NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F058009

Metagenome / Metatranscriptome Family F058009

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F058009
Family Type Metagenome / Metatranscriptome
Number of Sequences 135
Average Sequence Length 55 residues
Representative Sequence AIVADHYGRHFIRALRQPSQYWGWLLLFAAVIFSLIIAGIAVNRRLAATTSA
Number of Associated Samples 118
Number of Associated Scaffolds 135

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 7.58 %
% of genes near scaffold ends (potentially truncated) 90.37 %
% of genes from short scaffolds (< 2000 bps) 85.19 %
Associated GOLD sequencing projects 114
AlphaFold2 3D model prediction Yes
3D model pTM-score0.46

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (84.444 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland
(11.111 % of family members)
Environment Ontology (ENVO) Unclassified
(36.296 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(45.926 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 62.50%    β-sheet: 0.00%    Coil/Unstructured: 37.50%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.46
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 135 Family Scaffolds
PF02586SRAP 14.07
PF01212Beta_elim_lyase 8.89
PF00355Rieske 5.19
PF05638T6SS_HCP 3.70
PF02547Queuosine_synth 2.22
PF00072Response_reg 1.48
PF14063DUF4254 1.48
PF09990DUF2231 1.48
PF03692CxxCxxCC 1.48
PF00773RNB 0.74
PF00501AMP-binding 0.74
PF00873ACR_tran 0.74
PF13426PAS_9 0.74
PF00108Thiolase_N 0.74
PF12680SnoaL_2 0.74
PF01523PmbA_TldD 0.74
PF03167UDG 0.74
PF03576Peptidase_S58 0.74
PF01226Form_Nir_trans 0.74
PF00535Glycos_transf_2 0.74
PF13565HTH_32 0.74
PF02073Peptidase_M29 0.74
PF01740STAS 0.74
PF08308PEGA 0.74
PF00589Phage_integrase 0.74
PF13581HATPase_c_2 0.74
PF00133tRNA-synt_1 0.74
PF00248Aldo_ket_red 0.74
PF16640Big_3_5 0.74
PF08592Anthrone_oxy 0.74
PF14534DUF4440 0.74
PF02133Transp_cyt_pur 0.74
PF13358DDE_3 0.74
PF01066CDP-OH_P_transf 0.74
PF09851SHOCT 0.74
PF13367PrsW-protease 0.74
PF02401LYTB 0.74
PF13007LZ_Tnp_IS66 0.74
PF10502Peptidase_S26 0.74
PF03699UPF0182 0.74
PF00132Hexapep 0.74
PF13442Cytochrome_CBB3 0.74
PF06778Chlor_dismutase 0.74
PF06262Zincin_1 0.74

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 135 Family Scaffolds
COG1167DNA-binding transcriptional regulator, MocR family, contains an aminotransferase domainTranscription [K] 17.78
COG2135ssDNA abasic site-binding protein YedK/HMCES, SRAP familyReplication, recombination and repair [L] 14.07
COG0075Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucGAmino acid transport and metabolism [E] 8.89
COG0076Glutamate or tyrosine decarboxylase or a related PLP-dependent proteinAmino acid transport and metabolism [E] 8.89
COG0112Glycine/serine hydroxymethyltransferaseAmino acid transport and metabolism [E] 8.89
COG01567-keto-8-aminopelargonate synthetase or related enzymeCoenzyme transport and metabolism [H] 8.89
COG0399dTDP-4-amino-4,6-dideoxygalactose transaminaseCell wall/membrane/envelope biogenesis [M] 8.89
COG0436Aspartate/methionine/tyrosine aminotransferaseAmino acid transport and metabolism [E] 8.89
COG0520Selenocysteine lyase/Cysteine desulfuraseAmino acid transport and metabolism [E] 8.89
COG0626Cystathionine beta-lyase/cystathionine gamma-synthaseAmino acid transport and metabolism [E] 8.89
COG1003Glycine cleavage system protein P (pyridoxal-binding), C-terminal domainAmino acid transport and metabolism [E] 8.89
COG1104Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS familyAmino acid transport and metabolism [E] 8.89
COG1921Seryl-tRNA(Sec) selenium transferaseTranslation, ribosomal structure and biogenesis [J] 8.89
COG1982Arginine/lysine/ornithine decarboxylaseAmino acid transport and metabolism [E] 8.89
COG2008Threonine aldolaseAmino acid transport and metabolism [E] 8.89
COG2873O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependentAmino acid transport and metabolism [E] 8.89
COG3033TryptophanaseAmino acid transport and metabolism [E] 8.89
COG4992Acetylornithine/succinyldiaminopimelate/putrescine aminotransferaseAmino acid transport and metabolism [E] 8.89
COG3157Type VI protein secretion system component Hcp (secreted cytotoxin)Intracellular trafficking, secretion, and vesicular transport [U] 3.70
COG0809S-adenosylmethionine:tRNA-ribosyltransferase-isomerase (queuine synthetase)Translation, ribosomal structure and biogenesis [J] 2.22
COG07614-Hydroxy-3-methylbut-2-enyl diphosphate reductase IspHLipid transport and metabolism [I] 1.48
COG3191L-aminopeptidase/D-esteraseAmino acid transport and metabolism [E] 1.48
COG0060Isoleucyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.74
COG0143Methionyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.74
COG0183Acetyl-CoA acetyltransferaseLipid transport and metabolism [I] 0.74
COG0312Zn-dependent protease PmbA/TldA or its inactivated homologGeneral function prediction only [R] 0.74
