Basic Information | |
---|---|
Family ID | F059145 |
Family Type | Metagenome |
Number of Sequences | 134 |
Average Sequence Length | 42 residues |
Representative Sequence | MRAAKHHLETAEHDFDGHRRKAIEHLDQAIHEAEICMSMR |
Number of Associated Samples | 112 |
Number of Associated Scaffolds | 134 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 9.48 % |
% of genes near scaffold ends (potentially truncated) | 79.10 % |
% of genes from short scaffolds (< 2000 bps) | 73.88 % |
Associated GOLD sequencing projects | 101 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.49 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (83.582 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (12.687 % of family members) |
Environment Ontology (ENVO) | Unclassified (33.582 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.224 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.12% β-sheet: 0.00% Coil/Unstructured: 55.88% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 134 Family Scaffolds |
---|---|---|
PF13505 | OMP_b-brl | 16.42 |
PF07681 | DoxX | 8.21 |
PF09335 | SNARE_assoc | 2.24 |
PF12804 | NTP_transf_3 | 0.75 |
PF01612 | DNA_pol_A_exo1 | 0.75 |
PF16538 | FlgT_C | 0.75 |
PF00202 | Aminotran_3 | 0.75 |
PF04350 | PilO | 0.75 |
PF11104 | PilM_2 | 0.75 |
PF04079 | SMC_ScpB | 0.75 |
COG ID | Name | Functional Category | % Frequency in 134 Family Scaffolds |
---|---|---|---|
COG4270 | Uncharacterized membrane protein | Function unknown [S] | 8.21 |
COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 8.21 |
COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 2.24 |
COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 2.24 |
COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 2.24 |
COG3167 | Type IV pilus assembly protein PilO | Cell motility [N] | 1.49 |
COG1386 | Chromosome segregation and condensation protein ScpB | Transcription [K] | 0.75 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 83.58 % |
Unclassified | root | N/A | 16.42 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001546|JGI12659J15293_10068014 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 789 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100088533 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2887 | Open in IMG/M |
3300004091|Ga0062387_101315449 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300004092|Ga0062389_100391132 | All Organisms → cellular organisms → Bacteria | 1505 | Open in IMG/M |
3300004092|Ga0062389_102380090 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
3300004152|Ga0062386_100109628 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2127 | Open in IMG/M |
3300005436|Ga0070713_101163372 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 746 | Open in IMG/M |
3300005602|Ga0070762_10817089 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
3300005610|Ga0070763_10003332 | All Organisms → cellular organisms → Bacteria | 5944 | Open in IMG/M |
3300005610|Ga0070763_10022910 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2778 | Open in IMG/M |
3300005610|Ga0070763_10580558 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
3300005712|Ga0070764_10473741 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
3300005993|Ga0080027_10003970 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 5565 | Open in IMG/M |
3300006052|Ga0075029_101118917 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
3300006086|Ga0075019_10399168 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
3300006162|Ga0075030_100435543 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
3300006162|Ga0075030_100802538 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 743 | Open in IMG/M |
