Basic Information | |
---|---|
Family ID | F057728 |
Family Type | Metagenome |
Number of Sequences | 136 |
Average Sequence Length | 39 residues |
Representative Sequence | MFFHLPFGHAEVRVDSRDPHKIRSAAALDVIRRVRARRS |
Number of Associated Samples | 111 |
Number of Associated Scaffolds | 136 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 82.35 % |
% of genes near scaffold ends (potentially truncated) | 19.85 % |
% of genes from short scaffolds (< 2000 bps) | 72.06 % |
Associated GOLD sequencing projects | 100 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.36 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (98.529 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (22.059 % of family members) |
Environment Ontology (ENVO) | Unclassified (38.235 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (63.971 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.87% β-sheet: 11.94% Coil/Unstructured: 61.19% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 136 Family Scaffolds |
---|---|---|
PF05534 | HicB | 36.03 |
PF13349 | DUF4097 | 13.24 |
PF13345 | Obsolete Pfam Family | 9.56 |
PF01464 | SLT | 6.62 |
PF07690 | MFS_1 | 5.15 |
PF00575 | S1 | 3.68 |
PF05977 | MFS_3 | 3.68 |
PF04851 | ResIII | 2.94 |
PF02687 | FtsX | 0.74 |
PF08681 | DUF1778 | 0.74 |
PF09861 | Lar_N | 0.74 |
PF01121 | CoaE | 0.74 |
PF03575 | Peptidase_S51 | 0.74 |
PF00476 | DNA_pol_A | 0.74 |
PF07098 | DUF1360 | 0.74 |
COG ID | Name | Functional Category | % Frequency in 136 Family Scaffolds |
---|---|---|---|
COG1598 | Antitoxin component HicB of the HicAB toxin-antitoxin system | Defense mechanisms [V] | 36.03 |
COG4226 | Predicted nuclease of the RNAse H fold, HicB family | General function prediction only [R] | 36.03 |
COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 3.68 |
COG0237 | Dephospho-CoA kinase | Coenzyme transport and metabolism [H] | 0.74 |
COG0749 | DNA polymerase I, 3'-5' exonuclease and polymerase domains | Replication, recombination and repair [L] | 0.74 |
COG4453 | Uncharacterized conserved protein, DUF1778 family | Function unknown [S] | 0.74 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 98.53 % |
Unclassified | root | N/A | 1.47 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2124908045|KansclcFeb2_ConsensusfromContig64943 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 986 | Open in IMG/M |
2170459010|GIO7OMY01A5XWV | Not Available | 502 | Open in IMG/M |
3300000956|JGI10216J12902_112709132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 616 | Open in IMG/M |
3300001431|F14TB_101066408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 626 | Open in IMG/M |
3300001431|F14TB_102047607 | All Organisms → cellular organisms → Bacteria | 1258 | Open in IMG/M |
3300001686|C688J18823_10981706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 536 | Open in IMG/M |
3300002568|C688J35102_117974440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 519 | Open in IMG/M |
3300002568|C688J35102_119726763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 759 | Open in IMG/M |
3300002568|C688J35102_119810404 | Not Available | 781 | Open in IMG/M |
3300002568|C688J35102_120246284 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 947 | Open in IMG/M |
3300004081|Ga0063454_100376153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 936 | Open in IMG/M |
3300004114|Ga0062593_100890529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 898 | Open in IMG/M |
3300004157|Ga0062590_101887780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 615 | Open in IMG/M |
3300004463|Ga0063356_100605657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1482 | Open in IMG/M |
3300004479|Ga0062595_100988478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 721 | Open in IMG/M |
3300004480|Ga0062592_100625291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 921 | Open in IMG/M |
