Basic Information | |
---|---|
Family ID | F059742 |
Family Type | Metagenome |
Number of Sequences | 133 |
Average Sequence Length | 44 residues |
Representative Sequence | GVPVVSARRLPSMLRALPAVLGPERVAVLADQARVRFHAAA |
Number of Associated Samples | 82 |
Number of Associated Scaffolds | 133 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 16.54 % |
% of genes near scaffold ends (potentially truncated) | 84.21 % |
% of genes from short scaffolds (< 2000 bps) | 88.72 % |
Associated GOLD sequencing projects | 77 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.52 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (58.647 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere (26.316 % of family members) |
Environment Ontology (ENVO) | Unclassified (30.827 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (36.090 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.38% β-sheet: 0.00% Coil/Unstructured: 53.62% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 133 Family Scaffolds |
---|---|---|
PF00211 | Guanylate_cyc | 3.01 |
PF01872 | RibD_C | 3.01 |
PF13191 | AAA_16 | 1.50 |
PF13602 | ADH_zinc_N_2 | 1.50 |
PF02371 | Transposase_20 | 1.50 |
PF13460 | NAD_binding_10 | 1.50 |
PF03631 | Virul_fac_BrkB | 1.50 |
PF13683 | rve_3 | 1.50 |
PF12697 | Abhydrolase_6 | 1.50 |
PF08378 | NERD | 1.50 |
PF00072 | Response_reg | 0.75 |
PF04984 | Phage_sheath_1 | 0.75 |
PF13561 | adh_short_C2 | 0.75 |
PF08281 | Sigma70_r4_2 | 0.75 |
PF03083 | MtN3_slv | 0.75 |
PF05235 | CHAD | 0.75 |
PF04542 | Sigma70_r2 | 0.75 |
PF13565 | HTH_32 | 0.75 |
PF00665 | rve | 0.75 |
PF02698 | DUF218 | 0.75 |
PF13464 | DUF4115 | 0.75 |
PF01740 | STAS | 0.75 |
PF03372 | Exo_endo_phos | 0.75 |
PF05988 | DUF899 | 0.75 |
PF06146 | PsiE | 0.75 |
PF13808 | DDE_Tnp_1_assoc | 0.75 |
PF13546 | DDE_5 | 0.75 |
PF13560 | HTH_31 | 0.75 |
PF03706 | LPG_synthase_TM | 0.75 |
PF13751 | DDE_Tnp_1_6 | 0.75 |
PF00069 | Pkinase | 0.75 |
PF00391 | PEP-utilizers | 0.75 |
PF02810 | SEC-C | 0.75 |
PF13676 | TIR_2 | 0.75 |
PF08240 | ADH_N | 0.75 |
PF01544 | CorA | 0.75 |
PF03466 | LysR_substrate | 0.75 |
COG ID | Name | Functional Category | % Frequency in 133 Family Scaffolds |
---|---|---|---|
COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 3.01 |
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.01 |
COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 3.01 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 3.01 |
COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 1.50 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.50 |
COG0392 | Predicted membrane flippase AglD2/YbhN, UPF0104 family | Cell wall/membrane/envelope biogenesis [M] | 0.75 |
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.75 |
COG0598 | Mg2+ and Co2+ transporter CorA | Inorganic ion transport and metabolism [P] | 0.75 |
COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.75 |
COG1434 | Lipid carrier protein ElyC involved in cell wall biogenesis, DUF218 family | Cell wall/membrane/envelope biogenesis [M] | 0.75 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.75 |
COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.75 |
COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.75 |
COG2949 | Uncharacterized periplasmic protein SanA, affects membrane permeability for vancomycin | Cell wall/membrane/envelope biogenesis [M] | 0.75 |
COG3025 | Inorganic triphosphatase YgiF, contains CYTH and CHAD domains | Inorganic ion transport and metabolism [P] | 0.75 |
COG3223 | Phosphate starvation-inducible membrane PsiE (function unknown) | General function prediction only [R] | 0.75 |
COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.75 |
COG3497 | Phage tail sheath protein FI | Mobilome: prophages, transposons [X] | 0.75 |
COG4095 | Sugar transporter, SemiSWEET family, contains PQ motif | Carbohydrate transport and metabolism [G] | 0.75 |
COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.75 |
COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.75 |
COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.75 |