COG0495Leucyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.74
COG0525Valyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.74
COG0557Exoribonuclease RTranscription [K] 0.74
COG0558Phosphatidylglycerophosphate synthaseLipid transport and metabolism [I] 0.74
COG0692Uracil-DNA glycosylaseReplication, recombination and repair [L] 0.74
COG1183Phosphatidylserine synthaseLipid transport and metabolism [I] 0.74
COG1573Uracil-DNA glycosylaseReplication, recombination and repair [L] 0.74
COG1615Uncharacterized membrane protein, UPF0182 familyFunction unknown [S] 0.74
COG2116Formate/nitrite transporter FocA, FNT familyInorganic ion transport and metabolism [P] 0.74
COG2309Leucyl aminopeptidase (aminopeptidase T)Amino acid transport and metabolism [E] 0.74
COG3253Coproheme decarboxylase/chlorite dismutaseCoenzyme transport and metabolism [H] 0.74
COG3663G:T/U-mismatch repair DNA glycosylaseReplication, recombination and repair [L] 0.74
COG3824Predicted Zn-dependent protease, minimal metalloprotease (MMP)-like domainPosttranslational modification, protein turnover, chaperones [O] 0.74
COG4776Exoribonuclease IITranscription [K] 0.74
COG5050sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferasesLipid transport and metabolism [I] 0.74


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms84.44 %
UnclassifiedrootN/A15.56 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2140918007|ConsensusfromContig172413All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300004092|Ga0062389_100175456All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter2065Open in IMG/M
3300004092|Ga0062389_103700432All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium574Open in IMG/M
3300005167|Ga0066672_10099763All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1769Open in IMG/M
3300005167|Ga0066672_10458799All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium831Open in IMG/M
3300005171|Ga0066677_10481295All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium712Open in IMG/M
3300005172|Ga0066683_10191003All Organisms → cellular organisms → Bacteria → Acidobacteria1263Open in IMG/M
3300005177|Ga0066690_10205896All Organisms → cellular organisms → Bacteria1310Open in IMG/M
3300005187|Ga0066675_10729914All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium745Open in IMG/M
3300005451|Ga0066681_10169673All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1292Open in IMG/M
3300005471|Ga0070698_100134918All Organisms → cellular organisms → Bacteria2422Open in IMG/M
3300005554|Ga0066661_10086962All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1850Open in IMG/M
3300005950|Ga0066787_10079013All Organisms → cellular organisms → Bacteria → Acidobacteria674Open in IMG/M
3300006050|Ga0075028_100767438All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis585Open in IMG/M
3300006059|Ga0075017_100870565All Organisms → cellular organisms → Bacteria → Acidobacteria698Open in IMG/M
3300006102|Ga0075015_100090855All Organisms → cellular organisms → Bacteria1519Open in IMG/M
3300006162|Ga0075030_100711580All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella sibirica795Open in IMG/M
3300006797|Ga0066659_10098843All Organisms → cellular organisms → Bacteria1980Open in IMG/M
3300007076|Ga0075435_100664805All Organisms → cellular organisms → Bacteria → Acidobacteria905Open in IMG/M
3300009012|Ga0066710_104842362All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis503Open in IMG/M
3300009137|Ga0066709_102491378All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium698Open in IMG/M
3300009524|Ga0116225_1026520All Organisms → cellular organisms → Bacteria2917Open in IMG/M
3300009524|Ga0116225_1046984All Organisms → cellular organisms → Bacteria → Acidobacteria2089Open in IMG/M
3300009617|Ga0116123_1053583All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1142Open in IMG/M
3300009634|Ga0116124_1164638All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium619Open in IMG/M
3300009636|Ga0116112_1175881Not Available595Open in IMG/M
3300009639|Ga0116122_1055069All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis1340Open in IMG/M
3300009639|Ga0116122_1104398All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium920Open in IMG/M
3300009641|Ga0116120_1154586Not Available738Open in IMG/M
3300009643|Ga0116110_1068302All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1245Open in IMG/M
3300009645|Ga0116106_1082386Not Available1048Open in IMG/M
3300009645|Ga0116106_1187969All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis658Open in IMG/M
3300009672|Ga0116215_1137798All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_2_68_51086Open in IMG/M
3300009764|Ga0116134_1091502All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1108Open in IMG/M