3300005166|Ga0066674_10112340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1271 | Open in IMG/M |
3300005171|Ga0066677_10008996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4246 | Open in IMG/M |
3300005175|Ga0066673_10335351 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 883 | Open in IMG/M |
3300005175|Ga0066673_10609691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 634 | Open in IMG/M |
3300005176|Ga0066679_10504607 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 789 | Open in IMG/M |
3300005178|Ga0066688_10849295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 567 | Open in IMG/M |
3300005179|Ga0066684_10039575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2636 | Open in IMG/M |
3300005179|Ga0066684_10589282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 746 | Open in IMG/M |
3300005184|Ga0066671_10102976 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Hamadaea → Hamadaea tsunoensis | 1587 | Open in IMG/M |
3300005186|Ga0066676_10106080 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1713 | Open in IMG/M |
3300005328|Ga0070676_11349161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 546 | Open in IMG/M |
3300005332|Ga0066388_100221150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2523 | Open in IMG/M |
3300005332|Ga0066388_103885332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 762 | Open in IMG/M |
3300005338|Ga0068868_100699490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 907 | Open in IMG/M |
3300005339|Ga0070660_100067984 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2777 | Open in IMG/M |
3300005406|Ga0070703_10111479 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 980 | Open in IMG/M |
3300005440|Ga0070705_100736935 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 778 | Open in IMG/M |
3300005445|Ga0070708_100049621 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3714 | Open in IMG/M |
3300005445|Ga0070708_100119050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2434 | Open in IMG/M |
3300005451|Ga0066681_10407948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 835 | Open in IMG/M |
3300005454|Ga0066687_10179065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1143 | Open in IMG/M |
3300005468|Ga0070707_100306339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1544 | Open in IMG/M |
3300005471|Ga0070698_100098828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2892 | Open in IMG/M |
3300005526|Ga0073909_10147939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 977 | Open in IMG/M |
3300005556|Ga0066707_10512320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 778 | Open in IMG/M |
3300005559|Ga0066700_11006998 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 548 | Open in IMG/M |
3300005560|Ga0066670_10233022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1113 | Open in IMG/M |
3300005560|Ga0066670_10464482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 780 | Open in IMG/M |
3300005576|Ga0066708_10233915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1164 | Open in IMG/M |
3300005618|Ga0068864_100997831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 830 | Open in IMG/M |
3300005764|Ga0066903_100005900 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 10739 | Open in IMG/M |
3300005764|Ga0066903_100127157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3568 | Open in IMG/M |
3300005764|Ga0066903_100203345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 2968 | Open in IMG/M |
3300006046|Ga0066652_100153433 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1934 | Open in IMG/M |
3300006049|Ga0075417_10000317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 10277 | Open in IMG/M |
3300006163|Ga0070715_10013621 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2991 | Open in IMG/M |
3300006791|Ga0066653_10016566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2686 | Open in IMG/M |