COG5607 | CHAD domain, binds inorganic polyphosphates | Function unknown [S] | 0.75 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 58.65 % |
Unclassified | root | N/A | 41.35 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000858|JGI10213J12805_10625177 | Not Available | 959 | Open in IMG/M |
3300003373|JGI25407J50210_10008560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 2581 | Open in IMG/M |
3300003373|JGI25407J50210_10043429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1149 | Open in IMG/M |
3300003373|JGI25407J50210_10047765 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
3300003373|JGI25407J50210_10095196 | Not Available | 736 | Open in IMG/M |
3300004016|Ga0058689_10141428 | Not Available | 547 | Open in IMG/M |
3300004463|Ga0063356_102593369 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
3300005471|Ga0070698_100098356 | All Organisms → cellular organisms → Bacteria | 2900 | Open in IMG/M |
3300005562|Ga0058697_10475078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Blastococcus → unclassified Blastococcus → Blastococcus sp. TF02A-30 | 634 | Open in IMG/M |
3300005937|Ga0081455_10146825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1823 | Open in IMG/M |
3300005981|Ga0081538_10044875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2750 | Open in IMG/M |
3300005981|Ga0081538_10052881 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2422 | Open in IMG/M |
3300005981|Ga0081538_10091380 | All Organisms → cellular organisms → Bacteria | 1572 | Open in IMG/M |
3300005981|Ga0081538_10131426 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1176 | Open in IMG/M |
3300005981|Ga0081538_10365001 | Not Available | 522 | Open in IMG/M |
3300005981|Ga0081538_10375058 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300006844|Ga0075428_101956934 | Not Available | 608 | Open in IMG/M |
3300006845|Ga0075421_100197190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 2494 | Open in IMG/M |
3300009094|Ga0111539_13145364 | Not Available | 532 | Open in IMG/M |
3300009100|Ga0075418_11399802 | Not Available | 759 | Open in IMG/M |
3300009147|Ga0114129_12454405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 624 | Open in IMG/M |
3300009156|Ga0111538_13400743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 553 | Open in IMG/M |
3300009789|Ga0126307_11031407 | Not Available | 665 | Open in IMG/M |
3300009789|Ga0126307_11406616 | Not Available | 565 | Open in IMG/M |
3300009789|Ga0126307_11638474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 523 | Open in IMG/M |
3300009810|Ga0105088_1072327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 608 | Open in IMG/M |
3300009816|Ga0105076_1046654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea lactucae | 782 | Open in IMG/M |
3300009821|Ga0105064_1141852 | Not Available | 514 | Open in IMG/M |
3300009840|Ga0126313_10148879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1766 | Open in IMG/M |
3300009840|Ga0126313_10201856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1526 | Open in IMG/M |
3300009840|Ga0126313_10224110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia | 1451 | Open in IMG/M |
3300009840|Ga0126313_10300507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1255 | Open in IMG/M |
3300009840|Ga0126313_10980198 | Not Available | 692 | Open in IMG/M |
3300009840|Ga0126313_11772601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 516 | Open in IMG/M |
3300010037|Ga0126304_10426679 | Not Available | 887 | Open in IMG/M |
3300010037|Ga0126304_10867031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 613 | Open in IMG/M |
3300010037|Ga0126304_10898483 | Not Available | 602 | Open in IMG/M |
3300010038|Ga0126315_10400904 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella | 862 | Open in IMG/M |
3300010038|Ga0126315_10458248 | Not Available | 808 | Open in IMG/M |
3300010041|Ga0126312_10342521 | Not Available | 1059 | Open in IMG/M |
3300010042|Ga0126314_10038207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 3052 | Open in IMG/M |
3300010045|Ga0126311_10894143 | Not Available | 721 | Open in IMG/M |