3300010303|Ga0134082_10160946All Organisms → cellular organisms → Bacteria → Acidobacteria910Open in IMG/M
3300010304|Ga0134088_10303526All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium771Open in IMG/M
3300010325|Ga0134064_10025725All Organisms → cellular organisms → Bacteria → Acidobacteria1699Open in IMG/M
3300010375|Ga0105239_11047777All Organisms → cellular organisms → Bacteria938Open in IMG/M
3300012201|Ga0137365_10119376All Organisms → cellular organisms → Bacteria → Acidobacteria1983Open in IMG/M
3300012208|Ga0137376_10418142All Organisms → cellular organisms → Bacteria1164Open in IMG/M
3300012211|Ga0137377_11222081All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium681Open in IMG/M
3300012929|Ga0137404_11047192All Organisms → cellular organisms → Bacteria → Acidobacteria747Open in IMG/M
3300012929|Ga0137404_11641965All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis596Open in IMG/M
3300013764|Ga0120111_1013840All Organisms → cellular organisms → Bacteria → Acidobacteria2391Open in IMG/M
3300014052|Ga0120109_1013539All Organisms → cellular organisms → Bacteria1801Open in IMG/M
3300014155|Ga0181524_10414917All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis585Open in IMG/M
3300014161|Ga0181529_10156588All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae1380Open in IMG/M
3300014161|Ga0181529_10296422Not Available904Open in IMG/M
3300014489|Ga0182018_10005958All Organisms → cellular organisms → Bacteria → Acidobacteria9635Open in IMG/M
3300014489|Ga0182018_10360613All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium782Open in IMG/M
3300014489|Ga0182018_10740169All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium511Open in IMG/M
3300014492|Ga0182013_10373071All Organisms → cellular organisms → Bacteria → Acidobacteria774Open in IMG/M
3300014655|Ga0181516_10105949All Organisms → cellular organisms → Bacteria → Proteobacteria1420Open in IMG/M
3300014655|Ga0181516_10200275All Organisms → cellular organisms → Bacteria1013Open in IMG/M
3300014657|Ga0181522_10944890Not Available533Open in IMG/M
3300014657|Ga0181522_11005109Not Available517Open in IMG/M
3300015358|Ga0134089_10425305All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium571Open in IMG/M
3300016750|Ga0181505_10688298Not Available662Open in IMG/M
3300017931|Ga0187877_1053571Not Available1830Open in IMG/M
3300017931|Ga0187877_1073043All Organisms → cellular organisms → Bacteria1490Open in IMG/M
3300017935|Ga0187848_10319149All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia646Open in IMG/M
3300017936|Ga0187821_10296935Not Available641Open in IMG/M
3300017940|Ga0187853_10346416All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis664Open in IMG/M
3300017955|Ga0187817_10133216All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis1576Open in IMG/M
3300017999|Ga0187767_10150313All Organisms → cellular organisms → Bacteria → Acidobacteria697Open in IMG/M
3300018006|Ga0187804_10366545All Organisms → cellular organisms → Bacteria → Acidobacteria634Open in IMG/M
3300018009|Ga0187884_10317104Not Available629Open in IMG/M
3300018012|Ga0187810_10169760All Organisms → cellular organisms → Bacteria → Acidobacteria880Open in IMG/M
3300018012|Ga0187810_10538446All Organisms → cellular organisms → Bacteria → Acidobacteria501Open in IMG/M
3300018013|Ga0187873_1369743All Organisms → cellular organisms → Bacteria → Acidobacteria523Open in IMG/M
3300018026|Ga0187857_10122676Not Available1250Open in IMG/M
3300018033|Ga0187867_10307206Not Available887Open in IMG/M
3300018037|Ga0187883_10229925All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces949Open in IMG/M
3300018043|Ga0187887_10051996All Organisms → cellular organisms → Bacteria2517Open in IMG/M
3300018043|Ga0187887_10248524All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae1054Open in IMG/M
3300018047|Ga0187859_10040215All Organisms → cellular organisms → Bacteria → Acidobacteria2502Open in IMG/M
3300018062|Ga0187784_10453806All Organisms → cellular organisms → Bacteria1035Open in IMG/M
3300018431|Ga0066655_10241911All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1146Open in IMG/M
3300018468|Ga0066662_10585079All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1040Open in IMG/M
3300018468|Ga0066662_11543082All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium692Open in IMG/M
3300020021|Ga0193726_1246087All Organisms → cellular organisms → Bacteria → Acidobacteria727Open in IMG/M
3300020580|Ga0210403_11138980All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300021401|Ga0210393_11289424All Organisms → cellular organisms → Bacteria → Proteobacteria586Open in IMG/M
3300021402|Ga0210385_11034143All Organisms → cellular organisms → Bacteria → Acidobacteria631Open in IMG/M
3300021432|Ga0210384_11280794Not Available638Open in IMG/M
3300025434|Ga0208690_1011298Not Available1780Open in IMG/M