3300006796|Ga0066665_10088058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2249 | Open in IMG/M |
3300006796|Ga0066665_11090047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 609 | Open in IMG/M |
3300006797|Ga0066659_10227170 | All Organisms → cellular organisms → Bacteria | 1383 | Open in IMG/M |
3300006871|Ga0075434_100439322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1326 | Open in IMG/M |
3300006954|Ga0079219_10028108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 2185 | Open in IMG/M |
3300009137|Ga0066709_101571778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 944 | Open in IMG/M |
3300009147|Ga0114129_12454449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 624 | Open in IMG/M |
3300009545|Ga0105237_10773989 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 966 | Open in IMG/M |
3300010044|Ga0126310_10002275 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 7715 | Open in IMG/M |
3300010359|Ga0126376_10704076 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 972 | Open in IMG/M |
3300010376|Ga0126381_101158831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1117 | Open in IMG/M |
3300010397|Ga0134124_12219863 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 589 | Open in IMG/M |
3300012198|Ga0137364_11132901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 588 | Open in IMG/M |
3300012200|Ga0137382_10554556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 819 | Open in IMG/M |
3300012200|Ga0137382_10815211 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 672 | Open in IMG/M |
3300012200|Ga0137382_10996201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 602 | Open in IMG/M |
3300012201|Ga0137365_10050363 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3155 | Open in IMG/M |
3300012206|Ga0137380_11012417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 710 | Open in IMG/M |
3300012208|Ga0137376_10214642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1666 | Open in IMG/M |
3300012208|Ga0137376_10531859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1019 | Open in IMG/M |
3300012208|Ga0137376_11812680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 500 | Open in IMG/M |
3300012210|Ga0137378_11106510 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 707 | Open in IMG/M |
3300012211|Ga0137377_10135466 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2354 | Open in IMG/M |
3300012350|Ga0137372_10572134 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 832 | Open in IMG/M |
3300012958|Ga0164299_10469588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 828 | Open in IMG/M |
3300012975|Ga0134110_10541372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 534 | Open in IMG/M |
3300012989|Ga0164305_10048224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2476 | Open in IMG/M |
3300013296|Ga0157374_11100081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 815 | Open in IMG/M |
3300014150|Ga0134081_10076006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1032 | Open in IMG/M |
3300014154|Ga0134075_10494541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 547 | Open in IMG/M |
3300014157|Ga0134078_10107448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1052 | Open in IMG/M |
3300014968|Ga0157379_11322995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 696 | Open in IMG/M |
3300015371|Ga0132258_10041797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 10416 | Open in IMG/M |
3300017654|Ga0134069_1143415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 796 | Open in IMG/M |
3300018027|Ga0184605_10004831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4820 | Open in IMG/M |
3300018027|Ga0184605_10017742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2819 | Open in IMG/M |
3300018027|Ga0184605_10043651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1891 | Open in IMG/M |