3300010045|Ga0126311_11333978 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
3300010045|Ga0126311_11360495 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 591 | Open in IMG/M |
3300010045|Ga0126311_11391615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 585 | Open in IMG/M |
3300010166|Ga0126306_10385589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1094 | Open in IMG/M |
3300010166|Ga0126306_10800277 | Not Available | 760 | Open in IMG/M |
3300010403|Ga0134123_13517495 | Not Available | 507 | Open in IMG/M |
3300012204|Ga0137374_10863458 | Not Available | 667 | Open in IMG/M |
3300012353|Ga0137367_10774561 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
3300012355|Ga0137369_10670394 | Not Available | 715 | Open in IMG/M |
3300012901|Ga0157288_10289302 | Not Available | 568 | Open in IMG/M |
3300013306|Ga0163162_12198119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 633 | Open in IMG/M |
3300013307|Ga0157372_13049560 | Not Available | 535 | Open in IMG/M |
3300014487|Ga0182000_10170075 | Not Available | 807 | Open in IMG/M |
3300017965|Ga0190266_10927862 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
3300018031|Ga0184634_10013519 | All Organisms → cellular organisms → Bacteria | 2959 | Open in IMG/M |
3300018031|Ga0184634_10204983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 898 | Open in IMG/M |
3300018054|Ga0184621_10110117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 980 | Open in IMG/M |
3300018066|Ga0184617_1231229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 553 | Open in IMG/M |
3300018072|Ga0184635_10014379 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2824 | Open in IMG/M |
3300018073|Ga0184624_10122122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1128 | Open in IMG/M |
3300018466|Ga0190268_11017139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Blastococcus → unclassified Blastococcus → Blastococcus sp. TF02A-30 | 662 | Open in IMG/M |
3300019377|Ga0190264_11990896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 532 | Open in IMG/M |
3300019767|Ga0190267_10986172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 589 | Open in IMG/M |
3300026708|Ga0208712_102864 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 655 | Open in IMG/M |
3300027718|Ga0209795_10034832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha → Actinopolymorpha alba | 1622 | Open in IMG/M |
3300027909|Ga0209382_12318221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Blastococcus → unclassified Blastococcus → Blastococcus sp. TF02A-30 | 504 | Open in IMG/M |
3300027909|Ga0209382_12323141 | Not Available | 503 | Open in IMG/M |
3300027952|Ga0209889_1086975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea lactucae | 632 | Open in IMG/M |
3300028596|Ga0247821_10719802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → Frankia torreyi | 653 | Open in IMG/M |
3300028707|Ga0307291_1213668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Blastococcus → unclassified Blastococcus → Blastococcus sp. TF02A-30 | 500 | Open in IMG/M |
3300028711|Ga0307293_10195119 | Not Available | 644 | Open in IMG/M |
3300028712|Ga0307285_10057131 | Not Available | 981 | Open in IMG/M |
3300028718|Ga0307307_10102661 | Not Available | 873 | Open in IMG/M |
3300028720|Ga0307317_10190724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Blastococcus → unclassified Blastococcus → Blastococcus sp. TF02A-30 | 691 | Open in IMG/M |
3300028722|Ga0307319_10114547 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 867 | Open in IMG/M |
3300028722|Ga0307319_10181554 | Not Available | 686 | Open in IMG/M |
3300028771|Ga0307320_10216545 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 751 | Open in IMG/M |
3300028784|Ga0307282_10280612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 802 | Open in IMG/M |
3300028791|Ga0307290_10100739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1053 | Open in IMG/M |
3300028791|Ga0307290_10221042 | Not Available | 694 | Open in IMG/M |
3300028810|Ga0307294_10414129 | Not Available | 509 | Open in IMG/M |
