Basic Information | |
---|---|
Family ID | F059375 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 134 |
Average Sequence Length | 46 residues |
Representative Sequence | AGLSAAQIAAQLRNPSSPVAQAIDGSAKVIVAAINQVLHDQAGQG |
Number of Associated Samples | 124 |
Number of Associated Scaffolds | 134 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 91.04 % |
% of genes from short scaffolds (< 2000 bps) | 92.54 % |
Associated GOLD sequencing projects | 117 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.65 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (71.642 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (17.910 % of family members) |
Environment Ontology (ENVO) | Unclassified (18.657 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.015 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.58% β-sheet: 0.00% Coil/Unstructured: 53.42% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.65 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 134 Family Scaffolds |
---|---|---|
PF04264 | YceI | 9.70 |
PF07992 | Pyr_redox_2 | 8.21 |
PF02627 | CMD | 5.97 |
PF02566 | OsmC | 5.97 |
PF14833 | NAD_binding_11 | 3.73 |
PF10397 | ADSL_C | 2.24 |
PF04248 | NTP_transf_9 | 1.49 |
PF00248 | Aldo_ket_red | 1.49 |
PF13193 | AMP-binding_C | 1.49 |
PF01475 | FUR | 0.75 |
PF08546 | ApbA_C | 0.75 |
PF11251 | DUF3050 | 0.75 |
PF00491 | Arginase | 0.75 |
PF00578 | AhpC-TSA | 0.75 |
PF17197 | DUF5134 | 0.75 |
PF06445 | GyrI-like | 0.75 |
PF04229 | GrpB | 0.75 |
PF02371 | Transposase_20 | 0.75 |
PF02628 | COX15-CtaA | 0.75 |
PF03640 | Lipoprotein_15 | 0.75 |
PF01906 | YbjQ_1 | 0.75 |
PF01850 | PIN | 0.75 |
PF13631 | Cytochrom_B_N_2 | 0.75 |
PF11271 | PorA | 0.75 |
PF13560 | HTH_31 | 0.75 |
PF13358 | DDE_3 | 0.75 |
PF07883 | Cupin_2 | 0.75 |
PF00291 | PALP | 0.75 |
PF14192 | DUF4314 | 0.75 |
PF01244 | Peptidase_M19 | 0.75 |
PF05960 | DUF885 | 0.75 |
PF04545 | Sigma70_r4 | 0.75 |
PF07040 | DUF1326 | 0.75 |
PF07732 | Cu-oxidase_3 | 0.75 |
PF00561 | Abhydrolase_1 | 0.75 |
COG ID | Name | Functional Category | % Frequency in 134 Family Scaffolds |
---|---|---|---|
COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 9.70 |
COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 5.97 |
COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 5.97 |
COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 5.97 |
COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 5.97 |
COG2343 | Uncharacterized conserved protein, DUF427 family | Function unknown [S] | 1.49 |
COG0010 | Arginase/agmatinase family enzyme | Amino acid transport and metabolism [E] | 0.75 |
COG0393 | Uncharacterized pentameric protein YbjQ, UPF0145 family | Function unknown [S] | 0.75 |
COG0735 | Fe2+ or Zn2+ uptake regulation protein Fur/Zur | Inorganic ion transport and metabolism [P] | 0.75 |
COG1612 | Heme A synthase | Coenzyme transport and metabolism [H] | 0.75 |
COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 0.75 |
COG2132 | Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) | Cell cycle control, cell division, chromosome partitioning [D] | 0.75 |
COG2320 | GrpB domain, predicted nucleotidyltransferase, UPF0157 family | General function prediction only [R] | 0.75 |
COG2355 | Zn-dependent dipeptidase, microsomal dipeptidase homolog | Posttranslational modification, protein turnover, chaperones [O] | 0.75 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.75 |
COG4315 | Predicted lipoprotein with conserved Yx(FWY)xxD motif (function unknown) | Function unknown [S] | 0.75 |
COG4805 | Uncharacterized conserved protein, DUF885 family | Function unknown [S] | 0.75 |
COG5588 | Uncharacterized conserved protein, DUF1326 domain | Function unknown [S] | 0.75 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 71.64 % |
Unclassified | root | N/A | 28.36 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300005366|Ga0070659_101985426 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300005434|Ga0070709_10989676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 668 | Open in IMG/M |
3300005435|Ga0070714_101157201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 754 | Open in IMG/M |
3300005435|Ga0070714_102004974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 564 | Open in IMG/M |