3300006162|Ga0075030_101406376 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
3300006176|Ga0070765_101866721 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
3300006800|Ga0066660_11159120 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
3300006893|Ga0073928_10086989 | All Organisms → cellular organisms → Bacteria | 2660 | Open in IMG/M |
3300006893|Ga0073928_10697442 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 708 | Open in IMG/M |
3300007265|Ga0099794_10340744 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 779 | Open in IMG/M |
3300009088|Ga0099830_10878930 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 741 | Open in IMG/M |
3300010043|Ga0126380_10121387 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1615 | Open in IMG/M |
3300010048|Ga0126373_12462230 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
3300010339|Ga0074046_10726583 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
3300010341|Ga0074045_10279845 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1097 | Open in IMG/M |
3300010358|Ga0126370_10880128 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 807 | Open in IMG/M |
3300010358|Ga0126370_11721470 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 604 | Open in IMG/M |
3300010359|Ga0126376_11592541 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 685 | Open in IMG/M |
3300010361|Ga0126378_10088528 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3021 | Open in IMG/M |
3300010379|Ga0136449_102862985 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 679 | Open in IMG/M |
3300010398|Ga0126383_11700017 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 720 | Open in IMG/M |
3300010937|Ga0137776_1388808 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 709 | Open in IMG/M |
3300011120|Ga0150983_11073738 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1605 | Open in IMG/M |
3300011120|Ga0150983_16022124 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 807 | Open in IMG/M |
3300011269|Ga0137392_11574269 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
3300012200|Ga0137382_11118709 | Not Available | 562 | Open in IMG/M |
3300012349|Ga0137387_10193481 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1459 | Open in IMG/M |
3300012354|Ga0137366_10181875 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1576 | Open in IMG/M |
3300012362|Ga0137361_10237348 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1659 | Open in IMG/M |
3300012362|Ga0137361_10607985 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
3300012971|Ga0126369_11472162 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 771 | Open in IMG/M |
3300014153|Ga0181527_1180475 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 896 | Open in IMG/M |
3300014158|Ga0181521_10011994 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 8222 | Open in IMG/M |
3300014168|Ga0181534_10255127 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
3300015242|Ga0137412_10171261 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1745 | Open in IMG/M |
3300017822|Ga0187802_10167676 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 841 | Open in IMG/M |
3300017822|Ga0187802_10262393 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 670 | Open in IMG/M |
3300017823|Ga0187818_10214029 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 841 | Open in IMG/M |
3300017930|Ga0187825_10041543 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1554 | Open in IMG/M |
3300017936|Ga0187821_10174013 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 820 | Open in IMG/M |
3300017993|Ga0187823_10298165 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