3300018061|Ga0184619_10069938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1549 | Open in IMG/M |
3300018431|Ga0066655_10049879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2152 | Open in IMG/M |
3300018431|Ga0066655_10737681 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 668 | Open in IMG/M |
3300018433|Ga0066667_10020967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3475 | Open in IMG/M |
3300018433|Ga0066667_10310284 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1232 | Open in IMG/M |
3300018433|Ga0066667_10952780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 740 | Open in IMG/M |
3300018468|Ga0066662_12468356 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 548 | Open in IMG/M |
3300018482|Ga0066669_10134321 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1789 | Open in IMG/M |
3300018482|Ga0066669_10406032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1155 | Open in IMG/M |
3300022756|Ga0222622_10088678 | All Organisms → cellular organisms → Bacteria | 1870 | Open in IMG/M |
3300022756|Ga0222622_11093730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 586 | Open in IMG/M |
3300025711|Ga0207696_1071510 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 964 | Open in IMG/M |
3300025885|Ga0207653_10002274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 6122 | Open in IMG/M |
3300025898|Ga0207692_10015471 | All Organisms → cellular organisms → Bacteria | 3358 | Open in IMG/M |
3300025899|Ga0207642_11031854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 530 | Open in IMG/M |
3300025905|Ga0207685_10127354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1126 | Open in IMG/M |
3300025910|Ga0207684_10307903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1365 | Open in IMG/M |
3300025922|Ga0207646_10056754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3499 | Open in IMG/M |
3300026023|Ga0207677_10880766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 806 | Open in IMG/M |
3300026300|Ga0209027_1015271 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2907 | Open in IMG/M |
3300026300|Ga0209027_1146767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 806 | Open in IMG/M |
3300026306|Ga0209468_1025648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2081 | Open in IMG/M |
3300026312|Ga0209153_1006532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3647 | Open in IMG/M |
3300026318|Ga0209471_1336021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 501 | Open in IMG/M |
3300026343|Ga0209159_1093270 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1325 | Open in IMG/M |
3300026377|Ga0257171_1098469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 519 | Open in IMG/M |
3300026529|Ga0209806_1004133 | All Organisms → cellular organisms → Bacteria | 8524 | Open in IMG/M |
3300026530|Ga0209807_1210188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 674 | Open in IMG/M |
3300026538|Ga0209056_10024384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 5841 | Open in IMG/M |
3300026550|Ga0209474_10136942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1607 | Open in IMG/M |
3300027748|Ga0209689_1383688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 537 | Open in IMG/M |
3300027873|Ga0209814_10006437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 4520 | Open in IMG/M |
3300028705|Ga0307276_10028200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1148 | Open in IMG/M |
3300028705|Ga0307276_10041376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 994 | Open in IMG/M |
3300028714|Ga0307309_10153914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 583 | Open in IMG/M |
3300028715|Ga0307313_10016890 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1940 | Open in IMG/M |
3300028791|Ga0307290_10011258 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3028 | Open in IMG/M |