3300005436|Ga0070713_100049342 | All Organisms → cellular organisms → Bacteria | 3472 | Open in IMG/M |
3300005437|Ga0070710_11401050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 523 | Open in IMG/M |
3300005467|Ga0070706_101470634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 623 | Open in IMG/M |
3300005471|Ga0070698_101062440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 758 | Open in IMG/M |
3300005535|Ga0070684_100418025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1237 | Open in IMG/M |
3300005541|Ga0070733_10141377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1558 | Open in IMG/M |
3300005545|Ga0070695_100334794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1129 | Open in IMG/M |
3300005564|Ga0070664_101806831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 580 | Open in IMG/M |
3300005577|Ga0068857_100352232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1364 | Open in IMG/M |
3300005602|Ga0070762_11028921 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → Kribbella catacumbae | 565 | Open in IMG/M |
3300005618|Ga0068864_101443234 | Not Available | 690 | Open in IMG/M |
3300005764|Ga0066903_107202359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 576 | Open in IMG/M |
3300005993|Ga0080027_10427516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 535 | Open in IMG/M |
3300006052|Ga0075029_101067650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 560 | Open in IMG/M |
3300006163|Ga0070715_11023118 | Not Available | 516 | Open in IMG/M |
3300006173|Ga0070716_101394049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 570 | Open in IMG/M |
3300006175|Ga0070712_101308640 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 632 | Open in IMG/M |
3300006804|Ga0079221_11711323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 513 | Open in IMG/M |
3300006804|Ga0079221_11750314 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300006854|Ga0075425_103055028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 511 | Open in IMG/M |
3300006904|Ga0075424_100801837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1005 | Open in IMG/M |
3300006954|Ga0079219_10951080 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 704 | Open in IMG/M |
3300009521|Ga0116222_1054095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1747 | Open in IMG/M |
3300009525|Ga0116220_10132994 | Not Available | 1064 | Open in IMG/M |
3300009624|Ga0116105_1166707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 592 | Open in IMG/M |
3300009700|Ga0116217_10026694 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4462 | Open in IMG/M |
3300009824|Ga0116219_10106252 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1637 | Open in IMG/M |
3300009824|Ga0116219_10313991 | Not Available | 882 | Open in IMG/M |
3300009824|Ga0116219_10710252 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300010043|Ga0126380_10590888 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 872 | Open in IMG/M |
3300010362|Ga0126377_12890388 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → unclassified Nocardioidaceae → Nocardioidaceae bacterium | 554 | Open in IMG/M |
3300010364|Ga0134066_10106392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 822 | Open in IMG/M |
3300010379|Ga0136449_100186623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3976 | Open in IMG/M |
3300010396|Ga0134126_11979240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 637 | Open in IMG/M |
3300010399|Ga0134127_10789316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 997 | Open in IMG/M |
3300010867|Ga0126347_1197939 | Not Available | 990 | Open in IMG/M |
3300010876|Ga0126361_10417727 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300011270|Ga0137391_11575034 | Not Available | 501 | Open in IMG/M |
3300012200|Ga0137382_10501300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 862 | Open in IMG/M |
3300012202|Ga0137363_10720488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 845 | Open in IMG/M |
3300012207|Ga0137381_10380744 | Not Available | 1230 | Open in IMG/M |
3300012360|Ga0137375_10225998 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1748 | Open in IMG/M |
