Metagenome / Metatranscriptome Family F058412

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F058412
Family Type	Metagenome / Metatranscriptome
Number of Sequences	135
Average Sequence Length	39 residues
Representative Sequence	MFVVSEAEAAAIRAAFDQGGELAAAVELRRLFPGITD
Number of Associated Samples	106
Number of Associated Scaffolds	135

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	26.85 %
% of genes near scaffold ends (potentially truncated)	72.59 %
% of genes from short scaffolds (< 2000 bps)	76.30 %
Associated GOLD sequencing projects	99
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.64

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (68.889 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (11.111 % of family members)
Environment Ontology (ENVO)	Unclassified (23.704 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (46.667 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 40.00% β-sheet: 0.00% Coil/Unstructured: 60.00%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.64
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.64
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 135 Family Scaffolds
PF00589	Phage_integrase	2.96
PF08837	DUF1810	1.48
PF01402	RHH_1	1.48
PF02796	HTH_7	1.48
PF00581	Rhodanese	0.74
PF00400	WD40	0.74
PF05443	ROS_MUCR	0.74
PF00118	Cpn60_TCP1	0.74
PF00135	COesterase	0.74
PF07238	PilZ	0.74
PF02586	SRAP	0.74
PF01740	STAS	0.74
PF00872	Transposase_mut	0.74
PF03992	ABM	0.74
PF04796	RepA_C	0.74
PF01135	PCMT	0.74
PF08448	PAS_4	0.74
PF00239	Resolvase	0.74
PF04352	ProQ	0.74
PF02321	OEP	0.74
PF13358	DDE_3	0.74
PF09594	GT87	0.74
PF07690	MFS_1	0.74
PF00216	Bac_DNA_binding	0.74
PF12833	HTH_18	0.74
PF07519	Tannase	0.74
PF03061	4HBT	0.74
PF07885	Ion_trans_2	0.74

COG ID	Name	Functional Category	% Frequency in 135 Family Scaffolds
COG1538	Outer membrane protein TolC	Cell wall/membrane/envelope biogenesis [M]	1.48
COG5579	Uncharacterized conserved protein, DUF1810 family	Function unknown [S]	1.48
COG0459	Chaperonin GroEL (HSP60 family)	Posttranslational modification, protein turnover, chaperones [O]	0.74
COG0776	Bacterial nucleoid DNA-binding protein IHF-alpha	Replication, recombination and repair [L]	0.74
COG1961	Site-specific DNA recombinase SpoIVCA/DNA invertase PinE	Replication, recombination and repair [L]	0.74
COG2135	ssDNA abasic site-binding protein YedK/HMCES, SRAP family	Replication, recombination and repair [L]	0.74
COG2226	Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG	Coenzyme transport and metabolism [H]	0.74
COG2272	Carboxylesterase type B	Lipid transport and metabolism [I]	0.74
COG2452	Predicted site-specific integrase-resolvase	Mobilome: prophages, transposons [X]	0.74
COG2518	Protein-L-isoaspartate O-methyltransferase	Posttranslational modification, protein turnover, chaperones [O]	0.74
COG2519	tRNA A58 N-methylase Trm61	Translation, ribosomal structure and biogenesis [J]	0.74
COG3109	sRNA-binding protein ProQ	Signal transduction mechanisms [T]	0.74
COG3328	Transposase (or an inactivated derivative)	Mobilome: prophages, transposons [X]	0.74
COG4122	tRNA 5-hydroxyU34 O-methylase TrmR/YrrM	Translation, ribosomal structure and biogenesis [J]	0.74
COG4957	Predicted transcriptional regulator	Transcription [K]	0.74

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	68.89 %
All Organisms	root	All Organisms	31.11 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	68.89 %
cellular organisms	root	All Organisms → cellular organisms	31.11 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	68.89 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	31.11 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	68.89 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	25.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	68.89 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	20.74 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.74 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.74 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	0.74 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	68.89 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	17.04 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1.48 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	0.74 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.74 %
Methylococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales	0.74 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	68.89 %
Acetobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae	10.37 %
Azospirillaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae	2.22 %
unclassified Rhodospirillales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales	1.48 %
Desulfovibrionales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfovibrionales	0.74 %
Pleomorphomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Pleomorphomonadaceae	0.74 %
Methylococcaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae	0.74 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	0.74 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.74 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	68.89 %
Azospirillum	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum	2.22 %
Roseomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas	1.48 %
Rhodospirillales bacterium 69-11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-11	1.48 %
Rhodopila	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila	1.48 %
Chthonobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Pleomorphomonadaceae → Chthonobacter	0.74 %
Desulfovibrionaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfovibrionales → Desulfovibrionaceae	0.74 %
Acidisphaera	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisphaera	0.74 %
Methylocaldum	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylocaldum	0.74 %
Paracraurococcus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Paracraurococcus	0.74 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	0.74 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.74 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	68.89 %
Azospirillum baldaniorum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum → Azospirillum baldaniorum	2.22 %
Rhodopila globiformis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila → Rhodopila globiformis	1.48 %
Roseomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas	1.48 %
Rhodospirillales bacterium 69-11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-11	1.48 %
Chthonobacter albigriseus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Pleomorphomonadaceae → Chthonobacter → Chthonobacter albigriseus	0.74 %
unclassified Acidisphaera	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisphaera → unclassified Acidisphaera	0.74 %
Paracraurococcus ruber	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Paracraurococcus → Paracraurococcus ruber	0.74 %
Solidesulfovibrio	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfovibrionales → Desulfovibrionaceae → Solidesulfovibrio	0.74 %
Methylocaldum	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylocaldum	0.74 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	0.74 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.74 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	68.89 %
Azospirillum baldaniorum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum → Azospirillum baldaniorum	2.22 %
Rhodopila globiformis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila → Rhodopila globiformis	1.48 %
Roseomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas	1.48 %
Rhodospirillales bacterium 69-11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-11	1.48 %
Acidisphaera sp. S103	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisphaera → unclassified Acidisphaera → Acidisphaera sp. S103	0.74 %
Solidesulfovibrio magneticus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfovibrionales → Desulfovibrionaceae → Solidesulfovibrio → Solidesulfovibrio magneticus	0.74 %
Chthonobacter albigriseus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Pleomorphomonadaceae → Chthonobacter → Chthonobacter albigriseus	0.74 %
Paracraurococcus ruber	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Paracraurococcus → Paracraurococcus ruber	0.74 %
Methylocaldum	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylocaldum	0.74 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	0.74 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.74 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	68.89 %
Azospirillum baldaniorum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum → Azospirillum baldaniorum	2.22 %
Rhodopila globiformis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila → Rhodopila globiformis	1.48 %
Roseomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas	1.48 %
Rhodospirillales bacterium 69-11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-11	1.48 %
Solidesulfovibrio magneticus RS-1	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfovibrionales → Desulfovibrionaceae → Solidesulfovibrio → Solidesulfovibrio magneticus → Solidesulfovibrio magneticus RS-1	0.74 %
Acidisphaera sp. S103	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisphaera → unclassified Acidisphaera → Acidisphaera sp. S103	0.74 %
Chthonobacter albigriseus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Pleomorphomonadaceae → Chthonobacter → Chthonobacter albigriseus	0.74 %
Paracraurococcus ruber	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Paracraurococcus → Paracraurococcus ruber	0.74 %
Methylocaldum	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylocaldum	0.74 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	0.74 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.74 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2170459006\|GBPF9FW01A2HX4	Not Available	502	Open in IMG/M
2170459012\|GOYVCMS01A7N5P	Not Available	506	Open in IMG/M
2170459023\|GZGNO2B02GZMWJ	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Paracraurococcus → Paracraurococcus ruber	507	Open in IMG/M
3300002568\|C688J35102_120661035	Not Available	1311	Open in IMG/M
3300004479\|Ga0062595_101857702	Not Available	575	Open in IMG/M
3300005434\|Ga0070709_11808563	Not Available	500	Open in IMG/M
3300005435\|Ga0070714_102483732	Not Available	503	Open in IMG/M
3300005459\|Ga0068867_101125467	Not Available	718	Open in IMG/M
3300005535\|Ga0070684_100190118	Not Available	1868	Open in IMG/M
3300005563\|Ga0068855_101184365	Not Available	795	Open in IMG/M
3300005563\|Ga0068855_102395103	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	527	Open in IMG/M
3300005842\|Ga0068858_100197452	Not Available	1902	Open in IMG/M
3300006028\|Ga0070717_11309401	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	659	Open in IMG/M
3300006050\|Ga0075028_100983585	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum → Azospirillum baldaniorum	524	Open in IMG/M
3300006172\|Ga0075018_10730116	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum → Azospirillum baldaniorum	538	Open in IMG/M
3300006174\|Ga0075014_100592409	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum → Azospirillum baldaniorum	633	Open in IMG/M