3300028799|Ga0307284_10022990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2019 | Open in IMG/M |
3300028807|Ga0307305_10379810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 639 | Open in IMG/M |
3300028814|Ga0307302_10044350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2063 | Open in IMG/M |
3300028819|Ga0307296_10078565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1758 | Open in IMG/M |
3300028878|Ga0307278_10395333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 608 | Open in IMG/M |
3300028881|Ga0307277_10003627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 5925 | Open in IMG/M |
3300031858|Ga0310892_10700277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 695 | Open in IMG/M |
3300031938|Ga0308175_100348101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1530 | Open in IMG/M |
3300033475|Ga0310811_10160849 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2808 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 22.06% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.29% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.82% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.82% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 8.09% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 8.09% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.68% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.68% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.94% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.94% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.21% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.47% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.47% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.47% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.74% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.74% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.74% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.74% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.74% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.74% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.74% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.74% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.74% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.74% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.74% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.74% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.74% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.74% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.74% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300028705 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115 | Environmental | Open in IMG/M |
3300028714 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196 | Environmental | Open in IMG/M |
3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
KansclcFeb2_15937370 | 2124908045 | Soil | MLFHLPFGHAEVRVDSRDPHKIRPAAALDVIRRVRARRS |
F62_03052100 | 2170459010 | Grass Soil | MWFHLPFGHADVRVDSRDPRKIRLAAANDVIRRVRARRS |
JGI10216J12902_1127091322 | 3300000956 | Soil | MFFHLPFGHADLRVDSRDPRSVRPAAALDVIRRVRARRS* |
F14TB_1010664081 | 3300001431 | Soil | MLFHLPFGHAEVRVDSRDPHKIRPAAALDVIRRVRARRS* |
F14TB_1020476071 | 3300001431 | Soil | MYVHMPFGHIEVRVDSRDPRKLGHPGALEVIRRVRGRRS* |
C688J18823_109817061 | 3300001686 | Soil | MFIQLPFGHTEVRVDHRDPRQIRSNAALAIIRRVRAGKS* |
C688J35102_1179744402 | 3300002568 | Soil | MLFHLPFGHAEVRVDSRDPHKISPAAANDIIRRVRARRP* |
C688J35102_1197267632 | 3300002568 | Soil | MFFHLPFGHAEVRVDTRDPHQITQTAALDVIRRVRARRRP* |
C688J35102_1198104042 | 3300002568 | Soil | MFIQLPFGHTEVRVDHRDPRQIRSTAALAIIRRVRNARS* |
C688J35102_1202462842 | 3300002568 | Soil | MFIQLPFGHTEVRVDHRDPRKIRSTAALSIIRRVRAGRS* |
Ga0063454_1003761532 | 3300004081 | Soil | MLFHLPFGHAEVRVDSRDPHKISPAAANDVIRRVRARRP* |
Ga0062593_1008905292 | 3300004114 | Soil | MFAHLPYGHVEVRVDSRDPRKLAPASSLEIIRRIRGRRS* |