3300012923|Ga0137359_10824638 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
3300012960|Ga0164301_11107275 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 630 | Open in IMG/M |
3300014201|Ga0181537_10025224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4148 | Open in IMG/M |
3300014745|Ga0157377_11033058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 625 | Open in IMG/M |
3300014969|Ga0157376_12737709 | Not Available | 533 | Open in IMG/M |
3300015371|Ga0132258_12391043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1324 | Open in IMG/M |
3300017792|Ga0163161_10550907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 945 | Open in IMG/M |
3300017821|Ga0187812_1008961 | All Organisms → cellular organisms → Bacteria | 3468 | Open in IMG/M |
3300017821|Ga0187812_1262551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 550 | Open in IMG/M |
3300017823|Ga0187818_10077862 | All Organisms → cellular organisms → Bacteria | 1429 | Open in IMG/M |
3300017924|Ga0187820_1091234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Nocardiopsaceae → Nocardiopsis | 867 | Open in IMG/M |
3300017937|Ga0187809_10110459 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
3300017943|Ga0187819_10344967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 861 | Open in IMG/M |
3300017959|Ga0187779_10273976 | All Organisms → cellular organisms → Bacteria | 1073 | Open in IMG/M |
3300017959|Ga0187779_11112686 | Not Available | 552 | Open in IMG/M |
3300017972|Ga0187781_10399871 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
3300018001|Ga0187815_10499139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 521 | Open in IMG/M |
3300020081|Ga0206354_10895764 | Not Available | 644 | Open in IMG/M |
3300020579|Ga0210407_11037813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 624 | Open in IMG/M |
3300020581|Ga0210399_10677797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Propionibacteriaceae → Microlunatus → Microlunatus phosphovorus | 849 | Open in IMG/M |
3300020582|Ga0210395_11290885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 535 | Open in IMG/M |
3300021088|Ga0210404_10759461 | Not Available | 554 | Open in IMG/M |
3300021374|Ga0213881_10385477 | Not Available | 630 | Open in IMG/M |
3300021388|Ga0213875_10138257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1139 | Open in IMG/M |
3300021403|Ga0210397_11233374 | Not Available | 581 | Open in IMG/M |
3300021420|Ga0210394_10334731 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1330 | Open in IMG/M |
3300021479|Ga0210410_11036285 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 710 | Open in IMG/M |
3300022499|Ga0242641_1025329 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
3300022521|Ga0224541_1016768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 788 | Open in IMG/M |
3300022533|Ga0242662_10076239 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
3300022709|Ga0222756_1051459 | Not Available | 618 | Open in IMG/M |
3300022712|Ga0242653_1088379 | Not Available | 554 | Open in IMG/M |
3300022718|Ga0242675_1077698 | Not Available | 604 | Open in IMG/M |
3300023056|Ga0233357_1010213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1017 | Open in IMG/M |
3300024249|Ga0247676_1016555 | Not Available | 1152 | Open in IMG/M |
3300024323|Ga0247666_1058236 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
3300024331|Ga0247668_1012720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1749 | Open in IMG/M |
3300025898|Ga0207692_10988946 | Not Available | 555 | Open in IMG/M |
3300025921|Ga0207652_10438900 | Not Available | 1177 | Open in IMG/M |
3300025928|Ga0207700_11410612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → unclassified Nocardioidaceae → Nocardioidaceae bacterium | 619 | Open in IMG/M |
3300025928|Ga0207700_11775430 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → unclassified Nocardioidaceae → Nocardioidaceae bacterium | 543 | Open in IMG/M |
3300025929|Ga0207664_11770585 | Not Available | 540 | Open in IMG/M |
3300025929|Ga0207664_11798581 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300025931|Ga0207644_11178931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 644 | Open in IMG/M |