3300028811|Ga0307292_10266020 | Not Available | 714 | Open in IMG/M |
3300028812|Ga0247825_11234991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 546 | Open in IMG/M |
3300028819|Ga0307296_10035888 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2618 | Open in IMG/M |
3300028824|Ga0307310_10385118 | Not Available | 694 | Open in IMG/M |
3300028876|Ga0307286_10017077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2303 | Open in IMG/M |
3300028876|Ga0307286_10035184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1665 | Open in IMG/M |
3300028876|Ga0307286_10391564 | Not Available | 520 | Open in IMG/M |
3300028878|Ga0307278_10007362 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5210 | Open in IMG/M |
3300028880|Ga0307300_10297832 | Not Available | 545 | Open in IMG/M |
3300030499|Ga0268259_10087786 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes ianthinogenes | 682 | Open in IMG/M |
3300031548|Ga0307408_100129636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 1966 | Open in IMG/M |
3300031548|Ga0307408_100835225 | Not Available | 839 | Open in IMG/M |
3300031548|Ga0307408_102422118 | Not Available | 510 | Open in IMG/M |
3300031731|Ga0307405_10134162 | Not Available | 1716 | Open in IMG/M |
3300031731|Ga0307405_10151737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1630 | Open in IMG/M |
3300031731|Ga0307405_11201433 | Not Available | 656 | Open in IMG/M |
3300031731|Ga0307405_11787314 | Not Available | 546 | Open in IMG/M |
3300031824|Ga0307413_10514574 | Not Available | 964 | Open in IMG/M |
3300031824|Ga0307413_11096605 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 687 | Open in IMG/M |
3300031824|Ga0307413_11851751 | Not Available | 541 | Open in IMG/M |
3300031852|Ga0307410_10504249 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 996 | Open in IMG/M |
3300031852|Ga0307410_12006895 | Not Available | 516 | Open in IMG/M |
3300031901|Ga0307406_10204085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1457 | Open in IMG/M |
3300031901|Ga0307406_10329716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1184 | Open in IMG/M |
3300031901|Ga0307406_10934130 | Not Available | 740 | Open in IMG/M |
3300031901|Ga0307406_12055471 | Not Available | 511 | Open in IMG/M |
3300031903|Ga0307407_10767536 | Not Available | 731 | Open in IMG/M |
3300031903|Ga0307407_10827746 | Not Available | 706 | Open in IMG/M |
3300031903|Ga0307407_11466598 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
3300031903|Ga0307407_11515062 | Not Available | 531 | Open in IMG/M |
3300031911|Ga0307412_11227077 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
3300031995|Ga0307409_100024107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4235 | Open in IMG/M |
3300031995|Ga0307409_100291811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1513 | Open in IMG/M |
3300032002|Ga0307416_100098498 | Not Available | 2536 | Open in IMG/M |
3300032002|Ga0307416_100362985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1471 | Open in IMG/M |
3300032002|Ga0307416_102509024 | Not Available | 614 | Open in IMG/M |
3300032002|Ga0307416_102514987 | Not Available | 613 | Open in IMG/M |
3300032002|Ga0307416_102942319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 570 | Open in IMG/M |
3300032002|Ga0307416_103362827 | Not Available | 535 | Open in IMG/M |
3300032002|Ga0307416_103637515 | Not Available | 516 | Open in IMG/M |
3300032004|Ga0307414_11938121 | Not Available | 550 | Open in IMG/M |
3300032005|Ga0307411_10031035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3283 | Open in IMG/M |
3300032126|Ga0307415_100012204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Aeromicrobium | 4960 | Open in IMG/M |
3300032126|Ga0307415_100323969 | All Organisms → cellular organisms → Bacteria | 1286 | Open in IMG/M |
3300032126|Ga0307415_102277833 | Not Available | 531 | Open in IMG/M |
3300032159|Ga0268251_10313190 | Not Available | 655 | Open in IMG/M |
3300033550|Ga0247829_11320109 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