Ga0062590_1018877802 | 3300004157 | Soil | MFAHLPYGHVEVRVDSRDPRKLAPTSSLEIIRRIRGRRS* |
Ga0063356_1006056573 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MLFHLPFGHADMRVDSRNPQNYRPAAALDVIRRVRARRS* |
Ga0062595_1009884782 | 3300004479 | Soil | MFFHLPFGHAEVRVDSRDPRKNGAVSALDIIRRTRGRRS* |
Ga0062592_1006252912 | 3300004480 | Soil | MFFHLPFGHAEVRVDSRDPRKNGAVSALDVIRRTRGRRS* |
Ga0066674_101123403 | 3300005166 | Soil | MLFHLPFGHAEVRIDSRDPHKIHSAAALDVIRRVRARRS* |
Ga0066677_100089964 | 3300005171 | Soil | MFFHLPFGHAEVRVDSRDPHKIRATPALEVIRRVRARRS* |
Ga0066673_103353512 | 3300005175 | Soil | MYVHMPFGHIEVRVDSHEPRKLGHAGALDVIRRVRRRRS* |
Ga0066673_106096912 | 3300005175 | Soil | MFLHLPFGHAEVRVDARDPKKLRPAGALDVIRRVRARKS* |
Ga0066679_105046072 | 3300005176 | Soil | MFFHLPFGHAEMRVDSRDPHKLRPTPALEVIRRVRARRS* |
Ga0066688_108492952 | 3300005178 | Soil | MLFHLPFGHAEVRVDSRDPHKIRSTAALDVIRRVRARRS* |
Ga0066684_100395753 | 3300005179 | Soil | MFFHLPFGHAEVRVDSRDPHKIRLAGANEVIRRVRARRS* |
Ga0066684_105892821 | 3300005179 | Soil | MFVQLPFGHAETRIDPREPRKLAPTSALEVIRRVRRCAS* |
Ga0066671_101029762 | 3300005184 | Soil | MFLHLPFGHAEVRVDARDPRKLRPAGALDVIRRVRARKS* |
Ga0066676_101060802 | 3300005186 | Soil | MFFHLPFGHAEVRVDARDPHKIRPRAALDVIRCVRARRS* |
Ga0070676_113491612 | 3300005328 | Miscanthus Rhizosphere | MLFHLPFGHAEVRVDSRNPQKIRSAAALDVIRRVRARRS* |
Ga0066388_1002211502 | 3300005332 | Tropical Forest Soil | MYVHLPMGHIEVRVDSRNPHKLGRPGANEIIRRVRGRRS* |
Ga0066388_1038853322 | 3300005332 | Tropical Forest Soil | MFAHLPYGHVEVRVDSRDPRKLAPAGSLEIIRRIRGRRS* |
Ga0068868_1006994902 | 3300005338 | Miscanthus Rhizosphere | MFFHLPFGHAEVRVDSRDPHKIRSAAALDVIRRVRARRS* |
Ga0070660_1000679845 | 3300005339 | Corn Rhizosphere | MLFHLPFGHAEVRVDSRNPHKIRSAAALDVIRRVRARRS* |
Ga0070703_101114792 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MLFHLPFGHAEVRVDSRDPHKIRSAAALDVIRRVRARRS* |
Ga0070705_1007369352 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MFFHLPFGHTEVRVDSRDPRKNGAVSALDVIRRTRGRRS* |
Ga0070708_1000496212 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MFFHLPFGHAEVRVDARDPHKIRPAAALDVIRRVRARRS* |
Ga0070708_1001190504 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MLFHLPFGHAEVRVDSRDPHKIRSAAANDVIRRVRARRS* |
Ga0066681_104079482 | 3300005451 | Soil | MYVHMPLGHIEVRVDSHDPRKLGHAGALDVIRRVRRRRS* |
Ga0066687_101790652 | 3300005454 | Soil | MLFHLPFGHAEVRVDSRDPHKICPAAAHDVIRRVRARRS* |
Ga0070707_1003063393 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MFFHLPFGHTEVRVDSRDPRKNGALSALEVIRRTRGRRS* |
Ga0070698_1000988283 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MFFHLPFGHTEVRVDSRDPRKNGAVSALEVIRRTRGRRS* |
Ga0073909_101479392 | 3300005526 | Surface Soil | MFIQLPFGHTEARVDHRDPRKIRSTTAHEIIRRVRARRS* |
Ga0066707_105123201 | 3300005556 | Soil | HLPFGHAEVRVDSRDPHKIRSAAALDVIRRVRARRS* |
Ga0066700_110069982 | 3300005559 | Soil | MLFHLPFGHAEVRVDSRDPHKFSPAAANDVIRRVRARRP* |
Ga0066670_102330221 | 3300005560 | Soil | VMYVHMPFGHIEVRVDSHDPRKLGHAGALDVIRRVRRRRS* |
Ga0066670_104644822 | 3300005560 | Soil | MYVHMPLGHIEVRVDSRDPRKLGHPGALEVIRRVRGRRS* |
Ga0066708_102339151 | 3300005576 | Soil | VKEGKMFFHLPFGHAEVRVDPRDPRKMCPAGALEVIRRVRARRS* |
Ga0068864_1009978313 | 3300005618 | Switchgrass Rhizosphere | MFAHLPFGHVEVRVDSRDPRKLAPASSLEIIRRIRGRR |
Ga0066903_1000059003 | 3300005764 | Tropical Forest Soil | MFVHLPFGHVEVRVDSRDPRKLGQPGALEVIRRVRGRRS* |
Ga0066903_1001271573 | 3300005764 | Tropical Forest Soil | MYVHLPLGHIEVRVDSRNPHKLGRPGANEIIRRVRGRRS* |
Ga0066903_1002033452 | 3300005764 | Tropical Forest Soil | MYVHLPLGHIEVRIDSRDPHKLGHPGALDVIRRVRGRRS* |
Ga0066652_1001534332 | 3300006046 | Soil | MYVHLPTGHIEVRVDSRDPRKLGHAGALDVIRRVRGRRS* |
Ga0075417_1000031714 | 3300006049 | Populus Rhizosphere | MYVHMPFGHIEVRVDSRDPRKLGHAGALDVIRRVRGRRS* |
Ga0070715_100136212 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MFAHLPYGHVEVRVDSRDPRKLAPTSSLEIIRRTRGRRS* |
Ga0066653_100165661 | 3300006791 | Soil | MYVHMPFGHIEVRVDSHDPRKLGHAGALDVIRRVRRRRS* |