3300006175\|Ga0070712_101629373	Not Available	565	Open in IMG/M
3300006237\|Ga0097621_101375402	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	668	Open in IMG/M
3300006237\|Ga0097621_102206885	Not Available	527	Open in IMG/M
3300006358\|Ga0068871_101122114	Not Available	736	Open in IMG/M
3300006755\|Ga0079222_12677552	Not Available	502	Open in IMG/M
3300009094\|Ga0111539_13506689	Not Available	503	Open in IMG/M
3300009098\|Ga0105245_10282499	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-11	1623	Open in IMG/M
3300009101\|Ga0105247_11620533	Not Available	532	Open in IMG/M
3300009176\|Ga0105242_10197411	All Organisms → cellular organisms → Bacteria → Proteobacteria	1785	Open in IMG/M
3300009176\|Ga0105242_11662424	Not Available	674	Open in IMG/M
3300009500\|Ga0116229_10861371	Not Available	733	Open in IMG/M
3300009787\|Ga0116226_11712037	Not Available	577	Open in IMG/M
3300010043\|Ga0126380_11515472	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila → Rhodopila globiformis	594	Open in IMG/M
3300010341\|Ga0074045_10059878	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2722	Open in IMG/M
3300010375\|Ga0105239_12336344	Not Available	622	Open in IMG/M
3300010376\|Ga0126381_100458155	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila → Rhodopila globiformis	1790	Open in IMG/M
3300010400\|Ga0134122_12023958	Not Available	615	Open in IMG/M
3300012212\|Ga0150985_106308744	All Organisms → cellular organisms → Bacteria	536	Open in IMG/M
3300012212\|Ga0150985_120175226	Not Available	500	Open in IMG/M
3300012212\|Ga0150985_122077928	Not Available	582	Open in IMG/M
3300012469\|Ga0150984_103501668	Not Available	1508	Open in IMG/M
3300012469\|Ga0150984_111292111	All Organisms → cellular organisms → Bacteria	576	Open in IMG/M
3300012469\|Ga0150984_112937252	Not Available	647	Open in IMG/M
3300012892\|Ga0157294_10145865	Not Available	653	Open in IMG/M
3300012955\|Ga0164298_11064851	Not Available	603	Open in IMG/M
3300012955\|Ga0164298_11498199	Not Available	526	Open in IMG/M
3300012960\|Ga0164301_11075911	Not Available	638	Open in IMG/M
3300012971\|Ga0126369_12678458	Not Available	583	Open in IMG/M
3300012986\|Ga0164304_11233936	Not Available	605	Open in IMG/M
3300013307\|Ga0157372_11264277	Not Available	852	Open in IMG/M
3300014325\|Ga0163163_11567759	Not Available	720	Open in IMG/M
3300014488\|Ga0182001_10209322	Not Available	720	Open in IMG/M
3300014493\|Ga0182016_10690211	All Organisms → cellular organisms → Bacteria	574	Open in IMG/M
3300014497\|Ga0182008_10206795	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylocaldum	1000	Open in IMG/M
3300014497\|Ga0182008_10567143	Not Available	633	Open in IMG/M
3300015265\|Ga0182005_1254302	Not Available	544	Open in IMG/M
3300016319\|Ga0182033_11966348	Not Available	532	Open in IMG/M
3300016387\|Ga0182040_11610541	Not Available	553	Open in IMG/M
3300018432\|Ga0190275_10535623	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae	1210	Open in IMG/M
3300018432\|Ga0190275_11614716	All Organisms → cellular organisms → Bacteria → Proteobacteria	726	Open in IMG/M
3300020581\|Ga0210399_10940616	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae	699	Open in IMG/M
3300020582\|Ga0210395_10665656	Not Available	780	Open in IMG/M
3300021171\|Ga0210405_10075292	Not Available	2660	Open in IMG/M
3300021171\|Ga0210405_10878249	Not Available	683	Open in IMG/M
3300021171\|Ga0210405_11382197	Not Available	514	Open in IMG/M
3300021181\|Ga0210388_10456442	Not Available	1123	Open in IMG/M
3300021377\|Ga0213874_10420218	Not Available	523	Open in IMG/M
3300021475\|Ga0210392_11223220	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	562	Open in IMG/M
3300021478\|Ga0210402_10570561	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae	1050	Open in IMG/M
3300024179\|Ga0247695_1062104	Not Available	552	Open in IMG/M
3300025878\|Ga0209584_10143762	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas	896	Open in IMG/M
3300025906\|Ga0207699_10294816	All Organisms → cellular organisms → Bacteria	1131	Open in IMG/M
3300025915\|Ga0207693_10035067	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae	3957	Open in IMG/M
3300025916\|Ga0207663_10062273	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae	2371	Open in IMG/M
3300025925\|Ga0207650_11029268	Not Available	701	Open in IMG/M
3300025925\|Ga0207650_11370561	Not Available	602	Open in IMG/M
3300025928\|Ga0207700_10945507	Not Available	771	Open in IMG/M
3300025928\|Ga0207700_11306198	Not Available	646	Open in IMG/M
3300025929\|Ga0207664_10659584	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisphaera → unclassified Acidisphaera → Acidisphaera sp. S103	940	Open in IMG/M
3300025939\|Ga0207665_10372908	Not Available	1081	Open in IMG/M
3300025949\|Ga0207667_12114029	Not Available	521	Open in IMG/M
3300026095\|Ga0207676_11997591	Not Available	579	Open in IMG/M
3300026118\|Ga0207675_102502587	Not Available	527	Open in IMG/M
3300026121\|Ga0207683_12150390	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Pleomorphomonadaceae → Chthonobacter → Chthonobacter albigriseus	506	Open in IMG/M
3300027895\|Ga0209624_10704007	Not Available	666	Open in IMG/M
3300027905\|Ga0209415_10932602	Not Available	586	Open in IMG/M
3300027908\|Ga0209006_10696103	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium 69-11	832	Open in IMG/M
3300028379\|Ga0268266_12275645	Not Available	513	Open in IMG/M
3300028565\|Ga0302145_10241310	Not Available	601	Open in IMG/M
3300028773\|Ga0302234_10489322	Not Available	526	Open in IMG/M