3300033551|Ga0247830_10792974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Blastococcus → unclassified Blastococcus → Blastococcus sp. TF02A-30 | 753 | Open in IMG/M |
3300034172|Ga0334913_096732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 624 | Open in IMG/M |
3300034174|Ga0334932_045576 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 26.32% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 18.80% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 16.54% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 7.52% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.02% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.51% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.01% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 3.01% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.26% |
Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 2.26% |
Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 1.50% |
Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 1.50% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.75% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.75% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.75% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.75% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.75% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.75% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.75% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.75% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.75% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
3300004016 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz | Host-Associated | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
3300009810 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 | Environmental | Open in IMG/M |
3300009816 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 | Environmental | Open in IMG/M |
3300009821 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 | Environmental | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1 | Environmental | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
3300026708 | Grasslands soil microbial communities from Gorham, Kansas, USA that are Nitrogen fertilized -NN628 (SPAdes) | Environmental | Open in IMG/M |
3300027718 | Agave microbial communities from Guanajuato, Mexico - Or.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300027952 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 (SPAdes) | Environmental | Open in IMG/M |
3300028596 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14 | Environmental | Open in IMG/M |
3300028707 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148 | Environmental | Open in IMG/M |
3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
3300030499 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (v2) | Host-Associated | Open in IMG/M |
3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
3300032159 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2) | Host-Associated | Open in IMG/M |
3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
3300034172 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 9HMS | Environmental | Open in IMG/M |
3300034174 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 28HNS | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI10213J12805_106251774 | 3300000858 | Soil | MDGVSMVPARRLPSMLRELPVVLGLERVAALADRCPGQR |
JGI25407J50210_100085604 | 3300003373 | Tabebuia Heterophylla Rhizosphere | QGVPVVSARRLPSMLRTLPAVLGPERVAALAHQARIRFPAAA* |
JGI25407J50210_100434291 | 3300003373 | Tabebuia Heterophylla Rhizosphere | PWGKVVMNGVPVVAARGLPSMLRALPAVVGPERVAWLADQARVRFHAAA* |
JGI25407J50210_100477652 | 3300003373 | Tabebuia Heterophylla Rhizosphere | MDGVPVVAAPRLPSMLRQFPPVLGPERLIGLANQARVRFHAAA* |
JGI25407J50210_100951962 | 3300003373 | Tabebuia Heterophylla Rhizosphere | MDGVPVMAARRLPSILRELPAVLGPERVAALADQARVRFHAAA* |
Ga0058689_101414282 | 3300004016 | Agave | ARLLIARPWGKLIVDGVRVVPAGRLPSMLRHLPAVLGPGRTAELAERARTRFHPAA* |
Ga0063356_1025933692 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MAPRSPGQGVTDGVPVVSARRLPSMLRALPAVLGLERVAWLADQAQVRFRAAA* |