3300026041|Ga0207639_11343828 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
3300026324|Ga0209470_1216964 | Not Available | 793 | Open in IMG/M |
3300027590|Ga0209116_1151540 | Not Available | 503 | Open in IMG/M |
3300027604|Ga0208324_1064670 | Not Available | 1049 | Open in IMG/M |
3300027619|Ga0209330_1152588 | Not Available | 520 | Open in IMG/M |
3300027725|Ga0209178_1062352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1207 | Open in IMG/M |
3300027765|Ga0209073_10147960 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter agilis | 865 | Open in IMG/M |
3300027854|Ga0209517_10072947 | Not Available | 2427 | Open in IMG/M |
3300027855|Ga0209693_10128980 | Not Available | 1251 | Open in IMG/M |
3300027857|Ga0209166_10321348 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharopolyspora | 812 | Open in IMG/M |
3300027867|Ga0209167_10318267 | Not Available | 843 | Open in IMG/M |
3300027867|Ga0209167_10658048 | Not Available | 573 | Open in IMG/M |
3300027879|Ga0209169_10072967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1775 | Open in IMG/M |
3300027905|Ga0209415_10518645 | Not Available | 911 | Open in IMG/M |
3300028906|Ga0308309_10359457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1243 | Open in IMG/M |
3300030490|Ga0302184_10060609 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1808 | Open in IMG/M |
3300030509|Ga0302183_10063893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1457 | Open in IMG/M |
3300030524|Ga0311357_10233313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1786 | Open in IMG/M |
3300031027|Ga0302308_10858862 | Not Available | 501 | Open in IMG/M |
3300031234|Ga0302325_10211795 | All Organisms → cellular organisms → Bacteria | 3311 | Open in IMG/M |
3300031754|Ga0307475_10402091 | All Organisms → cellular organisms → Bacteria | 1101 | Open in IMG/M |
3300031765|Ga0318554_10796734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 528 | Open in IMG/M |
3300031777|Ga0318543_10498036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 546 | Open in IMG/M |
3300031795|Ga0318557_10232543 | Not Available | 843 | Open in IMG/M |
3300031820|Ga0307473_10766257 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
3300031896|Ga0318551_10413120 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
3300031912|Ga0306921_12014928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 614 | Open in IMG/M |
3300031945|Ga0310913_10482078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 881 | Open in IMG/M |
3300032008|Ga0318562_10754958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 558 | Open in IMG/M |
3300032065|Ga0318513_10183183 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
3300032067|Ga0318524_10488438 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
3300032076|Ga0306924_11656816 | Not Available | 672 | Open in IMG/M |
3300032160|Ga0311301_10200174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3426 | Open in IMG/M |
3300032160|Ga0311301_10943657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1153 | Open in IMG/M |
3300032174|Ga0307470_10089582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1727 | Open in IMG/M |
3300032180|Ga0307471_102528864 | Not Available | 650 | Open in IMG/M |
3300032770|Ga0335085_12224178 | Not Available | 551 | Open in IMG/M |
3300032782|Ga0335082_10475831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter agilis | 1112 | Open in IMG/M |
3300032828|Ga0335080_10668816 | Not Available | 1085 | Open in IMG/M |
3300032893|Ga0335069_11253736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → Arthrobacter agilis | 809 | Open in IMG/M |
3300032897|Ga0335071_10972344 | Not Available | 796 | Open in IMG/M |