3300025454|Ga0208039_1071683All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium615Open in IMG/M
3300025477|Ga0208192_1081916All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium595Open in IMG/M
3300025496|Ga0208191_1082124All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium669Open in IMG/M
3300025498|Ga0208819_1072205All Organisms → cellular organisms → Bacteria → Acidobacteria761Open in IMG/M
3300026296|Ga0209235_1143608All Organisms → cellular organisms → Bacteria964Open in IMG/M
3300026298|Ga0209236_1093142All Organisms → cellular organisms → Bacteria1371Open in IMG/M
3300026328|Ga0209802_1022372All Organisms → cellular organisms → Bacteria → Acidobacteria3446Open in IMG/M
3300026329|Ga0209375_1175702All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium858Open in IMG/M
3300026456|Ga0255351_1083987All Organisms → cellular organisms → Bacteria → Acidobacteria577Open in IMG/M
3300026537|Ga0209157_1131730All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1145Open in IMG/M
3300026538|Ga0209056_10008646All Organisms → cellular organisms → Bacteria10437Open in IMG/M
3300026547|Ga0209156_10270456All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium778Open in IMG/M
3300026548|Ga0209161_10004694All Organisms → cellular organisms → Bacteria10858Open in IMG/M
3300027330|Ga0207777_1034590All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium922Open in IMG/M
3300027609|Ga0209221_1145537Not Available591Open in IMG/M
3300027854|Ga0209517_10237720All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1099Open in IMG/M
3300027867|Ga0209167_10142322Not Available1253Open in IMG/M
3300027882|Ga0209590_10481678All Organisms → cellular organisms → Bacteria → Acidobacteria802Open in IMG/M
3300028017|Ga0265356_1030129All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium589Open in IMG/M
3300028047|Ga0209526_10510685All Organisms → cellular organisms → Bacteria → Acidobacteria782Open in IMG/M
3300028069|Ga0255358_1036874All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium691Open in IMG/M
3300029636|Ga0222749_10014005All Organisms → cellular organisms → Bacteria3252Open in IMG/M
3300029914|Ga0311359_10609044All Organisms → cellular organisms → Bacteria → Acidobacteria803Open in IMG/M
3300029914|Ga0311359_10650152All Organisms → cellular organisms → Bacteria → Acidobacteria766Open in IMG/M
3300029919|Ga0302141_1053327All Organisms → cellular organisms → Bacteria → Acidobacteria1096Open in IMG/M
3300030058|Ga0302179_10411043All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis595Open in IMG/M
3300030399|Ga0311353_10824713All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium789Open in IMG/M
3300030618|Ga0311354_10794726All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium893Open in IMG/M
3300030646|Ga0302316_10420451All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium536Open in IMG/M
3300030707|Ga0310038_10424531All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis574Open in IMG/M
3300031234|Ga0302325_10004893All Organisms → cellular organisms → Bacteria30840Open in IMG/M
3300031525|Ga0302326_13030273All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300031708|Ga0310686_110917155All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300031712|Ga0265342_10041069All Organisms → cellular organisms → Bacteria → Acidobacteria2803Open in IMG/M
3300031715|Ga0307476_10691086Not Available755Open in IMG/M
3300031753|Ga0307477_10178808All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium1478Open in IMG/M
3300031820|Ga0307473_11414395All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia524Open in IMG/M
3300031823|Ga0307478_11246389Not Available619Open in IMG/M
3300032160|Ga0311301_10293451All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2615Open in IMG/M
3300032421|Ga0310812_10498178All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium548Open in IMG/M
3300032770|Ga0335085_10553776All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1303Open in IMG/M
3300032805|Ga0335078_10388531All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis1837Open in IMG/M
3300033983|Ga0371488_0030350All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii3684Open in IMG/M
3300034091|Ga0326724_0527727All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis600Open in IMG/M
3300034199|Ga0370514_012315All Organisms → cellular organisms → Bacteria2008Open in IMG/M