Ga0066665_100880583 | 3300006796 | Soil | MFFHLPFGHAEVGVDSRDPHKIRATPALEVIRRVRARRS* |
Ga0066665_110900471 | 3300006796 | Soil | MLFHLPFGHAEVRVDSHDPRKIRSADALDVIRRVRARRS* |
Ga0066659_102271703 | 3300006797 | Soil | MFFHLPFGHTEVRVDSRDPRKNGPVSALEVIRRTRGRRS* |
Ga0075434_1004393222 | 3300006871 | Populus Rhizosphere | MFAHLPYGHVEVRVDSRDPRKLAPASSLEIIRRTRGRRS* |
Ga0079219_100281083 | 3300006954 | Agricultural Soil | MFAHLRYGHVEVRVDSRDPRKLAPASSLEIIRRIRGRRS* |
Ga0066709_1015717782 | 3300009137 | Grasslands Soil | MLFHLPFGHAEVRVDSRDPHKIHSAAALDVIRRVRARRS* |
Ga0114129_124544491 | 3300009147 | Populus Rhizosphere | GEMFAHLPYGHVEVRVDSRDPRKLAPASSLEIIRRIRGRRS* |
Ga0105237_107739892 | 3300009545 | Corn Rhizosphere | MFFHLPFGHAEVRVDSRNPHKIRSAAALDVIRRVRARRS* |
Ga0126310_100022755 | 3300010044 | Serpentine Soil | MFFHLPFGHAEVRVDTRDPHNICPNAALDIIRRVRARRRS* |
Ga0126376_107040761 | 3300010359 | Tropical Forest Soil | MYVHLPLGHIEVRVDSRDPRKLGRPGSLDIIRRVRGRRS |
Ga0126381_1011588312 | 3300010376 | Tropical Forest Soil | MYVHLPFGHTEVRVDSRDPRKLGHPGALEVIRRVRGRRS* |
Ga0134124_122198632 | 3300010397 | Terrestrial Soil | FHLPFGHAEVRVDSRDPHKIRSAAALDVIRRVRARRS* |
Ga0137364_111329012 | 3300012198 | Vadose Zone Soil | LFHLPFGHAEVRVDSRDPHKISPAAANDVIRRVRARRP* |
Ga0137382_105545562 | 3300012200 | Vadose Zone Soil | LFHLSFGHAEVRIDSRDPHKIHSAAALDVIHRVRARRS* |
Ga0137382_108152112 | 3300012200 | Vadose Zone Soil | MFFHLPFGHAEVRVDSRDPHKISPAAANDVIRRVRARRP* |
Ga0137382_109962011 | 3300012200 | Vadose Zone Soil | EMLFHLPFGHVDVRVDSRNPQKDHPAAALDVIRRVRSRRS* |
Ga0137365_100503633 | 3300012201 | Vadose Zone Soil | MVFHLPFGHAEVRVDSRDPHKIRSAAALDVIRRVRARRS* |
Ga0137380_110124173 | 3300012206 | Vadose Zone Soil | MFFHLPFGHTEVRVDSRDPRKNGAVSALDVIRRTR |
Ga0137376_102146423 | 3300012208 | Vadose Zone Soil | MWFHLPFGHAEVRVDSRDPHKISPAAANDIIRRVRARRP* |
Ga0137376_105318592 | 3300012208 | Vadose Zone Soil | PELGGEMFFHLPFGHAEVRVDARDPRKIRPRAALDVIRYVRARAS* |
Ga0137376_118126802 | 3300012208 | Vadose Zone Soil | MLFHLPFGHVEVRIDSRDPHKIRSAAALDVIRRVRARRS* |
Ga0137378_111065102 | 3300012210 | Vadose Zone Soil | PFGHAEVRIDSRDPHKIRPAAALDVIRRVRARRS* |
Ga0137377_101354661 | 3300012211 | Vadose Zone Soil | MLFHLPFGHAEVRVDSRDPHKIGPAAANDVIRRVRARRS* |
Ga0137372_105721341 | 3300012350 | Vadose Zone Soil | MFVQLPFGHAEVRVDPRDPRKISPAAANDVIRRVR |
Ga0164299_104695881 | 3300012958 | Soil | MFFHLPVGHAEVRVDSRDPRKNGAVSALDVIRRTRGRRS* |
Ga0134110_105413722 | 3300012975 | Grasslands Soil | MLFHLPFGHAEVRVDSRDPHKIRATPALEVIRRVRAPRS* |
Ga0164305_100482242 | 3300012989 | Soil | MLFHLPFGHAEVRVDSRDPHKIRSGAALDVIRRVRARRS* |
Ga0157374_111000812 | 3300013296 | Miscanthus Rhizosphere | MLFHLPFGHAEVRVDSRNPHKIRSAAALDVIRSVRARRS* |
Ga0134081_100760062 | 3300014150 | Grasslands Soil | MFFHLPFGHVEVHVDTRDPHKIRATPALEVIRRVRARRS* |
Ga0134075_104945412 | 3300014154 | Grasslands Soil | MLFHLPFGHAEVRVDSRDPHKIRATPALEVIRRVRARRS* |
Ga0134078_101074482 | 3300014157 | Grasslands Soil | MLFHLPFGHAEVRVDSRDPHKIHSAAALDVIRRVGARRS* |
Ga0157379_113229951 | 3300014968 | Switchgrass Rhizosphere | GGEMLFHLPFGHAEVRVDSRDPHKIRSAAALDVIRRVRARRS* |
Ga0132258_100417976 | 3300015371 | Arabidopsis Rhizosphere | MYVQLPLGHIEVRVDSRDPHKLGRPGCNEIIRRVRGRRS* |
Ga0134069_11434152 | 3300017654 | Grasslands Soil | MLFHLPFGHAEVRIDSRDPHKIRSAAALDVIRRVRARRS |
Ga0184605_100048314 | 3300018027 | Groundwater Sediment | MFFHLPFGHAEVRVDPRDPHKIRPRAALDVIRCVRARRS |
Ga0184605_100177425 | 3300018027 | Groundwater Sediment | MLFHLPFGHAEVRVDSRDPHKIRSTAALDVIRRVRARRS |
Ga0184605_100436512 | 3300018027 | Groundwater Sediment | MFYHLAFGHAEVRVDSRDPRKNGAVSALDVIRRVRGRRS |
Ga0184619_100699383 | 3300018061 | Groundwater Sediment | MLFHLPFGHAEVRVDSRDPHKIGRAGANDVIRRVRARRS |
Ga0066655_100498792 | 3300018431 | Grasslands Soil | MFFHLPFGHAEVRVDSRDPHKIRATPALEVIRRVRARRS |
Ga0066655_107376811 | 3300018431 | Grasslands Soil | MFLHLPFGHAEVRVDARDPRKLRPAGALDVIRRVRARKS |