3300032954|Ga0335083_10980965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → unclassified Nocardioidaceae → Nocardioidaceae bacterium | 666 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.91% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 8.96% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.96% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 5.22% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.48% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.48% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.48% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.73% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.99% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.99% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.99% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 2.99% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.24% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.49% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.49% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.49% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.49% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.49% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.49% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.49% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.49% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.49% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.49% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.75% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.75% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.75% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.75% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.75% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.75% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.75% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.75% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.75% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.75% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.75% |
Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.75% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.75% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.75% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.75% |
Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.75% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.75% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010867 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300022499 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022521 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E3 20-24 | Environmental | Open in IMG/M |
3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022709 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022712 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022718 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300023056 | Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS2 | Environmental | Open in IMG/M |
3300024249 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK17 | Environmental | Open in IMG/M |
3300024323 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07 | Environmental | Open in IMG/M |
3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
3300027590 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027619 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300028746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_1 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300030490 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3 | Environmental | Open in IMG/M |
3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300031027 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_3 | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0070659_1019854261 | 3300005366 | Corn Rhizosphere | VLAGLSAGQIASQLRNPSSPVAKAIDGSAKVIIAAIDQVLHEHPAH* |
Ga0070709_109896761 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | LAGLSAAQIAAQLRNPSSPVAQAIDGSAKVIVAAINQVLHNQAGQG* |
Ga0070714_1011572012 | 3300005435 | Agricultural Soil | SAAQIAAQLRNPSSPVAQAIDGSAKVIITAINQVLHDQASRG* |
Ga0070714_1020049741 | 3300005435 | Agricultural Soil | AGLSATQIAADLRDPSSPVAQAIDGSANVIIAAINQVLHHPASQG* |
Ga0070713_1000493421 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | AAQIAARLRDPASPVAQAIDGAAKVIIAAINQVLHDQVTRG* |
Ga0070710_114010502 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | AGLSAAQIAAQLRNPSSPVAQAIDGSAKVIITAINQVLHDQASRG* |
Ga0070706_1014706341 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | PQVLAGLSAAQIAAQLRDPSSPVARAIDASAQVIINHTNQVLRDRAAHNQA* |
Ga0070698_1010624401 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VLAGLSAAQIATQLRNPSSSVAQAIDGSAKVIVAAINQILHDQAGRG* |