3300034282|Ga0370492_0440098All Organisms → cellular organisms → Bacteria → Acidobacteria529Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland11.11%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil10.37%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland9.63%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog5.19%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil5.19%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa5.19%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment4.44%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.44%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.44%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.44%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.22%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa2.22%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog2.22%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.96%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.96%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.96%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.48%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost1.48%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.48%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil1.48%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.48%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.48%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil1.48%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.48%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.48%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.74%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.74%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.74%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.74%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.74%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.74%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.74%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.74%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2140918007Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_allEnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005950Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009524Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaGEnvironmentalOpen in IMG/M
3300009617Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100EnvironmentalOpen in IMG/M
3300009634Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150EnvironmentalOpen in IMG/M
3300009636Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150EnvironmentalOpen in IMG/M
3300009639Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40EnvironmentalOpen in IMG/M
3300009641Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150EnvironmentalOpen in IMG/M
3300009643Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40EnvironmentalOpen in IMG/M
3300009645Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40EnvironmentalOpen in IMG/M
3300009672Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaGEnvironmentalOpen in IMG/M
3300009764Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40EnvironmentalOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300013764Permafrost microbial communities from Nunavut, Canada - A28_35cm_6MEnvironmentalOpen in IMG/M
3300014052Permafrost microbial communities from Nunavut, Canada - A23_35cm_12MEnvironmentalOpen in IMG/M
3300014155Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaGEnvironmentalOpen in IMG/M
3300014161Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaGEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014492Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaGEnvironmentalOpen in IMG/M
3300014655Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaGEnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300015358Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300016750Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017931Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017936Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017999Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MGEnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018009Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40EnvironmentalOpen in IMG/M
3300018012Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5EnvironmentalOpen in IMG/M
3300018013Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100EnvironmentalOpen in IMG/M
3300018026Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100EnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300020021Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300025434Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025454Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025477Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025496Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025498Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 (SPAdes)EnvironmentalOpen in IMG/M
3300026296Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026298Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026328Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes)EnvironmentalOpen in IMG/M
3300026329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes)EnvironmentalOpen in IMG/M