3300018062|Ga0187784_10646307 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 848 | Open in IMG/M |
3300018088|Ga0187771_10106281 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2268 | Open in IMG/M |
3300018090|Ga0187770_10327661 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1195 | Open in IMG/M |
3300018468|Ga0066662_11896649 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 623 | Open in IMG/M |
3300020579|Ga0210407_11280535 | Not Available | 548 | Open in IMG/M |
3300020581|Ga0210399_10242223 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1503 | Open in IMG/M |
3300020581|Ga0210399_10341208 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1251 | Open in IMG/M |
3300020581|Ga0210399_10542012 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 965 | Open in IMG/M |
3300020581|Ga0210399_11380265 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
3300020582|Ga0210395_11242137 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
3300020583|Ga0210401_10027548 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5425 | Open in IMG/M |
3300021088|Ga0210404_10380424 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 787 | Open in IMG/M |
3300021181|Ga0210388_11434937 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
3300021402|Ga0210385_10326421 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1142 | Open in IMG/M |
3300021433|Ga0210391_10673428 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 811 | Open in IMG/M |
3300021474|Ga0210390_10067400 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2956 | Open in IMG/M |
3300021559|Ga0210409_10787269 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 823 | Open in IMG/M |
3300023056|Ga0233357_1047722 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
3300025939|Ga0207665_10454996 | Not Available | 983 | Open in IMG/M |
3300026318|Ga0209471_1305118 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
3300026920|Ga0208575_1017261 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 658 | Open in IMG/M |
3300027070|Ga0208365_1054188 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
3300027604|Ga0208324_1016806 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2296 | Open in IMG/M |
3300027652|Ga0209007_1004579 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3808 | Open in IMG/M |
3300027678|Ga0209011_1159439 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 631 | Open in IMG/M |
3300027725|Ga0209178_1303023 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
3300027853|Ga0209274_10060363 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1817 | Open in IMG/M |
3300027855|Ga0209693_10422191 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
3300027867|Ga0209167_10139776 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1264 | Open in IMG/M |
3300027867|Ga0209167_10340736 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 814 | Open in IMG/M |
3300027879|Ga0209169_10227919 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 975 | Open in IMG/M |
3300027884|Ga0209275_10913178 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300027898|Ga0209067_10149444 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1239 | Open in IMG/M |
3300027911|Ga0209698_10508806 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 932 | Open in IMG/M |
3300028759|Ga0302224_10166007 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 868 | Open in IMG/M |
3300028800|Ga0265338_10384283 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1003 | Open in IMG/M |
3300028906|Ga0308309_10078297 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2490 | Open in IMG/M |
3300030494|Ga0310037_10465297 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