Ga0070684_1004180252 | 3300005535 | Corn Rhizosphere | AGLSAAQIAAQLRDPSSPVAQAIDASAQVIINQINQVLRDQGVA* |
Ga0070733_101413772 | 3300005541 | Surface Soil | YNPQILAGLSAAQIASQLANPSSQVAQAIDGSARVIITAIDQVLHDKPALRAARAGA* |
Ga0070695_1003347941 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | LAGLSAAQIAAQLRDPSSPVARAIDASAQVIINHINQVLRDRAAHNQA* |
Ga0070664_1018068311 | 3300005564 | Corn Rhizosphere | VIAGSQYSPQVLAGLSAAQIAAQLRDPSSPVARAIDASAQVIINHINQVLRDRAAHNQA* |
Ga0068857_1003522321 | 3300005577 | Corn Rhizosphere | SAAQIAAQLRDPSSPVARAIDASAQVIINHINQVLRDRAAHNQA* |
Ga0070762_110289211 | 3300005602 | Soil | PQVLAGLSAAQIASQLSNPSSPVAQAVDGSAQVIIAAIDQVLHDETTPRLATGVSGG* |
Ga0068864_1014432341 | 3300005618 | Switchgrass Rhizosphere | QIASQLKNPDNPVARAIDGSAQVIITAINQVLHDTVPRG* |
Ga0066903_1072023591 | 3300005764 | Tropical Forest Soil | LAGAQFDPQVLAGLSAAQIAAQLRNPSSPVAQAIDSSAQVIIAAINQVLHHPADHG* |
Ga0080027_104275162 | 3300005993 | Prmafrost Soil | VLAGLSAAQIASQLSSPASPVARAVDGSAQAIIAAIDQVLHTQTARS* |
Ga0075029_1010676502 | 3300006052 | Watersheds | PQVLAGLSAAQIASQLSNPASPVAQAIDGSAQVIVAAIDQVLHDKTAQQPATGVSGG* |
Ga0070715_110231181 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | NPQVLTGLSAAQIASQLSNPSSPVAQAIDGSAQVIIAAIDQVLHTKTVR* |
Ga0070716_1013940492 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | QIAAQLRNPSSPVAQAIDGSAKVIVAAINQVLHDQAGQG* |
Ga0070712_1013086401 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | QYSPQVLAGLSAAQIAAQLRDPSSPVAQAIDASAQVIINQINQVLRDHATRSQA* |
Ga0079221_117113232 | 3300006804 | Agricultural Soil | GLSAAQIAAQLRNPSSPVAQAIDGSAKVIITAINQVLHDQAIRG* |
Ga0079221_117503142 | 3300006804 | Agricultural Soil | ADLRDPSSPVAQAIDGSANVIIAAINQILHDQASQG* |
Ga0075425_1030550282 | 3300006854 | Populus Rhizosphere | LSAAQIAARLRDPASPVAQAIDGAAKVIIAAINQVLHDQVTRG* |
Ga0075424_1008018372 | 3300006904 | Populus Rhizosphere | AGPRRLSAGQIASQFRNPSSPAAKAIDGSAKVIIAAIDQVLHKHPAH* |
Ga0079219_109510801 | 3300006954 | Agricultural Soil | AAQIAAQLRNPSSPVAQAIDGSAKVIVAAINQVLHDQAGQG* |
Ga0116222_10540951 | 3300009521 | Peatlands Soil | QVLAGLSAAQIADQLSKPSSPVAQAIDGSAKVIIAAIDQVLQASSGRG* |
Ga0116220_101329941 | 3300009525 | Peatlands Soil | VLAGLSAAQIASQLSNPSSPVAQAIDGSAQVIITALEQVLHDKTAQQPATGVSGG* |
Ga0116105_11667072 | 3300009624 | Peatland | LAGLSAAQIASRLSQPASPVARAIDGSAQVIVAAIDQVRHDQTARS* |
Ga0116217_100266941 | 3300009700 | Peatlands Soil | VQGLSAAQIAGQLSNPSSPVAKAIDGSASVIIAAIDQILHDTAARS* |
Ga0116219_101062524 | 3300009824 | Peatlands Soil | VLAGLSAAQIADQLGNPSSPVAQAVDGSAKVIIAAIDQVLHANSGRG* |
Ga0116219_103139912 | 3300009824 | Peatlands Soil | VLAGLSAAQIASQLSNPASPVAQAIDGSAQVIVAAIDQVLHDKTAQQPATGVSGG* |
Ga0116219_107102522 | 3300009824 | Peatlands Soil | VLAGLSAAQIADQLGNPSSPVAQAVDGSAKVIIAAIDQVLQASSGRG* |
Ga0126380_105908881 | 3300010043 | Tropical Forest Soil | LSAAQIAAQLRDPSSPVARAIDASAQVIINQINQVLRDRAAQT* |
Ga0074046_103060491 | 3300010339 | Bog Forest Soil | QLSNPSSPVAQAIDGSAQVIVAAIDQILLDKTARS* |
Ga0126377_128903882 | 3300010362 | Tropical Forest Soil | GLSATQIAADLRDPSSPVAQAIDGSANVIIAAINQVLHHPASQG* |
Ga0134066_101063921 | 3300010364 | Grasslands Soil | RDPSSPVAQAIDASAQVIINQINQVLRDRATQRQA* |
Ga0136449_1001866232 | 3300010379 | Peatlands Soil | VLAGLSAAQIASQLSHPSSPVAQAIDGSAQVIVTAIDQVLHDKTAPQLATGGSGG* |
Ga0134126_119792402 | 3300010396 | Terrestrial Soil | AGLSAAQIAAQLRNPSSPVAQAIDGSAKVIVAAINQVLHDQAGQG* |
Ga0134127_107893163 | 3300010399 | Terrestrial Soil | SQYSPQVLAGLSAAQIAAQLRDPSSPVARAIDASAQVIINQINQVLRDRAGQSRA* |
Ga0126347_11979392 | 3300010867 | Boreal Forest Soil | YDPQVLAGLSAAQIASQLSNPSSPVAQAVDGSAKVIITAIGQVLHDQAARS* |
Ga0126361_104177271 | 3300010876 | Boreal Forest Soil | QIASQLATPSSPVAQAIDGAAKVIVAAIDQVLHTAAGPG* |
Ga0137391_115750341 | 3300011270 | Vadose Zone Soil | QLRDPASPVAKAVDGSARVIIAAIDQVLHETPAR* |
Ga0137382_105013002 | 3300012200 | Vadose Zone Soil | GLSATQIAAQLRNPSSPVAQAIDGSAKVIVAAINQVLHDQVGQG* |
Ga0137363_107204882 | 3300012202 | Vadose Zone Soil | VLTGLSTAQIAAQLRNPSSPVAEAVDGSAKVIVAAINQVLHDQAGRG* |
Ga0137381_103807441 | 3300012207 | Vadose Zone Soil | AQLRNPSSPVAQAIDGSAKVIVAAINQLLHDQAGQG* |
Ga0137375_102259983 | 3300012360 | Vadose Zone Soil | AAQIAAQLRNPPSPVAQAIDGSAKVIVAAINQLLHDQASGG* |