Ga0066667_100209675 | 3300018433 | Grasslands Soil | MFLHLPFGHAEVRVDARDPKKLRPAGALDVIRRVRARKS |
Ga0066667_103102843 | 3300018433 | Grasslands Soil | MFFHLPFGHAEVRADRRGRGKMCPAGALEVIRRVRARRS |
Ga0066667_109527802 | 3300018433 | Grasslands Soil | MLFHLPFGHAEVRVDSRDPHKISPAAANDVIRRVRARRP |
Ga0066662_124683562 | 3300018468 | Grasslands Soil | MLFHLPFGHAEVRVDSRDPHKIHSAAALDVIRRVRARRS |
Ga0066669_101343211 | 3300018482 | Grasslands Soil | HLPFGHAEVRVDSRDPHKISPAAANDVIRRVRARRP |
Ga0066669_104060323 | 3300018482 | Grasslands Soil | MYVHMPLGHIEVRVDSHDPRKLGHAGALDVIRRVRRRRS |
Ga0222622_100886784 | 3300022756 | Groundwater Sediment | MFTHLPFGHTEVRVDHRDPHKIRSTTAHEIIRRVRARRS |
Ga0222622_110937301 | 3300022756 | Groundwater Sediment | MFIHLPFGHTEVRVDHRDPHKIHSTSAHEIIRRVRARRS |
Ga0207696_10715102 | 3300025711 | Switchgrass Rhizosphere | MLFHLPFGHAEVRVDSRNPQKIRSAAALDVIRRVRARRS |
Ga0207653_100022742 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MFAHLPYGHVEVRVDSRDPRKLAPTSSLEIIRRIRGRRS |
Ga0207692_100154713 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MFFHLPFGHAEVRVDSRDPRKNGAVSALDVIRRTRGRRS |
Ga0207642_110318542 | 3300025899 | Miscanthus Rhizosphere | MLFHLPFGHAEVRVDSRDPHKIRSAAALDVIRRVRARRS |
Ga0207685_101273541 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | FAHLPYGHVEVRVDSRDPRKLAPTSSLEIIRRIRGRRS |
Ga0207684_103079032 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MLFHLPFGHAEVRVDSRDPHKIRSAAANDVIRRVRARRS |
Ga0207646_100567544 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | FHLPFGHAEVRVDSRDPHKIRSAAANDVIRRVRARRS |
Ga0207677_108807662 | 3300026023 | Miscanthus Rhizosphere | MFFHLPFGHAEVRVDSRDPHKIRSAAALDVIRRVRARRS |
Ga0209027_10152713 | 3300026300 | Grasslands Soil | MLFHLPFGHAEVRIDSRDPHKIHSAAALDVIRRVRARRS |
Ga0209027_11467672 | 3300026300 | Grasslands Soil | MLFHLPFGHAEVRVDSRDPHKISPAAANDIIRRVRARRP |
Ga0209468_10256483 | 3300026306 | Soil | MFFHLPFGHAEVRVDTRDPHQITQTAALDVIRRVRARRRP |
Ga0209153_10065324 | 3300026312 | Soil | MFFHLPFGHAEVRVDSRDPHKIRLAGANEVIRRVRARRS |
Ga0209471_13360212 | 3300026318 | Soil | MFFHLPFGHAEMRVDSRDPHKLRPTPALEVIRRVRARRS |
Ga0209159_10932701 | 3300026343 | Soil | MLFHLPFGHAEVRVDSRDPHKIRSAAALDVIRRVRA |
Ga0257171_10984691 | 3300026377 | Soil | MFFHLPFGHTEVRVDSRDPRKNGPVSALDVIRRTRGRRS |
Ga0209806_10041331 | 3300026529 | Soil | LFHLPFGHAEVRVDSRDPHKISPAAANDVIRRVRARRP |
Ga0209807_12101881 | 3300026530 | Soil | MFFHLPFGHAEVGVDSRDPHKIRATPALEVIRRVRARRS |
Ga0209056_100243846 | 3300026538 | Soil | MLFHLPFGHAEVRVDSRDPHKIRATPALEVIRRVRARRS |
Ga0209474_101369421 | 3300026550 | Soil | FFHLPFGHAEVRVDSRDPHKIRATPALEVIRRVRARRS |
Ga0209689_13836882 | 3300027748 | Soil | MLFHLPFGHAEVRVDSRDPHKLRPTPALEVIRRVRARRS |
Ga0209814_100064373 | 3300027873 | Populus Rhizosphere | MYVHMPFGHIEVRVDSRDPRKLGHAGALDVIRRVRGRRS |
Ga0307276_100282003 | 3300028705 | Soil | MFFHLPFGHAEVRVDTRDPHNICPNAALDIIRRVRARRRS |
Ga0307276_100413762 | 3300028705 | Soil | MFFHLPFGHAEVRVDARDPHKIRPRAALDVIRCVRARRS |
Ga0307309_101539141 | 3300028714 | Soil | MLFHLPFGHVEVRVDSRDPHKIRSAAALDVIRRVRARRS |
Ga0307313_100168903 | 3300028715 | Soil | GGTMFTHLPFGHTEVRVDHRDPHKIRSTTAHEIIRRVRARRS |
Ga0307290_100112581 | 3300028791 | Soil | FHLPFGHAEVRVDSRDPHKIRSAAALDVIRRVRARRS |
Ga0307284_100229902 | 3300028799 | Soil | MFFHLPFGHAEVRVDARDPRKIRPRAALDVIRCVRARPS |
Ga0307305_103798102 | 3300028807 | Soil | MLFHLPFGHAEVRIDSRDPHKIRSGAALDVIRRVRARRS |
Ga0307302_100443503 | 3300028814 | Soil | PELGGEMLFHLPFGHAEVRVDSRDPHKIRSAAALDVIRRVRARRS |
Ga0307296_100785653 | 3300028819 | Soil | LPFGHAEVRVDSRDPHKIRSTAALDVIRRVRARRS |
Ga0307278_103953332 | 3300028878 | Soil | MFFHLPFGHAEVRVDSRDPHKIGRAGANDVIRRVRARRS |
Ga0307277_100036274 | 3300028881 | Soil | MFFHLPFGHAEVRVDVRDPRKIRPRAALDVIRCVRARPS |
Ga0310892_107002772 | 3300031858 | Soil | MFAHLPYGHVEVRVDSRDPRKLAPTSSLEIIRRIRG |
Ga0308175_1003481013 | 3300031938 | Soil | MFFHLPFGHAEVRVDTRDPHQISPPAALDVIRRVRARRRP |
Ga0310811_101608493 | 3300033475 | Soil | MLFHLPFGHADMRVDSRNPQNYRPAAALDVIRRVRARRS |
⦗Top⦘ |