3300031122|Ga0170822_12111618 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1791 | Open in IMG/M |
3300031231|Ga0170824_120143246 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
3300031231|Ga0170824_128780066 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1050 | Open in IMG/M |
3300031247|Ga0265340_10292223 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 723 | Open in IMG/M |
3300031446|Ga0170820_13614112 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 826 | Open in IMG/M |
3300031474|Ga0170818_100579545 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1666 | Open in IMG/M |
3300031708|Ga0310686_112623185 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 824 | Open in IMG/M |
3300031708|Ga0310686_117659952 | Not Available | 574 | Open in IMG/M |
3300031715|Ga0307476_10337668 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1108 | Open in IMG/M |
3300031718|Ga0307474_11615820 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
3300031754|Ga0307475_10043358 | All Organisms → cellular organisms → Bacteria | 3344 | Open in IMG/M |
3300031823|Ga0307478_10196722 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1620 | Open in IMG/M |
3300031823|Ga0307478_10453496 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1066 | Open in IMG/M |
3300031962|Ga0307479_10051453 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3958 | Open in IMG/M |
3300032160|Ga0311301_12017667 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 672 | Open in IMG/M |
3300032180|Ga0307471_104267593 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
3300032205|Ga0307472_102744016 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
3300032892|Ga0335081_10600520 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1358 | Open in IMG/M |
3300032955|Ga0335076_10310217 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1466 | Open in IMG/M |
3300032955|Ga0335076_10980118 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 727 | Open in IMG/M |
3300033433|Ga0326726_10873183 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 872 | Open in IMG/M |
3300033807|Ga0314866_065189 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 616 | Open in IMG/M |
3300033888|Ga0334792_025486 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2047 | Open in IMG/M |
3300034199|Ga0370514_200769 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.69% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 9.70% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.72% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.72% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.97% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.97% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 5.22% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 5.22% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.73% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.73% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.99% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.99% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.24% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.24% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.24% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.24% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 2.24% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.49% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.49% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.49% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.49% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.49% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.49% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.49% |
Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.75% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.75% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.75% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.75% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.75% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.75% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.75% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.75% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.75% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001546 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009635 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 | Environmental | Open in IMG/M |
3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300014153 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaG | Environmental | Open in IMG/M |
3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300023056 | Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS2 | Environmental | Open in IMG/M |
3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
3300025406 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 (SPAdes) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
3300026920 | Forest soil microbial communities from Willamette National Forest, Oregon, USA, amended with Nitrogen - NN397 (SPAdes) | Environmental | Open in IMG/M |
3300027070 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF004 (SPAdes) | Environmental | Open in IMG/M |
3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029945 | I_Bog_N2 coassembly | Environmental | Open in IMG/M |
3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300033807 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10 | Environmental | Open in IMG/M |
3300033888 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-3-X1 | Environmental | Open in IMG/M |
3300034199 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12659J15293_100680141 | 3300001546 | Forest Soil | EAMRAARHHMEQAEPIFQGHREEAIKHLDMAIHEAEICEGMR* |
JGI12635J15846_103018662 | 3300001593 | Forest Soil | PPHPEIAAALDAMHSAHHYLENAAHDFHGHRVEAIKHLDAAIHEADICMQEP* |
JGIcombinedJ26739_1000885334 | 3300002245 | Forest Soil | MRAAKHHLESAEHDFDGHRMEAIKHLDMAIHEAEICESMK* |
Ga0062387_1013154491 | 3300004091 | Bog Forest Soil | EAMRAAKHHLEMAEHDFHGHRAKAIEHLDMAIHEAEICEQEP* |
Ga0062389_1003911322 | 3300004092 | Bog Forest Soil | MRAAKHHLEMAEHDFDGHRAKAIEHLNMAIHEAEICASMK* |
Ga0062389_1023800902 | 3300004092 | Bog Forest Soil | PHPHIEQGLEAMRAAKGHLEAAEHDFHGHRSKAIEHLNQAIHEAEICMQEP* |
Ga0062386_1001096284 | 3300004152 | Bog Forest Soil | MRAAKHELEIAEHDFDGHKVKSLEHLNASIHEAEICLSMR* |
Ga0062386_1005835622 | 3300004152 | Bog Forest Soil | HSAKEHMEHAEGEFHGHRGAAIHHIDEAIHEAEICMHEP* |
Ga0070713_1011633722 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | IGEAIESMRAAKHHLESAEHDFEGHRLKAIEHLDQAIKEAEICMSMK* |
Ga0070762_108170892 | 3300005602 | Soil | HPHIDEALEAMRSAKHQLETAEHDFDGHRAKAIEHLDRAIHEAEICVSMR* |
Ga0070763_100033321 | 3300005610 | Soil | ALEAMRNAKHQLETAEHDFHGHRAKSIEHLDQAIHEAEICEHE* |
Ga0070763_100229101 | 3300005610 | Soil | AMRSAKHQLESAEHDFDGHRARSIEHLDRAIHEAEICLSMR* |
Ga0070763_105805581 | 3300005610 | Soil | RSAKHHLEMAEHDFHGHRAKAIEHLDMAIHEAEECEREP* |
Ga0070764_104737412 | 3300005712 | Soil | HIDEALEAMRSAKHQLESAEHDFDGHRARSIEHLDRAIHEAEICLSMR* |
Ga0070766_100779901 | 3300005921 | Soil | AREHMGHAEGEFHGHRDKAIEHIDAAIHEAEICEREP* |
Ga0080027_100039702 | 3300005993 | Prmafrost Soil | MRNAKHQLETAEHDFDGHRRKSIEHLDMAIHEAEICLSMR* |
Ga0075029_1011189172 | 3300006052 | Watersheds | HAKHELETAEHDFHGHRVKSIEHLDQAIHEAEICMQEQ* |
Ga0075019_103991682 | 3300006086 | Watersheds | HIDEALEHMRAAKHELETAAHDFKGHRVKSMEHLNQAIHEAEECLKVDAD* |
