288851 | 3300015241 | Vadose Zone Soil | GDLAAQELVILRRTVSGFEERRAGGVRFVPLISRLAFSELPRR* |
Ga0134073_100008101 | 3300015356 | Grasslands Soil | LVIFTRTPAGLEERRAGGVRFVPLISRLAFTEGEQN* |
Ga0134073_100091094 | 3300015356 | Grasslands Soil | ELVILQRGPAGLVERRAGGVRFVPLISRLAFTEEPWL* |
Ga0134089_103520152 | 3300015358 | Grasslands Soil | VGDLSSQELVILERPTSGERLVQHQAGGVRFVPLISRFAFTEDH* |
Ga0134083_101343822 | 3300017659 | Grasslands Soil | VGDLGAQELVILQRTAVGGGLGGGGLEERRAGGVRFVPLISRLAFTEGT |
Ga0134083_102609552 | 3300017659 | Grasslands Soil | TQELVIVTRGRDGWTERHAGGVRFVPLVSSLAFSEPVEP |
Ga0184623_101465383 | 3300018056 | Groundwater Sediment | VIPLGDLASQELVIMRRTAEGGLEEQRAGGVRFVPLVSRLAFAEES |
Ga0184623_104538402 | 3300018056 | Groundwater Sediment | VGDLATQELVIVTRTGDGWQERRAGGVRFVPLVSRLAFPEEPLR |
Ga0066655_112928262 | 3300018431 | Grasslands Soil | SQELVILERPTSSERLVQHQAGGVRFVPLISRFAFTEEN |
Ga0066662_123148642 | 3300018468 | Grasslands Soil | GAQELVILTRTPAGLDERRAGGVRFVPLISRLAFTEGDRT |
Ga0066669_106786231 | 3300018482 | Grasslands Soil | ELVILQRGPAGMVERRAGGVRFVPLISRLAFTEEPWT |
Ga0066669_116281131 | 3300018482 | Grasslands Soil | ELGILERPADGGALVHKQAGAVRFVPLISRLAFTDGL |
Ga0179594_100671541 | 3300020170 | Vadose Zone Soil | IPIGDLATQELVILERSKNGEGLVQQQAGGVRFVPLISRLAFTEER |
Ga0137417_10540252 | 3300024330 | Vadose Zone Soil | SQELVILQRGPAGLVERRAGGVRFVPLISRLAFTEEPWT |
Ga0207646_102568273 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | LASQELVILQRSASGELLYRNAGGVRFVPLISRLAFTEQSP |
Ga0207646_103654393 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | QELVVLQRSARGLEERSAGGVRFVPLISRLGFTEESRS |
Ga0209350_10086913 | 3300026277 | Grasslands Soil | VIPVGDLASQELVVLERGPAGLVARRAGGVRFVPLISRLAFTEEPWG |
Ga0209027_11368221 | 3300026300 | Grasslands Soil | IPVGDLSGQELVILERGPGGSLTERHAGGVRFVPLISRLAFTEEPWS |
Ga0209027_12689371 | 3300026300 | Grasslands Soil | PIGDLASQELVIIQRGPAGLVERHAGGVRFVPLISRLAFTEEPWT |
Ga0209239_12453251 | 3300026310 | Grasslands Soil | VILQRGPAGMVERRAGGVRFVPLISRLAFTEEPWT |
Ga0209266_10036431 | 3300026327 | Soil | VIYERTPSGIEERRAGGVRFVPLISRLAFTEGDWG |
Ga0209375_10077121 | 3300026329 | Soil | LVIPVGDLASQELVILQRGSTGLVERRAGGVRFVPLISRLAFTEEPWA |
Ga0209057_10300001 | 3300026342 | Soil | ERSEHGGGELVQRQAGGVRFVPLISRLAFTEQPLP |
Ga0209059_11610352 | 3300026527 | Soil | GDLRAQELVILTRTPAGLDERRAGGVRFVPLISQLAFREGDQN |