3300029907\|Ga0311329_10577649	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae	749	Open in IMG/M
3300029915\|Ga0311358_11132546	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae	526	Open in IMG/M
3300030503\|Ga0311370_10211668	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	2596	Open in IMG/M
3300031058\|Ga0308189_10493886	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas	526	Open in IMG/M
3300031231\|Ga0170824_120002352	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	850	Open in IMG/M
3300031231\|Ga0170824_121650594	All Organisms → cellular organisms → Bacteria → Proteobacteria	678	Open in IMG/M
3300031470\|Ga0272432_1153652	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae	1001	Open in IMG/M
3300031890\|Ga0306925_12163201	All Organisms → cellular organisms → Bacteria	519	Open in IMG/M
3300031946\|Ga0310910_10766707	Not Available	761	Open in IMG/M
3300031954\|Ga0306926_12611092	All Organisms → cellular organisms → Bacteria	551	Open in IMG/M
3300032008\|Ga0318562_10390927	Not Available	809	Open in IMG/M
3300032009\|Ga0318563_10351046	All Organisms → cellular organisms → Bacteria → Proteobacteria	798	Open in IMG/M
3300032013\|Ga0310906_10366395	Not Available	942	Open in IMG/M
3300032074\|Ga0308173_12024476	Not Available	543	Open in IMG/M
3300032205\|Ga0307472_101791592	Not Available	609	Open in IMG/M
3300032261\|Ga0306920_103982764	All Organisms → cellular organisms → Bacteria	537	Open in IMG/M
3300032783\|Ga0335079_12387276	Not Available	500	Open in IMG/M
3300032898\|Ga0335072_10434693	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	1391	Open in IMG/M
3300034127\|Ga0370489_0265770	Not Available	516	Open in IMG/M
3300034358\|Ga0370485_0078809	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	913	Open in IMG/M
3300034358\|Ga0370485_0212619	Not Available	611	Open in IMG/M
3300034358\|Ga0370485_0251234	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfovibrionales → Desulfovibrionaceae → Solidesulfovibrio → Solidesulfovibrio magneticus → Solidesulfovibrio magneticus RS-1	569	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	65.19%
Host-Associated	Host-Associated	34.81%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	61.48%
Plants	Host-Associated → Plants	34.81%
Aquatic	Environmental → Aquatic	3.70%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	56.30%
Rhizosphere	Host-Associated → Plants → Rhizosphere	17.78%
Rhizoplane	Host-Associated → Plants → Rhizoplane	11.11%
Peat	Environmental → Terrestrial → Peat	4.44%
Roots	Host-Associated → Plants → Roots	3.70%
Peat Moss	Host-Associated → Plants → Peat Moss	2.22%
Sediment	Environmental → Aquatic → Sediment	2.96%
Freshwater	Environmental → Aquatic → Freshwater	0.74%
Rock-Dwelling (Endoliths)	Environmental → Terrestrial → Rock-Dwelling (Endoliths)	0.74%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	36.30%
Loam	Environmental → Terrestrial → Soil → Loam	14.07%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	11.85%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	8.15%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	5.93%
Soil	Host-Associated → Plants → Rhizosphere → Soil	5.93%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	4.44%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	2.22%
Unclassified	Host-Associated → Plants → Peat Moss → Unclassified	2.22%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	2.96%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	2.96%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	0.74%
Unclassified	Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified	0.74%
Soil	Host-Associated → Plants → Rhizoplane → Soil	0.74%
Unclassified	Host-Associated → Plants → Roots → Unclassified	0.74%

Habitat	Taxonomy	Distribution
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	17.78%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	13.33%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	11.85%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	11.85%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	8.15%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	5.93%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	5.19%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	4.44%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	2.22%
Unclassified	Host-Associated → Plants → Peat Moss → Unclassified → Unclassified	2.22%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	2.96%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	2.96%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	1.48%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	1.48%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	1.48%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	1.48%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	0.74%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	0.74%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	0.74%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.74%
Unclassified	Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified	0.74%
Unclassified	Host-Associated → Plants → Rhizoplane → Soil → Unclassified	0.74%
Unclassified	Host-Associated → Plants → Roots → Unclassified → Unclassified	0.74%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	11.11%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	8.89%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	7.41%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	4.44%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	4.44%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil	2.22%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	2.22%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	2.22%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	2.22%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	2.22%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	2.22%