Ga0075030_1004355433 | 3300006162 | Watersheds | ALESMRAAKHQLEIAEHDFDGHRARSIEHLNQAIHEAEICMQMK* |
Ga0075030_1008025381 | 3300006162 | Watersheds | EALEHMRAAKKELLAAEHDFEGHRVKSVEHLNEAIHEAEICMKMK* |
Ga0075030_1014063762 | 3300006162 | Watersheds | HAKHELETAEHDFHGHRVKSIEHLDQAIHEAEICMQEP* |
Ga0070765_1018667211 | 3300006176 | Soil | EGLEAMRAAKHHLEAATPEFHGHRAKAIEHLDQAIHEAEICETEP* |
Ga0066660_111591202 | 3300006800 | Soil | HIDEAIEAMRNAKHQLETAEHDFDGHRRKSIEHLDAAIHEAEICMSMR* |
Ga0073928_100869891 | 3300006893 | Iron-Sulfur Acid Spring | LESMRSARHHLERAEHDFQGHRAKAIVHLDRAIHEAEICLSMK* |
Ga0073928_106974422 | 3300006893 | Iron-Sulfur Acid Spring | AKHHLETAEHDFHGHRVKAIEHLDRAIHEAEICEEEP* |
Ga0099794_103407441 | 3300007265 | Vadose Zone Soil | KKHLEIAEHDFKGHRAKSLEHLNQAIREAEICLSMK* |
Ga0099830_108789301 | 3300009088 | Vadose Zone Soil | HISEGLEAMRSAKHHLEAAEHDFHGHRAKAIGHLNQAIREAEICMSEP* |
Ga0116117_12106721 | 3300009635 | Peatland | HAREHMEHAEGEFHGHRAKAIEHLDAAIHEAEICMQEP* |
Ga0116130_10529561 | 3300009762 | Peatland | HAKEHMEHADGEFHGHRAKAIEHIDAAIHEAEICMQEP* |
Ga0126380_101213873 | 3300010043 | Tropical Forest Soil | AAKHELDIAEHDFEGHRVKSIDHLNQAMHEAEICMSMK* |
Ga0126373_124622301 | 3300010048 | Tropical Forest Soil | ALEHMRAAKHELEIAEHDFDGHRVKSLEHLNASMHEAEICLSMR* |
Ga0074046_107265832 | 3300010339 | Bog Forest Soil | HPHIHEALEAMRNAKHELETAEHDFHGHRVKSIEHLDQAIHEAEICEQEP* |
Ga0074045_102798452 | 3300010341 | Bog Forest Soil | IHEALEAMRNAKHELETAEHDFHGHRADAIKHLDMAIHEAEICEQEP* |
Ga0074044_101100471 | 3300010343 | Bog Forest Soil | NAREHMEHAEGEFHGHRAKAIEHLDAAIHEAEMCEREP* |
Ga0126370_108801282 | 3300010358 | Tropical Forest Soil | AMRAAKHQLETAAHDYDGHRVKSIEHLDQAIREAEICESMK* |
Ga0126370_117214701 | 3300010358 | Tropical Forest Soil | IDEALEHMRAAKHELEVAEHDFQGHRVKSIEHLDQAMHEAEICMSMR* |
Ga0126376_115925412 | 3300010359 | Tropical Forest Soil | EALEAMKAAKHQLETAAHDYDGHRVKSIEHLDQAIREAEICESMK* |
Ga0126378_100885281 | 3300010361 | Tropical Forest Soil | MRAAKHELEVAAHDFDGHRVKSVEHLDQAIHEAEICNGMK* |
Ga0136449_1028629852 | 3300010379 | Peatlands Soil | AKDELYAAEHDFHGHRAKSIAHLDEAINEAEYCEKEP* |
Ga0126383_117000171 | 3300010398 | Tropical Forest Soil | AKHELDIAEHDFEGHRVKSIDHLNQAMHEAEICMSMK* |
Ga0137776_13888082 | 3300010937 | Sediment | AKHELEIAAHDFDGHRVKSIEHLNASIHEAEICLNMR* |
Ga0150983_110737381 | 3300011120 | Forest Soil | HPHIDEALEQMRAAKHQLESAEHDFDGHRAKSLEHLNQAIHEAEVCMSMK* |
Ga0150983_160221241 | 3300011120 | Forest Soil | ALESMRAAKHHLESAEHDFDGHRGKALEHLNQAIHEAEICMSMR* |
Ga0137392_115742691 | 3300011269 | Vadose Zone Soil | KHHLEAAEHDFHGHRAKAIEHLNQAIREAEICMSEP* |
Ga0137382_111187091 | 3300012200 | Vadose Zone Soil | RAAKKELESAEHDFQGHRAKSLEHLNQAMHEAEVCMSMK* |
Ga0137387_101934811 | 3300012349 | Vadose Zone Soil | ALEAMRSAKHHLESAEHDFRGHRAKAIADLDRAIHEAEICMSMR* |
Ga0137366_101818751 | 3300012354 | Vadose Zone Soil | HHLETAEHDFHGHRVKAMEHLDQAIREAEICEREQ* |
Ga0137361_102373483 | 3300012362 | Vadose Zone Soil | MRAAKHHLEAAQHDFHGHRAKAIGHLNQAIREAEICMSEP* |
Ga0137361_106079852 | 3300012362 | Vadose Zone Soil | MRSAKHHLEAAEHDFHGHRAKAIEHLNQAIREAEICMSEP* |
Ga0126369_114721621 | 3300012971 | Tropical Forest Soil | MRAAKHALETAEHDFDGHRVKSIEHLNASIREAEICLNMR* |
Ga0181527_11804751 | 3300014153 | Bog | NAKHELETAEHDFHGHRVNSIEHLDQAIHEAEICEQEP* |
Ga0181521_100119941 | 3300014158 | Bog | HPHIHEALEAMRNAQHELETAAHDFHGHRQKALEHLNQAIHEAEICEQEP* |
Ga0181534_102551271 | 3300014168 | Bog | EFMRSAKHELETAEHDFHGHRVKAIEHLNAAIHEAEVCEMEP* |
Ga0181522_100599701 | 3300014657 | Bog | LEELHHAKEHMEHADGEFHGHRAKAIEHIDAAIHEAEICMQEP* |
Ga0137412_101712611 | 3300015242 | Vadose Zone Soil | DLLAWLESAEYDFHGHRVKAIEHLNRAIREAEICMSEP* |
Ga0187802_101676762 | 3300017822 | Freshwater Sediment | LEAMRGAKHELETAEHDFHGHRVKAIEHLNQAIHEAEICEEEP |