Ga0209059_12034241 | 3300026527 | Soil | PVGDLSGQELVILQRGAEGGLTERHAGGVRFVPLISRLAFTEEPWA |
Ga0209160_10008371 | 3300026532 | Soil | QELVIVTRGASGWTERRAGGVRFVPLVSSLAFTEPVEP |
Ga0209160_10388715 | 3300026532 | Soil | DLASQELVIWERGRDGTPRERRAGGVRFVPLISRLAFTEEPEWR |
Ga0209058_11052843 | 3300026536 | Soil | LVILERSTRGELVQRNAGGVRFVPLISRLAFTEEPSA |
Ga0209056_103452472 | 3300026538 | Soil | QELVILQRGPAGMVERRAGGVRFVPLISRLAFTEEPWT |
Ga0209056_105152641 | 3300026538 | Soil | RLVIPVGDLATQELLVLERKPAPAGLVARRAGGVRFVPLISRLGFTEEPWT |
Ga0209376_10754511 | 3300026540 | Soil | IPVGDLSSQELVILERPTSSERLVQHQAGGVRFVPLISRFAFTEEN |
Ga0209376_11389481 | 3300026540 | Soil | ASQELVILERSEHGGGELVQRQAGGVRFVPLISRLAFTEQPLP |
Ga0209388_10329754 | 3300027655 | Vadose Zone Soil | GDLASQELVILERPTNGAGLVQRQAGGVRFVPLISRFAFTEEG |
Ga0209178_13104521 | 3300027725 | Agricultural Soil | PIGDLVTQELFIIERRPTGLTERRAGGVRFVPLISRLAFTEEPLV |
Ga0209689_10227156 | 3300027748 | Soil | WERGRDGTPRERRAGGVRFVPLISRLAFTEEPEWR |
Ga0209689_12840372 | 3300027748 | Soil | VIPVGDLSGQELVILQRGPGGRLTERRAGGVRFVPLISRLAFTEEPWS |
Ga0209073_103972421 | 3300027765 | Agricultural Soil | IIPVGDLALQELVILERPRSGEGIVERQAGGVRFVPLISRLAFTED |
Ga0209283_104036062 | 3300027875 | Vadose Zone Soil | VILERGPAGLVERRAGGVRFVPLISRLAFTEEPWR |
Ga0209283_104853711 | 3300027875 | Vadose Zone Soil | QELVILRRTADGLEERRAGGVRFVPLISRLAFSELPRR |
Ga0209382_116904861 | 3300027909 | Populus Rhizosphere | VILERPVNGDGLVQHQAGGVRFVPLISRLAFSEEP |
Ga0137415_112724431 | 3300028536 | Vadose Zone Soil | ASQELVIWERSADGTLRERRAGGVRFVPLISRLAFTEEPEWR |
Ga0307501_100300431 | 3300031152 | Soil | LVIPIGDLAAQELVILERPASGDRLLQHRAGGVRFVPLISRLAFTED |
Ga0307469_118361461 | 3300031720 | Hardwood Forest Soil | RLVIPIGDLASQELVIWERGADGTPRERRAGGVRFVPLISRLAFTEEPEWR |
Ga0307473_104629671 | 3300031820 | Hardwood Forest Soil | LVIPVGDLASQELVILERGAHGELLPRYAGGVRFVPLISRLAFTEEPSP |
Ga0307479_113363142 | 3300031962 | Hardwood Forest Soil | PIGDRGMQELVVYERTPTGVQERGAGGVRFVPLISRLAFPEEDWS |
Ga0326597_104273763 | 3300031965 | Soil | DLASQELVVLRRTAQGLTERRLGGVRFVPLISRLAFVEEGWR |
Ga0307472_1015718452 | 3300032205 | Hardwood Forest Soil | ELVILERGPAGLVERRAGGVRFVPLISRLAFTEEPWR |
Ga0364940_0039031_1127_1255 | 3300034164 | Sediment | LTAQELVILERPAHGQGQLEQRQAGGVRFVPLISRHAFSEDR |
Ga0364934_0390776_1_129 | 3300034178 | Sediment | DLASQELVILERPPTGEGLVQRQAGGVRFVPLISRLAFTEER |
⦗Top⦘ |