Host-Associated	Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated	2.22%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	2.96%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	2.96%
Untreated Peat Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil	2.96%
Bog	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog	2.96%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	2.96%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	2.96%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	2.96%
Grass Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil	1.48%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	1.48%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	1.48%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	1.48%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	1.48%
Palsa	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa	1.48%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	1.48%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	1.48%
Bog Forest Soil	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil	0.74%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.74%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.74%
Grass Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil	0.74%
Peatlands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil	0.74%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.74%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.74%
Arctic Peat Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil	0.74%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.74%
Bog Forest Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil	0.74%
Bog	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog	0.74%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.74%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	0.74%
Rock	Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock	0.74%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	0.74%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere	0.74%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.74%
Plant Roots	Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots	0.74%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.74%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.74%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.74%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2170459006	Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 0-10cm	Environmental	Open in IMG/M
2170459012	Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO1O1 lysis Rhizosphere grass	Environmental	Open in IMG/M
2170459023	Grass soil microbial communities from Rothamsted Park, UK - FA3 (control condition)	Environmental	Open in IMG/M
3300002568	Grasslands soil microbial communities from Hopland, California, USA - 2	Environmental	Open in IMG/M
3300004152	Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3	Environmental	Open in IMG/M
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental	Open in IMG/M
3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Environmental	Open in IMG/M
3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Environmental	Open in IMG/M
3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Host-Associated	Open in IMG/M
3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Environmental	Open in IMG/M
3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Host-Associated	Open in IMG/M
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated	Open in IMG/M
3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Host-Associated	Open in IMG/M
3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Environmental	Open in IMG/M
3300006050	Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014	Environmental	Open in IMG/M
3300006086	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013	Environmental	Open in IMG/M
3300006172	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014	Environmental	Open in IMG/M
3300006174	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014	Environmental	Open in IMG/M
3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Environmental	Open in IMG/M
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated	Open in IMG/M
3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Host-Associated	Open in IMG/M
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Host-Associated	Open in IMG/M
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated	Open in IMG/M
3300009500	Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG	Host-Associated	Open in IMG/M
3300009787	Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fa - Sphagnum fallax MG	Host-Associated	Open in IMG/M
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental	Open in IMG/M
3300010341	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2	Environmental	Open in IMG/M
3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Host-Associated	Open in IMG/M
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated	Open in IMG/M
3300012892	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1	Environmental	Open in IMG/M
3300012955	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG	Environmental	Open in IMG/M
3300012960	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300012986	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG	Environmental	Open in IMG/M