3300026456Peat soil microbial communities from Stordalen Mire, Sweden - H.B.S.T-25.r2EnvironmentalOpen in IMG/M
3300026537Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300027330Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 35 (SPAdes)EnvironmentalOpen in IMG/M
3300027609Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028017Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4Host-AssociatedOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028069Peat soil microbial communities from Stordalen Mire, Sweden - G.F.S.T0EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029914III_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029919Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_2EnvironmentalOpen in IMG/M
3300030058Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1EnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030618II_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030646Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_2EnvironmentalOpen in IMG/M
3300030707Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2)EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031712Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaGHost-AssociatedOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032421Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300033983Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fractionEnvironmentalOpen in IMG/M
3300034091Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00NEnvironmentalOpen in IMG/M
3300034199Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14EnvironmentalOpen in IMG/M
3300034282Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
A_all_C_012402602140918007SoilAICRTARYAVIAIVAEHYGRHFIRMLRHPTQYWGWLLLFAAMIFVLIAGGILINRRLANSSAE
Ga0062389_10017545633300004092Bog Forest SoilRYTAVAWIAERYGRHFVRVLRHPTQYWGWLLVFATVISLLIGAGIMINRRLAAA*
Ga0062389_10370043213300004092Bog Forest SoilLYGRPFIRVLRHPTQYWGWLLLFAAVVAGFVATGILLNRRLSTAPAT*
Ga0066672_1009976353300005167SoilADHYGRHFIRALRQPGQYWGWLLLFVAVIFSLIIAGILLNRRLAATTSA*
Ga0066672_1045879923300005167SoilICRAARYGIIAIVADHYGRHFIRALRQPSQYWGWLLLFAAVIFSLIIAGIAVNRRLAATTSA*
Ga0066677_1048129513300005171SoilRYGIIAIVADHYGRHFIRALRQPSQYWGWLLLFAAVIFSLIIAGIAVNRRLPATTSA*
Ga0066683_1019100313300005172SoilVADHYGRHFIRALRQPSQYWGWLLLFAAVIFSLIIAGIAVNRRLAATTSA*
Ga0066690_1020589633300005177SoilIVADHYGRHFIRALRQPSQYWGWLLLFAAVIFSLIIAGIAVNRRLAATTSA*
Ga0066675_1072991413300005187SoilIVADHYGRHFIRALRQPSQYWGWLLLFAAVIFSLIIAGIAVNRRLPATTSA*
Ga0066681_1016967313300005451SoilDHYGRHFIRALRQPGQYWGWLLLFAAVIFSLIIVGIAVNRRLAATTSA*
Ga0070698_10013491813300005471Corn, Switchgrass And Miscanthus RhizosphereDHYGRHFIRALRQPGQYWGWLLLFAAVIFSLSIAGILLNRRLAATTSA*
Ga0066661_1008696243300005554SoilVADHYGRHFIRALRQPSQYWGWLLLFAAVIFSLIIAGIAVNRRLPATTSA*
Ga0066787_1007901313300005950SoilLQFIAIVADDYGRHFVGVLRHPFQYWGWLLLFAAVIFSLIMAGILLNRRLTAAN
Ga0075028_10076743813300006050WatershedsICRGARYVFIAIIADHYGRHFIRVLRHPAQYWGWLLLFAAVMFGLIMAGIVLNKQLAATTSASA*
Ga0075017_10087056513300006059WatershedsVAADLYGRHFIRVLRHPTQYWGWLSLFTVLIFGLITAGILINRRLATVSAG*
Ga0075015_10009085543300006102WatershedsFIAIIADHYGRHFIRVLRHPAQYWGWLLLFAAVMFGLIMAGIVLNKQLAATTSASA*
Ga0075030_10071158013300006162WatershedsLYGRHFIRVLRHPVQYWGWFLLFAVLTIGLIATGILINRRIAGLAG*
Ga0066659_1009884313300006797SoilAIVADHYGRHFIRALRQPSQYWGWLLLFAAVIFSLIIAGIAVNRRLAATTSA*
Ga0075435_10066480523300007076Populus RhizosphereVTICRAARYGIIAVIADHYGRNFIRALRQPGQYWGWLLLFAAVIFSLIIAGILLNRRLAATTSA*
Ga0066710_10484236223300009012Grasslands SoilAIVADHYGRHFIRALRQPGQYWGWLLLFAAVIFSLIIAGIAVNRRLAATTSA
Ga0066709_10249137813300009137Grasslands SoilAIVADHYGRHFIRALRQPSQYWGWLLLFAAVIFSLIIAGIAVNRRLPATTSA*
Ga0116225_102652013300009524Peatlands SoilIAIVADHYGRHFVRALRHPTQYWGWMLLFAALIVGLVVGGILLNRRLETAPA*
Ga0116225_104698433300009524Peatlands SoilVTICRGARYAFIAIIADHYGRHFIRVLRHPAQYWGWLLLFAAVIFSLIMVGIVLNRRLTVTTL*
Ga0116123_105358313300009617PeatlandIIADHYGRHFIRVLRHPIQYWGWFLLFAAVILTVILAGITVNKRLVAATTA*
Ga0116124_116463823300009634PeatlandGARYAFIAIITDHYGRHFIRVLRHPAQHWGWLLLFAAVIFSLIMVGVVLNRRLAATTSA*
Ga0116112_117588123300009636PeatlandVVTICRAARYTLVAIIADHYGRHFVRVLRHPTEYWGWLIAFAAVILLVIMAGIVVNKRLSAAAVA*
Ga0116122_105506923300009639PeatlandGARYTLVAIIADHYGRHFVRVLRHPVQYWGWLLLFAAIILSVILAGVMLNKRLAATTTA*
Ga0116122_110439823300009639PeatlandTGRLLICRSARYTFIAIVADHYGRHFVRVLRHPSQYWGWLLLFAAVIFSLIMAGILLNRRLTAATTA*
Ga0116120_115458613300009641PeatlandIADHYGRHFVRVLRHPTEYWGWLIAFAAVILLVIMAGIVVNKRLSAAAVA*
Ga0116110_106830213300009643PeatlandDHYGRHFIRVLRHPAQHWGWLLLFAAVIFSLIMAGIVLNRRLTTTTSA*
Ga0116106_108238623300009645PeatlandIIADHYGRHFIRVLRHPIEYWGWLLAFAAVILILIMTGVVVNRRLAAATMA*
Ga0116106_118796913300009645PeatlandLVALVADHYGRHFLRILLHPTQHWGWLLLFAAIILSVILAGVMLNKRLAATTTA*
Ga0116215_113779823300009672Peatlands SoilTICRGARYAFIAIIADHYGRHFIRVLRHPAQYWGWLLLFAAVIFSLIMVGIVLNRRLTVTTL*