Ga0070698_1000983562 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MDGIPVALARRLPSMLRALPAVLGPEWVAHLADQARVRFHAAA* |
Ga0058697_104750781 | 3300005562 | Agave | KVVADGVPVVAARRLPSMLRQLPAVLGPERVANLAAQARIRFHAAA* |
Ga0081455_101468253 | 3300005937 | Tabebuia Heterophylla Rhizosphere | AARRLPSMLRVLPAVLGPERVAVLADQARVYFHAAA* |
Ga0081538_100448752 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MNGVPVVAARGLPSMLRALPAVVGPERVAWLADLARVRLHAAA* |
Ga0081538_100528812 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MNGMPVVAVRGLRSMLRTLPAVVGPEWVAWLADLARIRFHAAA* |
Ga0081538_100913801 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MAPNPWGKVVTQGVPVVAARRLPSMLRALPAVLAPGRVAVLADQARVRFHAAT* |
Ga0081538_101314261 | 3300005981 | Tabebuia Heterophylla Rhizosphere | VMNGVPVVAARRLPSMLRQLPAVLGPERVAWLADQARVRFDAAA* |
Ga0081538_103650012 | 3300005981 | Tabebuia Heterophylla Rhizosphere | GKVVMNGVPVVAARGLPSMLRALSAVVGPEWVAWLADLARVRLHAAA* |
Ga0081538_103750581 | 3300005981 | Tabebuia Heterophylla Rhizosphere | PWGKVVVDGVPVVPARRLPSMLRALPGVLGPERVANLADRARVRFHPAA* |
Ga0075428_1019569341 | 3300006844 | Populus Rhizosphere | PWGKVVTNGVPVLAARRLPSMLRNLPAVLGPERVTTLADQARIRFRAAA* |
Ga0075421_1001971901 | 3300006845 | Populus Rhizosphere | RRLPSMLRQLPAVLGPERVAWLADQARIRFHAAA* |
Ga0111539_131453641 | 3300009094 | Populus Rhizosphere | WGKVVTDGVPVVSAQRLPSMLRGLPAVLGPERVAWLADQARVSFHAAG* |
Ga0075418_113998022 | 3300009100 | Populus Rhizosphere | KVVVRGIPVVSARRLPSMLRALPALLGPERVADLAVQVRVRFHAAA* |
Ga0114129_124544051 | 3300009147 | Populus Rhizosphere | AKRLPSMLCALPAVLGPERVAVLADQARVRFHAAA* |
Ga0111538_134007432 | 3300009156 | Populus Rhizosphere | PWDKVVIHGVPVVSARRLPSMLRALPVVLGPERVAALADQARVRFHAAAEPHP* |
Ga0126307_110314072 | 3300009789 | Serpentine Soil | ARRLPSMLRQLPMVLGPERVAEVANQARIRFRAAA* |
Ga0126307_114066162 | 3300009789 | Serpentine Soil | RRLPSMLRQLPAVLRPEQVAAVANQARVRFHAAA* |
Ga0126307_116384742 | 3300009789 | Serpentine Soil | DGVPVVSARRLPSMLRQLPVVLGSERVAWLADHARVRFHAAG* |
Ga0105088_10723271 | 3300009810 | Groundwater Sand | QVPWGKVVMQGVPVVAARRLPSMLRSLPAVLGPERVAVLADQARVRFHAAA* |
Ga0105076_10466541 | 3300009816 | Groundwater Sand | QVPWGKVVVNGVPVVAARRLPSMLRQLPAVLGPERVAALAAQARVRFHASG* |
Ga0105064_11418521 | 3300009821 | Groundwater Sand | EGVPVVPAGRLPSMLRQLPAVLGPERIAVLANQARIRFRAAA* |
Ga0126313_101488794 | 3300009840 | Serpentine Soil | MDGVPVVSARRLPRMLRALPVVLGPERVADLADRARVRFRAAA* |
Ga0126313_102018562 | 3300009840 | Serpentine Soil | LGKVVIDGVPVVSARRLPSMLGQLPVVLGPERVTWLADQARVRFHAAG* |
Ga0126313_102241102 | 3300009840 | Serpentine Soil | VSARRLPSMLRQLPVVLRPERVAWLADQARVRFHAAG* |
Ga0126313_103005072 | 3300009840 | Serpentine Soil | SARRLPSLLCQLPAVLGPERVAWLADQARVRFHAAA* |
Ga0126313_109801981 | 3300009840 | Serpentine Soil | VQGVPVVPARRLPSMLRQLPTVLGPERVTGLADQARIRFHAAA* |
Ga0126313_117726011 | 3300009840 | Serpentine Soil | VEGVPVVTARRLPSMLRQLPAVLGPERVAWQADQARIRFHPAA* |
Ga0126304_104266792 | 3300010037 | Serpentine Soil | IPVVPARRLPSMLRALPALLGPERIAALADQARVRFHAAA* |
Ga0126304_108670312 | 3300010037 | Serpentine Soil | VADGVPVVAARRLPSMLGQLPAVLGPERVAGLAAQARIRFHAAA* |
Ga0126304_108984831 | 3300010037 | Serpentine Soil | KVVMDGVPVVPARRLPSMLRELPAVLGPERVAAVANQARTRFRAAA* |
Ga0126315_104009042 | 3300010038 | Serpentine Soil | VVNGVPVVAARRLRSMLRSLPAVLSPERVAALADQVRIGFHPAA* |
Ga0126315_104582481 | 3300010038 | Serpentine Soil | KVVVEGVPVVLARRLPSMLRALPGVLGPERVAALAHQARIRFRAAA* |
Ga0126312_103425211 | 3300010041 | Serpentine Soil | RRLPSLLRQLPAVLGPERVAWLADQARVRFHAPA* |
Ga0126314_100382073 | 3300010042 | Serpentine Soil | PWGKVVMDGVRVVTARRLPSMLRQLPVVLGPKRVAWLADQARVRFHAAG* |
Ga0126311_108941432 | 3300010045 | Serpentine Soil | MDGVPVVAARRLPSMLRQLPTVLGPERVAGLADQARLRFHAAA* |
Ga0126311_113339781 | 3300010045 | Serpentine Soil | RRLPSMLRALPLVLGPERVAWLADQARIRFRPAA* |
Ga0126311_113604951 | 3300010045 | Serpentine Soil | VPWGKVVVEGVPVVAARRLPSMLRALPPLLGPERITAVADQARVRFHTAA* |
Ga0126311_113916152 | 3300010045 | Serpentine Soil | VTQGVPVVAAKRLPSMLRALPAVLGPERVTGLADQARIRFRAAA* |
Ga0126306_103855892 | 3300010166 | Serpentine Soil | ARRLPSMLGQLPAVLGPERVANLADQARVRFQAAAQWLY* |