Ga0137359_108246381 | 3300012923 | Vadose Zone Soil | LSTPSSPVAQAVDGAAKVIIAAIDQVLHAEAGRG* |
Ga0164301_111072752 | 3300012960 | Soil | AAQLRNPSSPVAQAIDGSAKVIVAAINQVLHDQAGQG* |
Ga0181537_100252246 | 3300014201 | Bog | YDPQVLAGLSAAQIASQLSNPSSPVAQAVDGSAQVIIAAIDQVLHDKTAPRLATGVSGGRNPGRA* |
Ga0157377_110330581 | 3300014745 | Miscanthus Rhizosphere | PQVLAGLSAGQIASQLRNPSSPVAKAIDGSAKVIIAAIDQVLHEHPAH* |
Ga0157376_127377092 | 3300014969 | Miscanthus Rhizosphere | AVLAGLSATQIASQLKNPDSPVARAIDGSAQVIITAINQVLHDTVPRG* |
Ga0132258_123910433 | 3300015371 | Arabidopsis Rhizosphere | PQVLAGLSAAQIAAQLRNPSSPVAQAIDGSAKVIVAAINQILHDQAGQG* |
Ga0163161_105509072 | 3300017792 | Switchgrass Rhizosphere | DPQVLAGLSAAQIAAQLRNPSSPVAQAIDGSAKVIVAAINQVLHDQAGQG |
Ga0187812_10089612 | 3300017821 | Freshwater Sediment | VLAGLSAAQIAGQLSNPSSPVAQAIDGSAKVVIAAIGQVLQASSGRG |
Ga0187812_12625511 | 3300017821 | Freshwater Sediment | VLAGLSARQIASQLGDPSIPVAQAVDGSAQVIVAAIDHVLHDHAADGS |
Ga0187818_100778621 | 3300017823 | Freshwater Sediment | PQVLAGLSAAQIAGQLSNPSSPVTQAIDGSAKVVIAAIGQVLQASSGRG |
Ga0187820_10912343 | 3300017924 | Freshwater Sediment | RQIASQLADPSSPVAQAVDGSAQVIIAAIDHVLRGHAAGSSA |
Ga0187809_101104592 | 3300017937 | Freshwater Sediment | SAAQIAGQLRNPSSPVAQAVDGSAKVIIAAIDQVLQANTGRG |
Ga0187819_103449672 | 3300017943 | Freshwater Sediment | VLAGLSARQIASQLGDPSIPVAQAVDGSAQVIVAAIDHVLHDHAADGSA |
Ga0187779_102739763 | 3300017959 | Tropical Peatland | NQLSNPSSPVAQAIDGSANVIIAAIDQVLQEDLSHG |
Ga0187779_111126861 | 3300017959 | Tropical Peatland | PQVLAGLSASQIASQLRNPSSPVAKAIDGSAKAIIAAIDQVLHEHAAR |
Ga0187781_103998711 | 3300017972 | Tropical Peatland | GLSAAQIAGQLSNPSSPVARAVDGSAKAIISAIDQVLQAGSGRC |
Ga0187815_104991392 | 3300018001 | Freshwater Sediment | AGLSARQIASQLGDPSIPVAQAVDGSAQVIVAAIDHVLHDHAADGSA |
Ga0206354_108957641 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | QVLAGLSAAQIAAQLRNPSSPVAQAIDGSAKVIVAAINQVLHDQAGQG |
Ga0210407_110378132 | 3300020579 | Soil | GAQYSPQVLAGLSAAQIASQLRTPSSPVAQAVDGAAKVIIAAIEQVLHANTGHG |
Ga0210399_106777972 | 3300020581 | Soil | LAGLSAAQIASQLSNPSSPVAQAVDGSAKVIITAIDQVLHDQTTRR |
Ga0210395_112908851 | 3300020582 | Soil | LAGLSAAQIAGQLSDPASPVAPAIDGSAQVIVTAIDQVLHDKTGPS |
Ga0210404_107594611 | 3300021088 | Soil | QVLPGLSAAQIASQLSDPASPVAQAIDGSAQVIVAAIDQVLHDKAALQPATGVPAG |
Ga0213881_103854772 | 3300021374 | Exposed Rock | PQVLAGLSATQIAAELRDPSSPVAQAIDGSAKVIIAAIDQVLHDQSARG |
Ga0213875_101382573 | 3300021388 | Plant Roots | AGLSATQIAAELRDPSSPVAQAIDGSAKVIIAAIDQVLHDQSARG |
Ga0210397_112333742 | 3300021403 | Soil | NPQVLAGLSAAQIASQLSNPSSPVAQAIDGSAQVIVAAIDQVLHDQTAPRPATGVSGGSRVPSGS |
Ga0210394_103347313 | 3300021420 | Soil | QLRNPASPVAQAIDGSAKVIITAINQVLHDQAIRG |
Ga0210410_110362851 | 3300021479 | Soil | LAGLSAAQIAAQLRNPASPVAQAIDGSAKVIITAINQVLHDQAIRG |
Ga0242641_10253291 | 3300022499 | Soil | IASQLATPSSPVAQAIDGAAKVIIAAIDQVLPAGAGRG |
Ga0224541_10167681 | 3300022521 | Soil | VLAGLSAAQIASQLTDPSSQVAQAIDGSAQVIITAIDQVLHGGAGA |
Ga0242662_100762391 | 3300022533 | Soil | PQVLAGLSATQIASQLGNPSSPVARAIDGSAQVIIAAIDQVLHDTSPQAGGATG |
Ga0222756_10514591 | 3300022709 | Soil | VLAGLSATQIASQLAKPSSPVAQAIDGSARVIVAAINQVLAGRAGSGSGR |
Ga0242653_10883792 | 3300022712 | Soil | ANPSSPVAQAIDGSARVIVAAINQVLAGRAGSGSGQ |
Ga0242675_10776982 | 3300022718 | Soil | QVLAGLSATQIASQLGNPSSPVAQAIDGSAQVIIAAINQVLHDKTAHS |
Ga0233357_10102131 | 3300023056 | Soil | QLRDTSSPVAQAIDGSANVIIAAINQILHRAPAGPA |
Ga0247676_10165551 | 3300024249 | Soil | QIAAQLRNPSSPVAQAIDGSAKVIVAAINQVLHDQAGQG |
Ga0247666_10582362 | 3300024323 | Soil | YVIAGSQYSPQVLAGLSAAQIAAQLRDPSSPVARAIDASAQVIINHINQVLRDRAAHNQA |
Ga0247668_10127201 | 3300024331 | Soil | AQIAAQLRNPSSPVAQAIDGSAKVIVAAINQVLHDQAGQG |
Ga0207692_109889461 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | QLRNPSSPVAQAIDGSAKVIITAINQVLHDQASRG |
Ga0207652_104389002 | 3300025921 | Corn Rhizosphere | AQLRNPSSPVAQAIDGSAKVIVAAINQVLHDQAGQG |
Ga0207700_114106122 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | LSATQITADLRDPSSPVAQAIDGSANVIIAAINQVLHHPASQG |
Ga0207700_117754302 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | AGLSATQIAADLRDPSSPVAQAIDGSANVIIAAINQILHDQASQG |
Ga0207664_117705851 | 3300025929 | Agricultural Soil | AAQIAAQLRDPSSPVAQAIDSSAQVIINQINQVLRDRAGQSRA |
Ga0207664_117985812 | 3300025929 | Agricultural Soil | RDPSSPVARAIDASAQVIINHINQVLRDRAAQNQA |