Ga0116134_109150213300009764PeatlandRHFIRVLRHPAQHWGWLLLFAAVIFSLIMAGIVLNRRLTTTTSA*
Ga0134082_1016094633300010303Grasslands SoilAIVADHYGRHFIRALRQPSQYWGWLLLFAAVIFSLIIAGIAVNRRLVATTSA*
Ga0134088_1030352613300010304Grasslands SoilGIIAIVADHYGRHFIRALRQPGQYWGWLLLFAAVIFSLIIVGIAVNRRLAATTSA*
Ga0134064_1002572533300010325Grasslands SoilVTICRAARYGIIAIVADHYGRHFIRALRQPSQYWGWLLLFAAVIFSLIIAGIAVNRRLVATTSA*
Ga0105239_1104777723300010375Corn RhizosphereAARYAVIAIVAEHYGRHFIRMFRHPTQYWGWLLLLAAMIFFLIAGGILINRRLANSPAE*
Ga0137365_1011937623300012201Vadose Zone SoilVTICRAARYGIIAIVADHYGRHFIRALRQPSQYWGWLLLFAAVIFSLIIAGILLNRRLAATTSA*
Ga0137376_1041814213300012208Vadose Zone SoilHYGRHFIRALRQPSQYWGWLLLFAAVIFSLIIAGIAVNRRLPATTSA*
Ga0137377_1122208123300012211Vadose Zone SoilVTVCRGARYAFIAIIADHYGRHFIRVLRQPGQYWGWLLLFAAVIFSLIIAGIAVNRRLAATTSA*
Ga0137404_1104719213300012929Vadose Zone SoilRYGITAIVADHYGRHFIRALRQPGQYWGWLLLFAAVIFSLIIAGIAVNRRLAATTSA*
Ga0137404_1164196513300012929Vadose Zone SoilIIADHYGRHFIRVLRHPAQYWGWSLVLAAVIFSLIMGGIAVNKRFAAA*
Ga0120111_101384033300013764PermafrostVVTICRGARYAFIAVIADHYGRHFIRFLRQPAPYWGWLLLFAAVIFGLIMGGIALNRRLATATSA*
Ga0120109_101353923300014052PermafrostVIICRSARYTFIAIVADHYGRHFVRVLRHPSQYWGWLLLFAAVIFSLIMAGILLN*
Ga0181524_1041491723300014155BogAIIADHYGRHFIRVLRHPAQHWGWLLLVAAVIFSLIMAGIVLNRRLAATTSA*
Ga0181529_1015658813300014161BogVAIVADHYGRHFIRVLRHPVQYWGWLLLFAAIILCVILAGILISRRFAATATA*
Ga0181529_1029642223300014161BogAIIADHYGRHFIRVLRHPIEYWGWLLAFAAVILILIMTGVVVNRRLAAATMA*
Ga0182018_10005958163300014489PalsaFIAIVADHYGRHFVRVLRHPSQYWGWLLLFAAVIFSLIMAGILLNRRLTAATTA*
Ga0182018_1036061323300014489PalsaHYGRHFVRVLRHPSQYWGWLLLFAAVIFSLIMAGILLNRRLTVANIG*
Ga0182018_1074016923300014489PalsaAIVADHYGRHFVRVLRHPSQYWGWLLLFAAVIFSLIIAGILLNRRLTAATTA*
Ga0182013_1037307123300014492BogADHYGRHIVRVLRHPVQYWGWLLLFAALILSVIMAGVMLNRRLAATTAA*
Ga0181516_1010594913300014655BogTICRAARYTLVAIVADHYGRHFIRVLRHPVQYWGWLLLFAAIILCVILAGILISRRFAATATA*
Ga0181516_1020027523300014655BogHYGRHFIRVLSHPTQYWGWLLVFAAVILAVILAGIVLNKRLAAATTA*
Ga0181522_1094489023300014657BogYTLIAIIADHYGRHFIRVLRHPIEYWGWLLAFAAVILILIMTGVVVNRRLAAATMA*
Ga0181522_1100510913300014657BogHYGRHFIRALRHPDQYWGWLLLFAAVVLSLIMGGIELNRRLTATTPA*
Ga0134089_1042530513300015358Grasslands SoilIAIVADHYGRHFIRALRQPGQYWGWLLLFAAVIFSLIIVGIAVNRRLAATTSA*
Ga0181505_1068829813300016750PeatlandTICRGARYTLVAIIADHYGRHFVRVLRHPTEYWGWLIAFAAVILLVIMAGIVVNKRLSAAAVA
Ga0187877_105357113300017931PeatlandAICRGARYTLIAIIADHYGRHFTRVLRHPIEYWGWLLAFAAVILILIMTGVVVNRRLAAATMA
Ga0187877_107304353300017931PeatlandFIAIIADHYGRHFIRVLRHPAQHWGWLLLFAAVIFSLIMAGIVLNRRLAATTSA
Ga0187848_1031914913300017935PeatlandAIIADHYGRHFIRVLRHPSQYWGWLLLSAAVILGLVAAGIVINRRLVVPAGA
Ga0187821_1029693523300017936Freshwater SedimentTVITLCRGARYSLIAIIADHYGRHFIRALRHPTQYWGWLLLFASLGIGLTVAAFMVNRRLSTVAN
Ga0187853_1034641613300017940PeatlandIIADHYGRHFVRVLRHPVQYWGWLLLFAAIILSVILAGVMLNKRLAATTAA
Ga0187817_1013321613300017955Freshwater SedimentTICRGARYGVIAIIADHYGRHFIRVLRHPAQYWGWSLLFAAVIASLLIAGIALNRRLAATTTA
Ga0187767_1015031313300017999Tropical PeatlandVIAVVADHYGRHFIRALRHPIQYWGWLALFAAIILGLVGAGILINRRLETLSAAPTRVSA
Ga0187804_1036654533300018006Freshwater SedimentVAVVADLYGRHFIRVLRHPTQYWGWSLLFAMMIVGFIATGILVNRRLATASAA
Ga0187884_1031710413300018009PeatlandIADHYVRHFIRVLQHPAKYWGWLLVFATLILSVILAGVMLNKRLAATTAA
Ga0187810_1016976023300018012Freshwater SedimentVVTICRGARYGVIAIIADHYGRHFIRVLRHPAQYWGWSLLFAAILFSLIIGGITLNRRLAATTTA
Ga0187810_1052294613300018012Freshwater SedimentIIADLYGRHFIRMLRHPVQYWGWFLAFAALAIGLIAGGILINRRITSEPAG
Ga0187810_1053844623300018012Freshwater SedimentRGLRYSLVAIIADHYGRHFIRVLRHPIQYWGWLLVFAAVILTVILAGITVNKRLLAATTA
Ga0187873_136974323300018013PeatlandDHYGRHFIRVLRHPAQHWGWLLLFAAVIFSLIMAGIVLNRRLTTTTSA
Ga0187857_1012267613300018026PeatlandIITDHYGRHFIRVLRHPIEYWGWLLAFAAVILILIMTGVVVNRRLAAATMA
Ga0187867_1030720623300018033PeatlandYGRHFIRVLRHPIEYWGWLLAFAAVILILIMTGVVVNRRLAAATMA
Ga0187883_1022992523300018037PeatlandVAIIADHYGRHFIRVLRHPIQYWGWLLLFAAIILAVIWAGIVLNKRLAAETTV
Ga0187887_1005199613300018043PeatlandTLVAIIADHYGRHFIRVLQHPAKYWGWLLVFATLILSVILAGVMLNKRLAATTAA
Ga0187887_1024852433300018043PeatlandVAIVADHYGRHFIRVLRHPVQYWGWLLLFAAIILCVILAGILISRRFAATATA
Ga0187859_1004021513300018047PeatlandRTLRYSFIAIIADHYGRHFIRVLRHPSQYWGWLLLSAAVILGLVAAGIVINRRLVVPAGA
Ga0187784_1045380613300018062Tropical PeatlandDHYGRHFVRVLRHPAQEWEWLILFAAVIFTFTMAGIRLNRRMATA
Ga0066655_1024191113300018431Grasslands SoilTICRAARYGIIAIVADHYGRHFICALRQPGQYWGWLLLFAAVIFSLIIVGIAVNRRLAATTSA
Ga0066662_1058507913300018468Grasslands SoilICRAARYGIIAIVADHYGRHFIRALRQPSQYWGWLLLFAAVIFSLIIAGIAVNRRLPATTSA
Ga0066662_1154308213300018468Grasslands SoilRYGIIAIVADHYGRHFIRALRQPGQYWGWLLLFAAVIFSLIIVGIAVNRRLAATTSA
Ga0193726_124608723300020021SoilALALVADRYGRRFLGILRHPTQYWGWLLLFAVFTVAVIAAGILFNRRLSSVPANS
Ga0210403_1113898023300020580SoilIVADHYGRHFVRMFRHPTQYWGWLLLFTAMIFGLIAGGILINRRLATSAAGSTTIEPRATEL
Ga0210388_1108893623300021181SoilADLYGRHFIRVIRHPLQYWGWLLVFAAIVFGLIVAGILINRRIAASAG