3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Host-Associated	Open in IMG/M
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300014488	Bulk soil microbial communities from Mexico - San Felipe (SF) metaG	Environmental	Open in IMG/M
3300014493	Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG	Environmental	Open in IMG/M
3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Host-Associated	Open in IMG/M
3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Host-Associated	Open in IMG/M
3300016319	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H	Environmental	Open in IMG/M
3300016387	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176	Environmental	Open in IMG/M
3300018432	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T	Environmental	Open in IMG/M
3300018920	Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS	Environmental	Open in IMG/M
3300020581	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M	Environmental	Open in IMG/M
3300020582	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O	Environmental	Open in IMG/M
3300021171	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M	Environmental	Open in IMG/M
3300021181	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O	Environmental	Open in IMG/M
3300021377	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7	Host-Associated	Open in IMG/M
3300021403	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O	Environmental	Open in IMG/M
3300021404	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O	Environmental	Open in IMG/M
3300021475	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O	Environmental	Open in IMG/M
3300021478	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M	Environmental	Open in IMG/M
3300024179	Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK36	Environmental	Open in IMG/M
3300025878	Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes)	Environmental	Open in IMG/M
3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)	Environmental	Open in IMG/M
3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)	Environmental	Open in IMG/M
3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300027895	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)	Environmental	Open in IMG/M
3300027905	Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)	Environmental	Open in IMG/M
3300027908	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)	Environmental	Open in IMG/M
3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300028565	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_3	Environmental	Open in IMG/M
3300028773	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2	Environmental	Open in IMG/M
3300029907	I_Bog_N1 coassembly	Environmental	Open in IMG/M
3300029913	III_Bog_N3 coassembly	Environmental	Open in IMG/M
3300029915	III_Bog_E1 coassembly	Environmental	Open in IMG/M
3300030503	III_Palsa_E3 coassembly	Environmental	Open in IMG/M
3300031058	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031231	Coassembly Site 11 (all samples) - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031470	Rock endolithic microbial communities from Victoria Land, Antarctica - University Valley nord	Environmental	Open in IMG/M
3300031544	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26	Environmental	Open in IMG/M
3300031890	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)	Environmental	Open in IMG/M
3300031946	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172	Environmental	Open in IMG/M
3300031954	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)	Environmental	Open in IMG/M
3300032008	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18	Environmental	Open in IMG/M
3300032009	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19	Environmental	Open in IMG/M
3300032013	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3	Environmental	Open in IMG/M
3300032074	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1	Environmental	Open in IMG/M
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental	Open in IMG/M
3300032261	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)	Environmental	Open in IMG/M
3300032783	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3	Environmental	Open in IMG/M
3300032898	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1	Environmental	Open in IMG/M
3300034127	Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_16	Environmental	Open in IMG/M
3300034358	Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_01D_16	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
L01_06100050	2170459006	Grass Soil	MFTITEADAAAIRAAFDRGGELSAAIELRRLFPGVTAWQRQR
N56_05821240	2170459012	Grass Soil	MFVVTEADAAAIRAAFERRGEFAAAVELRRLFPGVDGHRA
FA3_01779480	2170459023	Grass Soil	MFVVSEAEAAAIRAAFDRGGELSAAVELRRLFPLITDM
C688J35102_1206610352	3300002568	Soil	MFVLTEAQAATIRATYKQRGELSAVVELRRLFPGVDNIALRLRR*
Ga0062386_1007046642	3300004152	Bog Forest Soil	MFVVTEADAAAIRAVYEQRGEFSAAVELRRRFPGVTNRSARNRREPTCPA*
Ga0062595_1018577021	3300004479	Soil	MFCVSEAQAAMIRTTFEQRGELSAVVELRRLFPGVGNVALAR
Ga0070709_108553042	3300005434	Corn, Switchgrass And Miscanthus Rhizosphere	MFVISEAEARSIRATLQQRGEFSAAVELRQLFPGIDNGQARLCVRTIAGW
Ga0070709_118085631	3300005434	Corn, Switchgrass And Miscanthus Rhizosphere	MFCVSEAQAAIIRTAFEQHGELSAVVELRRLFPGVGNVAWAREC
Ga0070714_1024837322	3300005435	Agricultural Soil	MFVVSEAEAAAIRAVFDQRGELSAAVELRRLFPGITDMAE
Ga0068867_1011254671	3300005459	Miscanthus Rhizosphere	MFTVSEAEASAIRAVYEQRGELSAAVELRRRFPGIFSTAQARE
Ga0070684_1001901181	3300005535	Corn Rhizosphere	MLSSMFSVSEEEAAAIRAVFQQDGEMSAAVELRRHFPGIT