Ga0207644_111789311 | 3300025931 | Switchgrass Rhizosphere | QVLAGLSAGQIASQLRNPSSPVAKAIDGSAKVIIAAIDQVLHEHPAH |
Ga0207639_113438282 | 3300026041 | Corn Rhizosphere | AQLRDPSSPVARAIDASAQVIINHINQVLRDRAAHNQA |
Ga0209470_12169641 | 3300026324 | Soil | GLSAAQIAAQLRNPSSPVAQAIDGSAKVIITAINQVLHDQASHG |
Ga0209116_11515402 | 3300027590 | Forest Soil | PQVLAGLSAAQIASQLTDPSSPVAQAIDGSAQVIITAIDQVLHGGAGA |
Ga0208324_10646701 | 3300027604 | Peatlands Soil | QYNPQVLAGLSAAQIASQLSNPASPVVQAIDGSAQVIVAAIDQVLHDKTAQQPATGVSGG |
Ga0209330_11525883 | 3300027619 | Forest Soil | QILAGLSAAQIASQLRNPSSPVAQAIDGSARIIVTAIDQVLHGTPSGAGHS |
Ga0209178_10623522 | 3300027725 | Agricultural Soil | AAQLRDPSSPVAQAIDASAQVIINQINQVLRDRANQSQA |
Ga0209073_101479602 | 3300027765 | Agricultural Soil | AADLRDPSSPVAQAIDGSANVIIAAINQVLHDQASQG |
Ga0209517_100729474 | 3300027854 | Peatlands Soil | VQGLSAAQIAGQLSNPSSPVAKAIDGSASVIIAAIDQILHDTAARS |
Ga0209693_101289802 | 3300027855 | Soil | QLSNPASPVAAAIDGAAQVIVAAINQVLHDQAASNTQ |
Ga0209166_103213481 | 3300027857 | Surface Soil | IASQLRNPASPVAQAIDGSAKVIIAAIDNVLHLRAPR |
Ga0209167_103182671 | 3300027867 | Surface Soil | YNPQILAGLSAAQIASQLANPSSQVAQAIDGSAQVIITAIDQVLHDKPALRAARAGA |
Ga0209167_106580481 | 3300027867 | Surface Soil | DPQVLAGLSARQIASQLADPSSPVAQAVDASAQVIIAAIDHVLGGHAAGSPA |
Ga0209169_100729674 | 3300027879 | Soil | QVLAGLSAVQIASQLSNPASPVAAAIDGAAQVIVAAINQVLHDQAASNTQ |
Ga0209415_105186451 | 3300027905 | Peatlands Soil | QVLAGLSAAQIASQLSNPASPVAQAIDGSAQVIVAAIDQVLHDKTAQQPATGVSGG |
Ga0302233_104013932 | 3300028746 | Palsa | LAGLSTAQIASQLRNTSSPVAKAIDGSASVIIAAISHVLHNQTAGR |
Ga0308309_103594571 | 3300028906 | Soil | SQLSNPSSRVAQAVDGSAKVIITAIGQVLHDQAARS |
Ga0302184_100606091 | 3300030490 | Palsa | QYDPRVLAGLSAAQIASQLSNPSSPVAQAVDGSAKVIITAIGQVLHDQAARS |
Ga0302183_100638931 | 3300030509 | Palsa | YDPRVLAGLSAAQIASQLSNPSSPVAQAVDGSAKVIITAIDQILHDQAARS |
Ga0311357_102333131 | 3300030524 | Palsa | PQVLAGLSAAQIASQLSNPASLVARAIDGSAQVIVAAIDQVLHDKTAHS |
Ga0302308_108588621 | 3300031027 | Palsa | VLAGLSAAQIASQLSNPSSPVAQAVDGSAKVIITAIDQILHDQAARS |
Ga0302325_102117951 | 3300031234 | Palsa | QVLAGLSAAQIASQLTDPSSPVAQAIDGSAQVIITAIDQVLHGQRAAGAGA |
Ga0307475_104020911 | 3300031754 | Hardwood Forest Soil | YNPQVLAGLSAAQIASQLAIPSSPVAQAIDGAAKLIIAAIDQVLHAGAGHG |
Ga0318554_107967341 | 3300031765 | Soil | YNPQVLAGLSAAQIASQLSNPSSPVAQAIDAAAKVIITAIDQVLHETSSRSS |
Ga0318543_104980361 | 3300031777 | Soil | AGQLSNPSSPVAEAVDGAARVIVAAIDQALHAKAAGT |
Ga0318557_102325431 | 3300031795 | Soil | QIAAQLRDPASPVAQAIDGAAEVIITAINQALHDQA |
Ga0307473_107662572 | 3300031820 | Hardwood Forest Soil | LRDPSSPVGRAIDASAQVIINHINQVLRDRAAHNQA |
Ga0318551_104131201 | 3300031896 | Soil | AGLSAAQIAAQLRDPSSPVAQAIDGSAQVIIAAINQVVHDQTARG |
Ga0306921_120149283 | 3300031912 | Soil | QLSNPSSPVAEAVDGAARVIVAAIDQALHAQAAGT |
Ga0310913_104820783 | 3300031945 | Soil | GLSAAQIAGQLSNPSSPVAEAVDGAARVIVAAIDQALHAQAAGT |
Ga0318562_107549581 | 3300032008 | Soil | LALRNPSSPVAQAIDGSAQAIVAAINQVLHNRAGQS |
Ga0318513_101831831 | 3300032065 | Soil | PQVLAGLSAAQIANQLSNPFSPVAQAIDGSANVIIAAIDQVLQEDLSHG |
Ga0318524_104884382 | 3300032067 | Soil | VLAGLSAAQIASQLSNPSSPVAHAIDTAAKVIIVAIDQVLHDTSSRSS |
Ga0306924_116568161 | 3300032076 | Soil | QYNPQVLAGLSAAQIAAQLRDPASPVAQAIDGAAEVIITAINQALHDQA |
Ga0311301_102001745 | 3300032160 | Peatlands Soil | VLAGLSAAQIASQLSHPSSPVAQAIDGSAQVIVTAIDQVLHDKTAPQLATGGSGG |
Ga0311301_109436572 | 3300032160 | Peatlands Soil | QYNPQVLAGLSAAQIASQLSDPASPVAQDIDGSAQVIIAAIDQVLGVT |
Ga0307470_100895823 | 3300032174 | Hardwood Forest Soil | AGLSAAQIAAQLRNPSSPVAQAIDGSAKVIVAAINQVLHDQAGQG |
Ga0307471_1025288641 | 3300032180 | Hardwood Forest Soil | AGQIASQLRNPSSPVAQAIDGSARIIITAINQVLHRAPAGRG |
Ga0335085_122241781 | 3300032770 | Soil | QVLAGLSAAQIAAQLRNPSSPVAQAIDGSAKVIITAINQVLHDQPAHG |
Ga0335082_104758312 | 3300032782 | Soil | AGLSATQIAADLRDPSSPVAQAIDGSANMIIAAINQVLHHPASQG |
Ga0335080_106688163 | 3300032828 | Soil | AQLRNPSSPVAQAIDGSAQAIVAAINQVLHNQAGQS |
Ga0335069_112537362 | 3300032893 | Soil | QIAADLRDPSSPVAQAIDGSANVIIAAINQVLHDPASQG |
Ga0335071_109723441 | 3300032897 | Soil | AQIAAQLRNPSSPVAQAIDGSAQAIVAAINQVLHNQAGQS |
Ga0335083_109809652 | 3300032954 | Soil | DLRDPSSPVAQAIDGSANVIIAAINQILHDQASQG |
⦗Top⦘ |