Ga0126306_108002772 | 3300010166 | Serpentine Soil | MDGVPVVPARRLPSMLGELPAVLGPERVAILADQARVRFHAAA* |
Ga0134123_135174951 | 3300010403 | Terrestrial Soil | VLPARRLPSMLGARPAVLGPEQVAAVASQARIRFRAAA* |
Ga0137374_108634582 | 3300012204 | Vadose Zone Soil | KLVVEGVPVVPARRLPSMLRALPTVLAPERVAGLADQARIRFHPAA* |
Ga0137367_107745611 | 3300012353 | Vadose Zone Soil | QVPWGKLVVNGVPVVTARRLLGLLRGLPAVLGPERVAALADAARVRFHAAA* |
Ga0137369_106703941 | 3300012355 | Vadose Zone Soil | WGKLVVDGVPVVSARRLPGLLRHLPAVLGPERVAGLANRGRVCFHAAA* |
Ga0157288_102893021 | 3300012901 | Soil | MGVQVVAARRLPSMLRQLPAVLGSERVAGLTDQARIRFHAAA* |
Ga0163162_121981192 | 3300013306 | Switchgrass Rhizosphere | VVMDGVPVVSARRLPSMLCALPEVLGPEWVAALADQGRIRLHPAA* |
Ga0157372_130495601 | 3300013307 | Corn Rhizosphere | WGKVVTRGVPVVAAKRLPSMLRQLPAVLGPEQVANLAAQARVRFHPAAKTKRL* |
Ga0182000_101700751 | 3300014487 | Soil | PRGKVVIKGIPVVAAQRLPNMLRQLPAVLGPERVAGLADQARVRFHAAA* |
Ga0190266_109278622 | 3300017965 | Soil | SARRLPSLLGALPLVLAPERVAGLANQARIRFHPAA |
Ga0184634_100135195 | 3300018031 | Groundwater Sediment | VVTQGVPVVSARRLPSMLRTLPAVLGPERVAALADRARVRFRAAA |
Ga0184634_102049831 | 3300018031 | Groundwater Sediment | NGVPVVAARRLPSMLRQLPAVLGPERVAALATQARVGFHTAG |
Ga0184621_101101171 | 3300018054 | Groundwater Sediment | MDGVPVVSARRLPSMLRTLPAVLGPERVAALADQARVRFRAA |
Ga0184617_12312292 | 3300018066 | Groundwater Sediment | GKVVTDGVPLVTARRLPSLLGGLPPMLGPERVANLADQARVRFRAAA |
Ga0184635_100143794 | 3300018072 | Groundwater Sediment | SMAPGPWGKVVMDGVPVVAATRLPSLLRGLPAVLGPERVAGLADRARVRFHAAA |
Ga0184624_101221222 | 3300018073 | Groundwater Sediment | MDGVPVVAATRLPSLLRGLPAVLGPERVAGLADRARVRFHAAA |
Ga0190268_110171392 | 3300018466 | Soil | QVPWGKVVMDGVPVVSARRLPSMLGQLPAVLGPERVAALADQARVRFHAAA |
Ga0190264_119908962 | 3300019377 | Soil | IDGVPVVAARRLPGMLRELPVVLGPERVADLANQARVRFHAAA |
Ga0190267_109861722 | 3300019767 | Soil | WGKVVTDGVPVVAARRLPSMLRALPAVLGPERVAWLADQARVRFHPAS |
Ga0208712_1028642 | 3300026708 | Soil | MSGVPVVPARRLPSMLCELPAVLGPERVAVLADQAR |
Ga0209795_100348321 | 3300027718 | Agave | YGRCAVVAARRLPSMLRALPAVLGPERVATLADQARIGFHPAA |
Ga0209382_123182211 | 3300027909 | Populus Rhizosphere | QVPWGKVVVRGVPVVPARQLPSMLRQLPAVLGPERVAILADQARVRFHAAA |
Ga0209382_123231411 | 3300027909 | Populus Rhizosphere | AQVPWGKVVIDGVPVVPARRLPSMLRQLPAVLGPERVAWLADQARIRFHAAA |
Ga0209889_10869752 | 3300027952 | Groundwater Sand | QVPWGKVVVNGVPVVAARRLPSMLRQLPAVLGPERVAALAAQARVRFHASG |
Ga0247821_107198021 | 3300028596 | Soil | VVAAKRLPSMLRHLPAVLGPERVAVLADQARVRFHAAA |
Ga0307291_12136682 | 3300028707 | Soil | GVPVVSARRLPSMLRALPAVLGPERVAVLADQARVRFHAAA |
Ga0307293_101951192 | 3300028711 | Soil | VPVVSARRLPSMLRQLPAMLGPERVAWLADQARVRFHAAA |
Ga0307285_100571313 | 3300028712 | Soil | GKMVTQCVPVVSARRLPSMLRALPGVLGPERVAAVAHQARIRFRAAA |
Ga0307307_101026611 | 3300028718 | Soil | GVPVLAVRRLPSMLGSLPAVLGPERVTALADQARIRFRAAA |
Ga0307317_101907241 | 3300028720 | Soil | VMDGVPVVSARRLPSMLRALPAVLGPERVAVLADQARVRFHAAA |
Ga0307319_101145471 | 3300028722 | Soil | TNGVPVLAARRLPSMLRQFPVALGSERVAWLTDRARLRFHAAA |
Ga0307319_101815541 | 3300028722 | Soil | VVSARRLPSMLRALPAVLGPERVAALAHQARIRFRAAA |
Ga0307320_102165452 | 3300028771 | Soil | PWGKVVMDGVPVVAARRLPSMLCALPAVLGPERVAGLTDQARIRFRAAA |
Ga0307282_102806121 | 3300028784 | Soil | VVPASRLPSMLRQLPAMLGPERVAGLADQARVRFHAAA |
Ga0307290_101007391 | 3300028791 | Soil | ARRLPSMLRQLPAMLGPERVAWLADQARVRFHAAA |
Ga0307290_102210421 | 3300028791 | Soil | VPWGKVVVDGIPVVSARRLPSMLRQLPAVLGPERVAAIASQARIRFRTAA |
Ga0307294_104141292 | 3300028810 | Soil | LVVAARRLPSMLRALPPVLGPERVAWLADQARIRFHPAA |
Ga0307292_102660201 | 3300028811 | Soil | VDGIPVVSARRLPSMLRQLPAVLGPERVAAIASQARIRFRTAA |
Ga0247825_112349911 | 3300028812 | Soil | VPVPWGKVVTDGVPVVAARRLPSMLRALPAVLGPERVAWLADQARVRFHPAS |
Ga0307296_100358882 | 3300028819 | Soil | MAPGPWGKFVMDGVPVVAATRLPSLLRGLPAVLGPERVAGLADQARVRFHAAA |
Ga0307310_103851181 | 3300028824 | Soil | RWVTNGVPVLAVRRLPSMLGSLPAVLGPERVTALADQARIRFRAAA |
Ga0307286_100170771 | 3300028876 | Soil | VIDGVPVLPAKRLPSMLRELPAVLGPERVAVLADQARIHFYAAA |
Ga0307286_100351843 | 3300028876 | Soil | TQGVPVVSARRLPSMLRQLPAMLGPERVAWLADQARVRFHAAA |
Ga0307286_103915641 | 3300028876 | Soil | MAPGPWGKVVMDGVPVVAATRLPSLLRGLPAVLGPERVAGLADRARVRFHAAA |