Ga0187802_102623932 | 3300017822 | Freshwater Sediment | AKHHLETAVPEFHGHRMKAIEHLNQAIHEAEICEQEP |
Ga0187818_102140291 | 3300017823 | Freshwater Sediment | HIDEALESMRAAKHQLEIAEHDFDGHRVKSLEHLNQAIHEAEICLSMK |
Ga0187825_100415431 | 3300017930 | Freshwater Sediment | MREAKHHLETAAHDFHGHRVKAIEHLDQAIHEAEICEREP |
Ga0187821_101740131 | 3300017936 | Freshwater Sediment | HIHDALEAMRAAKHHLDQAAHDFEGHRVKAIEHLDQAIHEAEICESMK |
Ga0187847_102152761 | 3300017948 | Peatland | EHMEHADGEFHGHRAKAIEHIDAAIHEAEICMQEP |
Ga0187823_102981652 | 3300017993 | Freshwater Sediment | SMRAAKHHLESAEHDFDGHRSRAIEHLNQAIHEAEICMSMR |
Ga0187810_100760551 | 3300018012 | Freshwater Sediment | EPHPEIQAALEAMHNAKDHLQHAAHDFHGHRVKSIEHLDQAIHEAEICMQEH |
Ga0187890_108692212 | 3300018044 | Peatland | RGARDHMAHAEGEFHGHRDRAIEHIDQAIHEAEICLNEP |
Ga0187784_106463071 | 3300018062 | Tropical Peatland | KHELEIAEHDFGGHRAKSIEHLDQAIHEAEICLEMK |
Ga0187771_101062811 | 3300018088 | Tropical Peatland | LEHMRAAKHELETAAHDFKGHRVKSLAHLNQAIEEAEICLKVDAD |
Ga0187770_103276613 | 3300018090 | Tropical Peatland | PHIGEALEAMHAAKHHLEAAVPEFHGHRAKAIEHLDQAIHEAEICMNEP |
Ga0066662_118966492 | 3300018468 | Grasslands Soil | HMRAAKKQLESAEHDFGGHRVKSIEHLDAAIREAEICMGMK |
Ga0210407_112805351 | 3300020579 | Soil | HMRAAKKELESAEHDFQGHRAKSLEHLNQAMHEAEVCMSMK |
Ga0210399_102422231 | 3300020581 | Soil | HPHIDEALEAMRSAKHHLETADRDFHGHRAKSIEHLNQAIHEAEICMQEP |
Ga0210399_103412084 | 3300020581 | Soil | RAAKHQLESAEHDFGGHRAKAIEHLDRAIHEAEICMSMR |
Ga0210399_105420121 | 3300020581 | Soil | EAMRAAKHHLETAEHDFHGHRVKAIEHLDRAIHEAEICEEEP |
Ga0210399_113802652 | 3300020581 | Soil | KHQLETAEHDFHGHRAKSIEHLDQAIHEAEICEHE |
Ga0210395_112421371 | 3300020582 | Soil | HIDEALESMRAAKHQLESAEHDFGGHRAKAIEHLDRAIHEAEICMSMR |
Ga0210401_100275481 | 3300020583 | Soil | PHIDEALESMRAAKHQLEVAEHDFDGHRVKSIEHLDRAIHEAEICMSMR |
Ga0210404_103804241 | 3300021088 | Soil | LESMRAAKHHLETADHDFDGHRKKAIEHLDQAIHEAEICMSMH |
Ga0210405_107391432 | 3300021171 | Soil | ALRGARDHMAHAEGEFHGHRDKAIEHIDQAIHEAEICMQEP |
Ga0210405_108765682 | 3300021171 | Soil | AMPPHPEIAAALEAMHAARHHLDDAAHDYHGHRVKSIEHLDQAIHEAEVCMQEP |
Ga0210388_101526381 | 3300021181 | Soil | MPPHPEIAAALEAMHAARHHLDDAAHDYHGHRVKSIEHLDQAIHEAEVCMQEP |
Ga0210388_114349371 | 3300021181 | Soil | IHEALESMRAAKHHLETAEHDFHGHRVKAIEHLDRAIHEAEICEQEP |
Ga0210385_103264211 | 3300021402 | Soil | RAAKHQLEIAEHDFDGHRAKSIEHLNAAIHEAEICMGMK |
Ga0210391_106734282 | 3300021433 | Soil | MRSAKHHLETAEHDFHGHRVKAIEHLDRAIHEAEICEQEP |
Ga0210390_100674001 | 3300021474 | Soil | MHSAKDHLDHAAHDYHGHRVESIKHLDMAIHEAEICMQEP |
Ga0210409_107872692 | 3300021559 | Soil | ERMRAAKKELESAEHDFDGHRVKSIEHLNQAMHEAEVCMSMK |
Ga0233357_10477221 | 3300023056 | Soil | AMRNAKHELETAEHDFHGHRVKSIEHLDQAIHEAEICEHE |
Ga0224564_10856621 | 3300024271 | Soil | LRSARDHMQHAEGEFHGHRDRTIEHIDAAIHEAEICLQEP |
Ga0208035_10246601 | 3300025406 | Peatland | MRHAREHMEHAEGEFHGHRAKAIEHLDAAIHEAEICMQEP |
Ga0207665_104549961 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | AAKHHLETAEHDFGGHRVKAIEHLDRAIREAEICMTMR |
Ga0209471_13051181 | 3300026318 | Soil | IDEALESMRAAKHHLESAEHAFHGHRAKAIEHLNQAIREAEISMSEP |
Ga0208575_10172611 | 3300026920 | Soil | KKHLEMAEHDFKGHRAKSLEHLQMAIHEAEICMAMKD |
Ga0208365_10541882 | 3300027070 | Forest Soil | MRAAKHQLESAEHDFDGHRAKAVEHLNMAIHEAEICMG |
Ga0208324_10168061 | 3300027604 | Peatlands Soil | HELEIAEHDFDGHRAKSVEHLDRAIHEAEICMGMH |
Ga0209007_10045793 | 3300027652 | Forest Soil | MRAAKHHLESAEHDFDGHRMEAIKHLDMAIHEAEICESMK |
Ga0209007_11748051 | 3300027652 | Forest Soil | EALRSAREHMGHAEGEFHGHRDKAIEHIDAAIHEAEICEREP |
Ga0209011_11594391 | 3300027678 | Forest Soil | EAMRSAKKHLEMAEHDFKGHRAKSLQHLQMAIREAEICMSMK |