Ga0210393_1128942423300021401SoilIAIVADLYGRHFIRVLRHPTQYWGWLLLFAVVTAGLIGGGILINRRLETAAG
Ga0210385_1103414323300021402SoilAIGIVADLYGRHFIRVISHPLQYWGWLLLFAAITLALIAGGILINRRIAAAEAG
Ga0210384_1128079423300021432SoilRYAAIGIIADLYGRHFIRVLRHPTQYWGWLLLFTAMIFGFIAGGILINRRLATASAT
Ga0208690_101129823300025434PeatlandRGARYTLIAIIADHYGRHFIRVLRHPIEYWGWLLAFAAVILILIMTGVVVNRRLAAATMA
Ga0208039_107168323300025454PeatlandTDHYGRHFIRVLRHPAQHWGWLLLFAAVIFSLIMVGVVLNRRLAATTSA
Ga0208192_108191623300025477PeatlandITDHYGRHFIRVLRHPAQHWGWLLLFAAVIFSLIMVGVVLNRRLAATTSA
Ga0208191_108212413300025496PeatlandSARYTFIAIVADHYGRHFVRVLRHPSQYWGWLLLFAAVIFSLIMAGILLNRRLTAATTA
Ga0208819_107220523300025498PeatlandDHYGRHFIRVLRHPAQHWGWLLLFAAVIFSLIMAGIVLNRRLAATTSA
Ga0209235_114360833300026296Grasslands SoilVTICRAARYGIIAIIADHYGRHFVRVLRHPSQYWGWLLLFAAVIFSLIIAGIAVNRRLPATTSA
Ga0209236_109314233300026298Grasslands SoilAARYGIIAIVADHYGRHFIRALRQPGQYWGWLLLFAAVIFSLIIAGIAVNRRLAATTSA
Ga0209802_102237213300026328SoilIAIVADHYGRHFIRALRQPSQYWGWLLLFAAVIFSLIIAGIAVNRRLVATTSA
Ga0209375_117570213300026329SoilIVADHYGRHFIRALRQPSQYWGWLLLFAAVIFSLIIAGIAVNRRLAATTSA
Ga0255351_108398713300026456SoilRYTLVALIADHYGRHIVRVLRHPVQYWGWLLLFAALILSVILVGVMLNKRLAATTAA
Ga0209157_113173013300026537SoilCRAARYGIIAIVADHYGRHFIRALRQPGQYWGWLLLFAAVIFSLIIVGIAVNRRLAATTS
Ga0209056_10008646143300026538SoilIIAVVADHYGRHFIRALRQPSQYWGWLLLFAAVIFSLIIAGIAVNRRLPATTSA
Ga0209156_1027045613300026547SoilIVADHYGRHFIRALRQPSQYWGWLLLFAAVIFSLIIAGIAVNRRLPATTSA
Ga0209161_10004694173300026548SoilIAIVADHYGRHFIRALRQPSQYWGWLLLFAAVIFSLIIAGIAVNRRLPATTSA
Ga0207777_103459013300027330Tropical Forest SoilIVADHYGRHFIRVLRHPSQYWGWFAALIVLLVVLIVAGFLVNRQLEPVAAE
Ga0209221_114553713300027609Forest SoilLIAVVADHYGRRFVRILRHPSQYWVWLLLFAAIVLTLVLAGVVLNRRFAAAASA
Ga0209517_1023772013300027854Peatlands SoilLVAIIADHYGRHFIRVLRHPIQYWGWFLLFAAVILTVILAGITVNKRLAAATTA
Ga0209167_1014232223300027867Surface SoilVAICRGARYTLIAFIADHYGRHFVRVLRHPTEYWGWLLAFAAIIAAVIMAGIVVNKRIAAAAMA
Ga0209590_1048167823300027882Vadose Zone SoilGRHFVRVLRHPSQYWGWLLLFAAVIFSLIMAGIVLNRRLSATTSA
Ga0265356_103012913300028017RhizosphereICRSVRYTFIAIVADHYGHHFVRVLRHPSQYWGWLLLFVAVIFSLIIAGILLNRRLTAANIV
Ga0209526_1051068523300028047Forest SoilCRTARYAVIAIVADHYGRHFIRMLRHPTQYWGWLLLFAAMIFGLIAGGILINKRLANSSA
Ga0255358_103687423300028069SoilRYAFIAIIADHYGRHFIRALRHPAQHWGWLLLFAAVIFSLIMAGIVLNRRLAATTSA
Ga0222749_1001400513300029636SoilARYATIAIAADLYGRHFILVLRHPTQYWGWFSLFAALIAGLIAAGILINRRLLLYRR
Ga0311359_1060904423300029914BogIIADHYGRHIVRVLRHPVQYWGWLLLFAALILSVIMAGVMLNKRLAATTAA
Ga0311359_1065015213300029914BogIIADHYGRHIVRVLRHPVQYWGWLLLFAALILSVIMAGVMLNRRLAATTAA
Ga0302141_105332713300029919BogRGARYTLVAIIADHYGRHIVRVLRHPVQYWGWLLLFAALILSVIMAGVMLNKRLAATTAA
Ga0302179_1041104333300030058PalsaIIADHYGRHFVRALRHPSQYWGWLLLAATVILSLVMAGIVLNRRLATTTSA
Ga0311353_1082471323300030399PalsaIAIVADHYGRHFVRVLRHPSQYWGWLLLFAAVIFSLIMAGILLNRRLTAANIG
Ga0311372_1211094913300030520PalsaSLYGRRFIGVLRHPTQYWGWLLLFAALTAGLIGGGILINRRLETAAG
Ga0311354_1079472613300030618PalsaTFIAIVADHYGRHFVRVLRHPSQYWGWLLLFAAVIFSLIMAGILLNRRLTAANIG
Ga0302316_1042045113300030646PalsaIAIVADHYGRHFVRVLRHPSQYWGWLLLFAAVIFSLIMAGILLNRRLTAATTA
Ga0310038_1042453113300030707Peatlands SoilISRAIRYSAIAIVADHYGRHFVRALRHPTQYWGWMLLFAALIVGLVVGGILLNRRLETAP
Ga0302325_1000489313300031234PalsaYGRHFVRVLRHPSQYWGWLLLFAAVIFSLIMAGILLNRRLTAANIG
Ga0302326_1303027323300031525PalsaRHFVRVLRHPSQYWGWLLLFAAVIFSLIMAGILLNRRLTAANIG
Ga0310686_11091715513300031708SoilGVRYCAIGLVADRYGRSVIGVLRHPTQYWGWLLLFAAIILVLVGAGILFNKRLAAAPGH
Ga0265342_1004106933300031712RhizosphereIADHYGRHFIGVLRHPVQYWGWLLAFAAVILVVIMAGILVNRRLAAESMA
Ga0307476_1069108623300031715Hardwood Forest SoilVADIYGRHFIRVLRHPSQYWGWLTLFIVLAIGLTLTGILLNRRLATATN
Ga0307477_1017880823300031753Hardwood Forest SoilVADHYGRHFIRALRHPTQFWGWWLLLAGLAFTMITAGVLLNRRLSAASAA
Ga0307473_1141439523300031820Hardwood Forest SoilARYATIAIAADLYGRHLILVLRHPTQYWGWLSLFAAMIFALIAGGILINKRLATMSAE
Ga0307478_1124638923300031823Hardwood Forest SoilRYSVIAIIADLYGRHFIRVLLHPVQYWGWFLAFAVLTIGLITGGILINRRIGAEPAG
Ga0311301_1029345113300032160Peatlands SoilDHYGRHFVRVLRHPSQYWGWLLLFAAIILTLILTGIALNRRFAAATSA
Ga0310812_1049817813300032421SoilRAARYGVVAIIADHYGRHFIRALRHPVQYWGWLLLFAAVLFSLITGGIMLNRRLAATTRA
Ga0335085_1055377623300032770SoilTLVALLADRFGRHIIRVLLHPAQYWGWFLLFAALICGVVLAGILLNKRIVNAAA
Ga0335078_1038853113300032805SoilAIVADLYGRHFIRVLRHPTQYWGWLLVFAAMVFGLTTAGILINKRLAAASAG
Ga0371488_0030350_3_1913300033983Peat SoilICRGARYTLVAIVADHYGRHFVRVLRHPTQYWGWLLLFAALILGVILAGIAINRRIAATASS
Ga0326724_0527727_1_1713300034091Peat SoilYTLVAIIADHYGRHFIRVLRHPVQYWGWLLLFAAVILSVILAGIVVNKRIAAATAA
Ga0370514_012315_23_2143300034199Untreated Peat SoilMICRSARYTSIAIVADHYGRHFVRVLRHPSQYWGWLLLFAAVIFSLIMAGILLNRRLTAATTA
Ga0370492_0440098_327_5273300034282Untreated Peat SoilTVVTICRGARYTLVAIIADHYGRHIVRVLRHPVQYWGWLLLFAALILSVIMAGVMLNRRLAATTAA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.