Ga0307278_100073623 | 3300028878 | Soil | VPVVAARRLPELLRRLPATLGPERVAGLANAARIRFLASA |
Ga0307300_102978321 | 3300028880 | Soil | VVPARRLPSMLRQLPAVLGPERVAGVASEARIRFRAAA |
Ga0268259_100877862 | 3300030499 | Agave | AARRLASMLRALPAVLGPERVAELADRARVRFHPAA |
Ga0307408_1001296364 | 3300031548 | Rhizosphere | MDGIPVVPAKRLPSMLLALPTVLGPERVAELADQARVRFHAAA |
Ga0307408_1008352251 | 3300031548 | Rhizosphere | KVVVQGVPVVPARRLPSMLRQLPTVLGPERVAWLADQARIRFHAAA |
Ga0307408_1024221181 | 3300031548 | Rhizosphere | KVVVQGVPVVPARRLPSMLRQLPAVLGPERVAVLADQARVRFHAAA |
Ga0307405_101341621 | 3300031731 | Rhizosphere | VVGGVPVVTARRLPSMLRQLPMVLGPERVAEVANQARIRFRGAA |
Ga0307405_101517371 | 3300031731 | Rhizosphere | DGVPVVSARRLPSMLRQLPVVLGPERVAWLADQARVRFHAAG |
Ga0307405_112014331 | 3300031731 | Rhizosphere | VAARRLPSMLRALPAVLGPERVADLADQARVRFHAAA |
Ga0307405_117873141 | 3300031731 | Rhizosphere | VVPARRLPSMLRQLPTVLGPERVTGLADQARIRFHAAA |
Ga0307413_105145741 | 3300031824 | Rhizosphere | VGVPVVAARRLPSMLRQLPAVLGPERVAALAHQARIRFHAAA |
Ga0307413_110966051 | 3300031824 | Rhizosphere | PWGKVVIDGVPVVSARRLPSMLGQLPVVLGPERVGWLADQARIRFRAAA |
Ga0307413_118517512 | 3300031824 | Rhizosphere | IVPAKRLPSMLLALPTVLGPERVAELANEARVRLHAAA |
Ga0307410_105042491 | 3300031852 | Rhizosphere | VVVEGIPVVPARRLPSMLRALPALLGPERIAALADQARVRFHAAA |
Ga0307410_120068951 | 3300031852 | Rhizosphere | MPIVPARRLPSMLRQLPAVLGPERVANLADQARVRFNAAD |
Ga0307406_102040853 | 3300031901 | Rhizosphere | VPAVSARRLPSMLRQLPVVLAPERVAALADQARIRFHPAA |
Ga0307406_103297161 | 3300031901 | Rhizosphere | MDGAPIVPAKRLPSMLLALPTVLGPERVAELANEARVRLHAAA |
Ga0307406_109341301 | 3300031901 | Rhizosphere | VVIDGVPVVSARRLPSMLGQLPVVLGPERVGWLADQARIRFHAAG |
Ga0307406_120554711 | 3300031901 | Rhizosphere | VPVVAARRLPSMLRALPAVLGPERVADLADQARIRFHAAA |
Ga0307407_107675361 | 3300031903 | Rhizosphere | KVVTKGVPVVAARRLPSMLRALPAVLGPERVAGLADQARVRFHAAA |
Ga0307407_108277462 | 3300031903 | Rhizosphere | MDGIPVVPAWRLPSMLRTLPAVLGPERVAGLTDQARVRFHA |
Ga0307407_114665981 | 3300031903 | Rhizosphere | GKVVVEGVPVVPARRLPSMLRHLPAVLGREQVAALASQARIRFRAAA |
Ga0307407_115150621 | 3300031903 | Rhizosphere | VVAARRLPRMLRQLPTVLGPERVTGLADQARIRFHPAA |
Ga0307412_112270771 | 3300031911 | Rhizosphere | GVPVVTARRLPSMLRALPLVLGPEQVAWLADQARIRFHPAA |
Ga0307409_1000241074 | 3300031995 | Rhizosphere | WGRVVVGGVPVVTARRLPSMLRQLPMVLGPERVAEVANQARICFRAAA |
Ga0307409_1002918111 | 3300031995 | Rhizosphere | VAEGVPVVAARRLPSMLRGLPAVLGPERVASLADQARVRFHAAP |
Ga0307416_1000984981 | 3300032002 | Rhizosphere | VPVVSARRLPSMLGQLPVVLGPERVGWLADQARIRFHAAG |
Ga0307416_1003629852 | 3300032002 | Rhizosphere | ARRLPSMLRQLPVLLGPERVAGLTDQARIRFHAAG |
Ga0307416_1025090241 | 3300032002 | Rhizosphere | VPVVAARRLPSMLCQLPAVLGPERVAWLADQARVRFHAAA |
Ga0307416_1025149871 | 3300032002 | Rhizosphere | QVPWGKVVMVGVPVVAARRLPSMLRQLPAVLGPERVAALAHQARIRFHAAA |
Ga0307416_1029423192 | 3300032002 | Rhizosphere | QGVPVVSARRLPSMLRALPAVLGPERVAGLADRARLRFRPAA |
Ga0307416_1033628271 | 3300032002 | Rhizosphere | PAKRLPDMLRQLPAVLGPERVAWLADQARLRFHAAA |
Ga0307416_1036375151 | 3300032002 | Rhizosphere | VPWGKVVVDGVPVVAAQRLPSRLLALPAVLGPERVAWLADQARVSFHAAG |
Ga0307414_119381212 | 3300032004 | Rhizosphere | RLPSMLRQLPVVLGPERVAWLADQARVRFHAAGNR |
Ga0307411_100310351 | 3300032005 | Rhizosphere | GVPVLAARRLPRMLRALPAVLGPEWVAGLADQARVRFHATA |
Ga0307415_1000122041 | 3300032126 | Rhizosphere | PWGKVVIDGVPVVSARRLPSMLGQLPVVLGPERVGWLADQARIRFHAAG |
Ga0307415_1003239693 | 3300032126 | Rhizosphere | VAARRLPSMLRQLPAVFGPERVTALANQARIRFHAAA |
Ga0307415_1022778331 | 3300032126 | Rhizosphere | PWGKVVMDGVPVVAARRLPRLLRQLPAVLGPERVADLADQARVRFHAAA |
Ga0268251_103131901 | 3300032159 | Agave | VDGVRVVMARRLPSMLRQLPVVLGPEWVAWLADQARVRFQAAG |
Ga0247829_113201092 | 3300033550 | Soil | MDGVPVVSARRLPSMLRQLPAVLGPERVSAVANQARIRFHAAG |
Ga0247830_107929741 | 3300033551 | Soil | VPVVPARQLPSMLRQLPAVLGPERVAILADQARVRFHAAA |
Ga0334913_096732_3_149 | 3300034172 | Sub-Biocrust Soil | GGKVVTQGVPVVAAKRLPSMLRQLPAVLGPGRVAWLADQARIRFHAAA |
Ga0334932_045576_17_148 | 3300034174 | Sub-Biocrust Soil | MEGVPVVAARHLPSMLRQLPAVLGPERVAVLADQARVRFHAAA |
⦗Top⦘ |