Ga0068855_1011843651	3300005563	Corn Rhizosphere	MFAVTEAQAAVIRTAYEQRGEFSAAVELRRLFPGIDNAQAR
Ga0068855_1023951033	3300005563	Corn Rhizosphere	MFCVSEAQAAVIRTAFEQRGELSAVVELRRLFPGVGNVA
Ga0068858_1001974521	3300005842	Switchgrass Rhizosphere	MLSSMFTVSEVEAAAIRAAYEQRGELSAAVELRRRFPGIF
Ga0081455_108556862	3300005937	Tabebuia Heterophylla Rhizosphere	MFVITEADAAAIRAAFNRGGEFSAAVELRRRFPGITDNVHARE
Ga0070717_104439881	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	MFVSTDARATTIRNAYKQRGEFSAAVRQLFPRIDNAQARLCVRT
Ga0070717_113094011	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	MTILPGMFCVTETEAAAIRAAYEQGGELSAAVELRRLF
Ga0075028_1009835851	3300006050	Watersheds	MFVVTEAEATAIRAAFDRGGELSAAVELRRLFPGITDNVQ
Ga0075019_107365732	3300006086	Watersheds	MFVVTEADAAAIRAVYQQRGEFSAAVELRRRFPGI
Ga0075018_107301161	3300006172	Watersheds	MFVVSEAEATAIRTAFDHGGEFAAAVELRRLFPGVA
Ga0075014_1005924091	3300006174	Watersheds	MFVVTEAEAAAIRAAFDRGGEFLAGVELRRLFPGVTDN
Ga0070712_1016293733	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	MFCVSEAQAAVIRTAFEQRGELSAVVELRRLFPGLG
Ga0097621_1013754021	3300006237	Miscanthus Rhizosphere	MFSVSEAEAAAIRAAYEQRGELSAAVELRRRSPGI
Ga0097621_1022068851	3300006237	Miscanthus Rhizosphere	FVVSEVEAAAIRAAFDQGGEFSAAIELRRLFPGIGDIERHCAG*
Ga0068871_1011221142	3300006358	Miscanthus Rhizosphere	MLLAMFVVSEADAAAIRTAFEQRGELSAAVELRRR
Ga0079222_126775521	3300006755	Agricultural Soil	MFCVSKAQAAIIRTAFEQRGELSAVVELRRLFPGV
Ga0075425_1019412831	3300006854	Populus Rhizosphere	MTIFPGMFCVSETEAAAIRTAYEQDGELSAAIELRQLFRDITDNAKA
Ga0111539_135066891	3300009094	Populus Rhizosphere	MFAITEAEAAGIRVAFEQRGELSAVVELRRLFPGVTDN
Ga0105245_102824992	3300009098	Miscanthus Rhizosphere	MFEVEAIEIRAAFDSGGKFSAAVELRGLFPAVTDNAQAR*
Ga0105245_124371212	3300009098	Miscanthus Rhizosphere	MFVVTDADAAAIRTAFDQGGEFSAAVELRQRFPGIPD
Ga0105247_116205331	3300009101	Switchgrass Rhizosphere	MFVVSEEQAAAIRAIFHQRGEFSAAVELRRLFDH*
Ga0105242_101974111	3300009176	Miscanthus Rhizosphere	MFCVSEAQAAVIRTAFEQRGELSAVVELRRLFPGL
Ga0105242_116624241	3300009176	Miscanthus Rhizosphere	MFVVTEDEAAAIRAVFEQHGEFAAAVELRRLFPGVTDND
Ga0105242_126303671	3300009176	Miscanthus Rhizosphere	MFMVSKAEAAAIRRAYEEDGEFAAAIELRRYFPGIADNANAR
Ga0116229_108613711	3300009500	Host-Associated	MFAVDETEATAIRTAYEQHGELSAGIEVRRLFPGITDGLKA
Ga0116226_105447161	3300009787	Host-Associated	MFSVSEEDAAAIRAAFHQAGELSAAAELRRRFPGFTDNTQAREW
Ga0116226_117120371	3300009787	Host-Associated	MFAVSEAEAAAIRTLFEHEGEFAAAMELRRIFPLITDNGK
Ga0126380_115154721	3300010043	Tropical Forest Soil	MFVISEAEADVIRATFEQRGEFAAAVEVRRLFPAITDTARAR
Ga0074045_100598781	3300010341	Bog Forest Soil	MFTVNDEDAAAIRAAFERGGEFAAAVELRRRFPLIED
Ga0105239_123363442	3300010375	Corn Rhizosphere	MFAITEAEAAAIRAAFEQTGELSAVVELRRLFPGIT
Ga0126381_1004581551	3300010376	Tropical Forest Soil	MLFGMFSVSDTEAAAIRAAYERGGELAAAVELRRYFR
Ga0126381_1039513211	3300010376	Tropical Forest Soil	MFVVTEADAAIRARYEQHGEPSAAVELRRRFPGITD
Ga0134122_120239581	3300010400	Terrestrial Soil	MFSITEAEATAIRAVFDQSGELSAVVELRRLFPGVT
Ga0150985_1063087441	3300012212	Avena Fatua Rhizosphere	MEAAAIRAAFDRGGEFSAAIELPRLFPGLADNDQARE
Ga0150985_1201752262	3300012212	Avena Fatua Rhizosphere	MFVLSEAQAAMIRAPYKQCGELSAVVELRRLFPGVDNIALRLRR*
Ga0150985_1220779282	3300012212	Avena Fatua Rhizosphere	MFVVTEAEAAAIRAAFDRGGELSAAVELRRLFPAVTDTT*
Ga0150984_1035016683	3300012469	Avena Fatua Rhizosphere	MFCVSETEAAAIRTAYEQDGELSAAIELRRLFPGIT
Ga0150984_1096868411	3300012469	Avena Fatua Rhizosphere	MFMVSEAEAAAIRRAYEENGEFAAAIELRRYFPGIQDNVNARL
Ga0150984_1112921112	3300012469	Avena Fatua Rhizosphere	MFMVNEADAAAIREALEKGGELSAAVELRRRFPGITDNAKVQ
Ga0150984_1129372521	3300012469	Avena Fatua Rhizosphere	MFVVTEAQAAMIRATYEQRGEFSAAVELRRLFPGIADNAQAR*
Ga0157294_101458651	3300012892	Soil	MFAITEAEAAAIRAAFEQNGELSAVVELRRLFPGVTDNVQ
Ga0164298_110648511	3300012955	Soil	MFVVTEAATIRAVFERHGEFAATLELRRLFPGVADNA*
Ga0164298_114981991	3300012955	Soil	MLLAMFVVTEADAAAIRAAFEQRGELSAAVELTMPRQGS
Ga0164301_110759113	3300012960	Soil	MLVVTEAEAAAIRAAFEQRGELSAAVELRRLFPGVT
Ga0126369_126784581	3300012971	Tropical Forest Soil	MFAVTEAEAAAIRAAFDQGGEFAAAVELRRLFPGV
Ga0164304_112339361	3300012986	Soil	MFSVSEAEAAAIRAAYEQRGELSAAVELRRRFPGI
Ga0157372_112642771	3300013307	Corn Rhizosphere	MFTVSEEEAADIRAVYEQRGELSAAVELRCRFPGIFS
Ga0157375_126539221	3300013308	Miscanthus Rhizosphere	MFMVSKAEAAAIRRAYEENGEFAAAIELRKHFPGIADNANA
Ga0163163_115677591	3300014325	Switchgrass Rhizosphere	MIASTEAEAAAIRAVFERRGEFAAAIELRRLFPSITDNGQA*
Ga0182001_102093222	3300014488	Soil	MTIIPTMFVVTETEAAAIRAAYEQGGEFSAAVELRRLFPGPTWTPKFT
Ga0182016_106902111	3300014493	Bog	MFVVSETEAARHLLPPSCDQGGELSAAVELRRLFPGITDTAQ
Ga0182008_102067951	3300014497	Rhizosphere	MTICPGMFCVTETEAAAIRAAYEQGGELSAAIELR
Ga0182008_105671431	3300014497	Rhizosphere	VFVLTEAQAAEIRTAYEQHGEFSAVVELRRLFPGLGDIAWARECVR
Ga0182005_12543023	3300015265	Rhizosphere	MTIFPGMFCVSESEAAAIRAAYEQGDELSAAVELRRLFPGITDN
Ga0182033_119663482	3300016319	Soil	MFSVTEAEAAAIRTAFEQGGEFAAAVELRRLFPGITD
Ga0182040_116105412	3300016387	Soil	MFTVTEAEAAAIRTAFEQGGELSAALELRRLFPGVT
Ga0190275_105356232	3300018432	Soil	MFLVNEETITAIRTAYAEGGELAAAVELRRLFPGI
Ga0190275_116147162	3300018432	Soil	MFLINEPIINAIRAAYAQGGELAAVVELRRLFPGITPAEAP
Ga0190273_107900142	3300018920	Soil	MFMVNEAEAAAIRRAYEEDGEFAAIELRRHFPGIQDHANARLCA
Ga0190273_119943691	3300018920	Soil	MFMVNEAEAAAIRLAYEEDREFAAAIELRRHFPGI
Ga0210399_109406161	3300020581	Soil	MFVVSEAEATAIRTAFDQGGEFAAAVELRRLFPGVADN
Ga0210395_106656563	3300020582	Soil	MLGAMFAVSEQDAAAIRAAFEQGGEFADAVELRRLF
Ga0210405_100752921	3300021171	Soil	MFVVTEVDAAAIRAAFERGGELSAAVELRRLFPGV