Ga0209178_13030232 | 3300027725 | Agricultural Soil | HPHIDEALEHMRAAKHALETAEHDFDGHRMKSIEHLNASIREAEICLNMR |
Ga0209274_100603633 | 3300027853 | Soil | MRAAKHHLESAEGDFHGHRHKAIDHLDQAIHEAEECEREP |
Ga0209693_104221912 | 3300027855 | Soil | RSAKHHLEMAEHDFHGHRAKAIEHLDMAIHEAEECEREP |
Ga0209167_101397763 | 3300027867 | Surface Soil | MRNAKHHLETAEHDFHGHRVKAIEHLDQAIHEAEICASEP |
Ga0209167_103407362 | 3300027867 | Surface Soil | ALEHMRAAKHELEIAEHDFDGHRAKSIEHLNGAIHEAEVCMGMH |
Ga0209169_102279191 | 3300027879 | Soil | HIDEALEAMRSAKHQLESAEHDFDGHRARSIEHLDRAIHEAEICLSMR |
Ga0209275_109131782 | 3300027884 | Soil | DEALEAMRSAKHQLETAEHDFDGHRAKAIEHLDRAIHEAEICVSMR |
Ga0209067_101494442 | 3300027898 | Watersheds | MRAAKHELEIAEHDFDGHRVKSIEHLNQAMHEAEICMEMK |
Ga0209698_105088062 | 3300027911 | Watersheds | ALESMRAAKHQLEIAEHDFDGHRARSIEHLNQAIHEAEICMQMK |
Ga0302224_101660071 | 3300028759 | Palsa | HPHIHEALDAMHAAKHHLEQAEHDYDGHRAKAIEHLDMAIHEAEICMSMP |
Ga0265338_103842832 | 3300028800 | Rhizosphere | RAAKHHLESAEHDFDGHRAKSIEHLNQAIHEAEICMGMK |
Ga0308309_100782971 | 3300028906 | Soil | LEAMRNAKHQLETAEHDFHGHRAKSIEHLDQAIHEAEICEHE |
Ga0311330_100171986 | 3300029945 | Bog | MRLARDHMAHAEGEFHGHRAKAIEHLDRAIHEAELCEQEP |
Ga0310037_104652972 | 3300030494 | Peatlands Soil | AKHQLEIAEHDFDGHRAKSIEHLNAAIHEAEICMGMK |
Ga0170822_121116181 | 3300031122 | Forest Soil | HPHIDEALESMRAAKHHLESAEHDFDGHRAKAIEHLDKAIHEAEICMSMK |
Ga0170824_1201432461 | 3300031231 | Forest Soil | HPHIDEALESMRAAKHHLESAEHDFDGHRAKAIEHLDKAIHEAEICMGMH |
Ga0170824_1287800662 | 3300031231 | Forest Soil | ALESMRAAKHHLETADHDFDGHRVKAIEHLNAAIHEAEICMSMR |
Ga0265340_102922231 | 3300031247 | Rhizosphere | ALESMRGAKHHLESAEHDFEGHKVKAIEHLDMAIHEAEICESMR |
Ga0170820_136141121 | 3300031446 | Forest Soil | LGSMRAAKHHLESAEHDFDGHRAKAIEHLDKAIHEAEICMSMK |
Ga0170818_1005795451 | 3300031474 | Forest Soil | IDEALESMRAAKHHLESAEHDFDGHRAKAIEHLDKAIHEAEICMSMK |
Ga0310686_1126231851 | 3300031708 | Soil | MRNAKHHLETADHDFHGHRMKSIEHLNQAIHEAEICLQE |
Ga0310686_1176599521 | 3300031708 | Soil | HSAKHHLETAVPEFHGHRAKAIEHLNQAIHEAEICEQEP |
Ga0307476_103376684 | 3300031715 | Hardwood Forest Soil | EAMRNAKHQLEAAEHDFHGHRAKSIEHLDQAIHEAEICEHE |
Ga0307474_116158202 | 3300031718 | Hardwood Forest Soil | ALESMRAAKHHLESAEHDFDGHRAKAIEHLDRAIREAEICMSMR |
Ga0307475_100433585 | 3300031754 | Hardwood Forest Soil | MRSAKHHLESAEHDFHGHRVKAIEHLNRAIREAEICMSEP |
Ga0307478_101967223 | 3300031823 | Hardwood Forest Soil | ITEALEAMRNAKHHLETAEHDFHGHRVKAIEHLNQAIHEAEICEQER |
Ga0307478_104534961 | 3300031823 | Hardwood Forest Soil | ALEHMRQAKHELEIAEHDFDGHRAKSIDHLDRAIHEAEICMGMH |
Ga0307479_100514531 | 3300031962 | Hardwood Forest Soil | AKRQLESAEHDFAGHRVKAIEHLDRAIREAEICMSMK |
Ga0311301_120176671 | 3300032160 | Peatlands Soil | AIKAMKAAKDELYAGEHDFHGHRAKSIAHLDEAINEAEYCEKEP |
Ga0307471_1042675931 | 3300032180 | Hardwood Forest Soil | DEALESMRAAKHHLETAEHDFDGHRAKAIGHLDQAIHEAEICMSMR |
Ga0307472_1027440161 | 3300032205 | Hardwood Forest Soil | MRAAKHHLETAEHDFDGHRRKAIEHLDQAIHEAEICMSMR |
Ga0335081_106005201 | 3300032892 | Soil | RNAKHHLEGAAHDFDGHRVKAIEHLDQAIHEAEVCESMK |
Ga0335076_103102173 | 3300032955 | Soil | HIHAALESMRAAKHELESAAHDFHGHRVKSIEHLDAAIHEAEICEHE |
Ga0335076_109801181 | 3300032955 | Soil | ALEHMQAAKHELEIAAHDFKGHRVKSLEHLNQAIGEAEMCLKVGD |
Ga0326728_103580723 | 3300033402 | Peat Soil | YAREHMTHAEGEFHGHRDKAIEHIDQAIHEAEICDREP |
Ga0326726_108731832 | 3300033433 | Peat Soil | AKKELESAEHDFQGHRAKSVQHLNQAMREAEICMNMK |
Ga0314866_065189_1_144 | 3300033807 | Peatland | IDEALEHMRAAKHELETAAHDFKGHRVKSLEHLNQAIAEAEMCLKAD |
Ga0334792_025486_1896_2045 | 3300033888 | Soil | PHIHEALESMRAAKHHLESAEHDFHGHRAKAIEHLDQAIHEAEICEREP |
Ga0370514_200769_2_154 | 3300034199 | Untreated Peat Soil | HPHITEGLEAMRSAKHHLESAEHDFHGHRAKAIEHLDMAIHEAELCEQEP |
⦗Top⦘ |