Ga0210405_108782492	3300021171	Soil	MFSVTEADAAVIRAAFERGGELSAAVELRRLFPGIADNAV
Ga0210405_113821971	3300021171	Soil	MRQRADDPAMFMVSEADAAAIRAAFEQGGELSASVELRRLFPGLA
Ga0210388_104564422	3300021181	Soil	MFVVTEAEAVAIRAVFQQFGEFAAAVELRRRFPGI
Ga0213874_104202182	3300021377	Plant Roots	VTIFPGMFCVSETEAAAIRTAYEQGGELSAAVELRRLFP
Ga0210397_103617011	3300021403	Soil	MFVVTEADAAAIRAVYEQQGEFAAADELRRLFPGGTDNAQA
Ga0210389_105331311	3300021404	Soil	MSVVTEADAAAIGAVYQQQGEFAAAIELRQRFSGITDNAQ
Ga0210392_112232201	3300021475	Soil	MFVVTEAEAAAIRTAFEQSGELAAAVELRRLFPLI
Ga0210402_105705613	3300021478	Soil	MFVVSEAEAAAIRSAFDRGGELSAAVELRRLFPGITDTAQAR
Ga0247695_10621041	3300024179	Soil	MFVVTEADAAAIRAVYEQRGEFAAAIELRRLFPGIT
Ga0209584_101437622	3300025878	Arctic Peat Soil	MFVVFETDAAAIRAAFDQGGELSAAVELRRLFPGVTD
Ga0207699_102948161	3300025906	Corn, Switchgrass And Miscanthus Rhizosphere	MFCVSEAQAAVIRTAFEQRGELSAVAELRRLFPGVAM
Ga0207693_100350675	3300025915	Corn, Switchgrass And Miscanthus Rhizosphere	MFVVTEADAAAIRAAFDQGGEFSAAVELRQRFPGIP
Ga0207663_100622731	3300025916	Corn, Switchgrass And Miscanthus Rhizosphere	MFVVTEAEAAAIRAAFEQRGELSAAVELRRLFPAV
Ga0207694_100356791	3300025924	Corn Rhizosphere	MFVVTDADAAAIRTAFDQGGEFSAAVELRQRFPGIPDNARAREFA
Ga0207650_110292681	3300025925	Switchgrass Rhizosphere	MLSSMFSVSEEEAAAIRAVYEQRGELSAAVELRRRFP
Ga0207650_113705612	3300025925	Switchgrass Rhizosphere	MFTVSEEEAADIRAVYEQRGELSAAVELRCRFPGIFSAA
Ga0207700_107673372	3300025928	Corn, Switchgrass And Miscanthus Rhizosphere	MFVVTEAQAAMIRATYEQRGEFSAAVELRQLFPGIMDNAQARLCVRTI
Ga0207700_109455071	3300025928	Corn, Switchgrass And Miscanthus Rhizosphere	MFCVSEAQAAVIRTAFEQQGELSAVVELRRLFPGVDNIAL
Ga0207700_113061982	3300025928	Corn, Switchgrass And Miscanthus Rhizosphere	MFAVTAAQAAIIRAAYEQRGEFSAAVELRQLFPGIVDNA
Ga0207664_106595842	3300025929	Agricultural Soil	MFVVTEAQAAMIRATYEQRGEFSAAVELRQLFPGITNNA
Ga0207664_106812212	3300025929	Agricultural Soil	MFVVTDADAAAIRTAFDQGGEFSAAVELRQRFPGIPDNAQARE
Ga0207686_117967781	3300025934	Miscanthus Rhizosphere	MFVVTDADAAAIRTAFDQGGEFSAAVELRQRFPGIPDNAQ
Ga0207704_107657552	3300025938	Miscanthus Rhizosphere	MFVVTEAQAAAIRAAYEQRGEFSAAVELRQLFPGIDNVRAREC
Ga0207704_119807053	3300025938	Miscanthus Rhizosphere	MFVVTDADAAAIRTAFDQGGEFSAAAELRQRFPGIP
Ga0207665_103729083	3300025939	Corn, Switchgrass And Miscanthus Rhizosphere	MFVVTEVDAAAIRAAFDRGGELSAAVELRRLFPSITST
Ga0207667_121140293	3300025949	Corn Rhizosphere	MFCVSEAQAAVIRTAFEQRGELSAVVELRRLFPGV
Ga0207658_111815381	3300025986	Switchgrass Rhizosphere	MFVVTDADAAAIRTAFDQGGEFSAAVELRQRFPGIPDNAR
Ga0207702_115862652	3300026078	Corn Rhizosphere	MFLVTEAQAAVIRTAYEQRGEFSAAVELRQLFPGIDNAQAREC
Ga0207676_119975911	3300026095	Switchgrass Rhizosphere	MPHALAVFVLTKAQAATIRATYEQRGEFSAAVELRQLFPGIVDNAQ
Ga0207675_1025025872	3300026118	Switchgrass Rhizosphere	MFCVSEAQAAVIRTAFEQRGELSAVVELRRLFPGVGNVAWARE
Ga0207683_121503902	3300026121	Miscanthus Rhizosphere	MFSVSEEEAAAIRAVFEQRGELSAAVELRRCFPGIVDNV
Ga0209624_107040072	3300027895	Forest Soil	MFVVSEAEAAAIRAAFDQGGELAAAVELRRLFPGITD
Ga0209415_109326021	3300027905	Peatlands Soil	MLSCMFVVTDAEAAAIRAAFDQGGEFAAAVELRRLFPGITDLPP
Ga0209006_106961032	3300027908	Forest Soil	MVVVSEVEAEAIRTDFDREGELSAAVELRRLFPLITNMA
Ga0268266_122756451	3300028379	Switchgrass Rhizosphere	MFSVSEEEAAAIRAVFEQRGELSAAVELRRCFPGIVDNVQ
Ga0302145_102413101	3300028565	Bog	MFCVSEADAAAIRVAFEQGGELSAAVELRRLFPGLA
Ga0302234_104893221	3300028773	Palsa	MFVVSDAQADMIRTAFDQGGEFTAAVELRRLFPGVRDNDQARAF
Ga0311329_105776491	3300029907	Bog	LSEADAAAIRDAFEHGGELAAAVELRRLFPGLANNENTRLCA
Ga0311362_110251841	3300029913	Bog	MFAIDEATADAIRAIYVQEGELSAAVELRRRFPLITD
Ga0311358_111325461	3300029915	Bog	MFAVSEADAAAIRDAFEHGGELAAAVELRRLFPGLAN
Ga0311370_102116681	3300030503	Palsa	MFIVHEAEAAAIRTILENKGELSAAIEVRRLFPGITD
Ga0308189_104938862	3300031058	Soil	MVDEATITAIREAFAEGGEFAAAVELRRRFPGIVDNAEA
Ga0170824_1200023522	3300031231	Forest Soil	MFVVTDAEAAAIRAVFEQRGEFAAAVELRRRFPGITD
Ga0170824_1216505941	3300031231	Forest Soil	MFVVTEADATAIRAAFDRGGELSAAIELRRLFPGVTDMA
Ga0272432_11536521	3300031470	Rock	VFCVSESEAELIRTAFDQGGELSAAVELRRLFPGITD
Ga0318534_107743531	3300031544	Soil	MFVITEAQAAAIRIVYEQRGEFSAAVEVRQLFRGIDNAQARLCVRTIAGW
Ga0306925_119151861	3300031890	Soil	MMFVVTEAQAAMIRATYEQRGEFSAAVELRCLFPGIADIAQARLCVRTIAS
Ga0306925_121632011	3300031890	Soil	MFVVSEAEAAAIRAIFHRQGEFAAAVELRRLFPGRYGR
Ga0310910_107667073	3300031946	Soil	MFVVSEAEAAAIRAVYEQRGESAAAVELRRRFPGIADDAQ
Ga0306926_126110921	3300031954	Soil	MMFVVTEAQAAMIRATYEQRGEFSAAVELRCLFPGIADI
Ga0318562_103909273	3300032008	Soil	MFVVSEAEAAAIRGVFHQQGEFAAAMELRRLFPGIPDAYRRESAHG
Ga0318563_103510462	3300032009	Soil	MFVVSEAEAAAIRAIFREKGEFSAAVELRRLFPGITDTEQARE
Ga0310906_103663951	3300032013	Soil	MFCVSEAQAAMIRTTFEQRGELSAVVELQRLFPGPG
Ga0308173_120244761	3300032074	Soil	MFVVTDSDVAAIRAAFEAGGELSAAVELRRRFAGIPNNE
Ga0307472_1017915922	3300032205	Hardwood Forest Soil	MGRRSHASGMFVVTEADATAIRDAFDHGGELSAAVELRRLFP
Ga0306920_1039827641	3300032261	Soil	MFTATEAEAAAIRASCDQGGEFAAAVELRRLFPGVTDSAEGGECARTIA
Ga0335079_123872761	3300032783	Soil	MFCISEAQAAEIRAIFHERGEFSAAIELRRLFPGI
Ga0335072_104346932	3300032898	Soil	MMFVVSEEEAAAIRTAFDRGGELEAAIELRRRFPGISDT
Ga0370489_0265770_246_374	3300034127	Untreated Peat Soil	MFAVTEAAAIREAYFSGGELSAAVELRRRFPGIADMDVPAEQ
Ga0370485_0078809_3_119	3300034358	Untreated Peat Soil	MFCVSEAEATLIRTAFHEGGELSAAVELRRLFPGIDDMA
Ga0370485_0212619_485_610	3300034358	Untreated Peat Soil	MFMVSEAEATAIREAWITGGELSAAVELRRFFPGITDMAKAR
Ga0370485_0251234_2_124	3300034358	Untreated Peat Soil	MFAVTAAEADAIRTAWIEGGELSAAVELRRLFPGITDMARA

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F058412

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences