Basic Information | |
---|---|
Family ID | F060190 |
Family Type | Metagenome |
Number of Sequences | 133 |
Average Sequence Length | 50 residues |
Representative Sequence | MKHPPTLAPLAAPRGAGQSVGAALPDWDEHPPTLAPLAAPRGAGQSVGAALPD |
Number of Associated Samples | 90 |
Number of Associated Scaffolds | 133 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 58.65 % |
% of genes near scaffold ends (potentially truncated) | 73.68 % |
% of genes from short scaffolds (< 2000 bps) | 77.44 % |
Associated GOLD sequencing projects | 69 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.15 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (86.466 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere (17.293 % of family members) |
Environment Ontology (ENVO) | Unclassified (52.632 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (90.977 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.15 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 133 Family Scaffolds |
---|---|---|
PF13247 | Fer4_11 | 9.77 |
PF02674 | Colicin_V | 6.02 |
PF01593 | Amino_oxidase | 5.26 |
PF03916 | NrfD | 5.26 |
PF00072 | Response_reg | 3.01 |
PF01578 | Cytochrom_C_asm | 3.01 |
PF12804 | NTP_transf_3 | 3.01 |
PF03328 | HpcH_HpaI | 3.01 |
PF14572 | Pribosyl_synth | 2.26 |
PF01435 | Peptidase_M48 | 2.26 |
PF00005 | ABC_tran | 2.26 |
PF03918 | CcmH | 2.26 |
PF16327 | CcmF_C | 1.50 |
PF00211 | Guanylate_cyc | 1.50 |
PF00378 | ECH_1 | 1.50 |
PF00528 | BPD_transp_1 | 1.50 |
PF08534 | Redoxin | 1.50 |
PF02518 | HATPase_c | 1.50 |
PF13531 | SBP_bac_11 | 1.50 |
PF00490 | ALAD | 1.50 |
PF08811 | DUF1800 | 0.75 |
PF07729 | FCD | 0.75 |
PF03950 | tRNA-synt_1c_C | 0.75 |
PF13662 | Toprim_4 | 0.75 |
PF01063 | Aminotran_4 | 0.75 |
PF13561 | adh_short_C2 | 0.75 |
PF09678 | Caa3_CtaG | 0.75 |
PF04552 | Sigma54_DBD | 0.75 |
PF08281 | Sigma70_r4_2 | 0.75 |
PF01569 | PAP2 | 0.75 |
PF12399 | BCA_ABC_TP_C | 0.75 |
PF02423 | OCD_Mu_crystall | 0.75 |
PF05598 | DUF772 | 0.75 |
PF01041 | DegT_DnrJ_EryC1 | 0.75 |
PF00310 | GATase_2 | 0.75 |
PF01627 | Hpt | 0.75 |
PF04166 | PdxA | 0.75 |
PF00535 | Glycos_transf_2 | 0.75 |
PF02698 | DUF218 | 0.75 |
PF01406 | tRNA-synt_1e | 0.75 |
PF00359 | PTS_EIIA_2 | 0.75 |
PF14559 | TPR_19 | 0.75 |
PF02826 | 2-Hacid_dh_C | 0.75 |
PF00113 | Enolase_C | 0.75 |
PF02634 | FdhD-NarQ | 0.75 |
PF02515 | CoA_transf_3 | 0.75 |
PF13522 | GATase_6 | 0.75 |
PF01594 | AI-2E_transport | 0.75 |
PF01970 | TctA | 0.75 |
PF00893 | Multi_Drug_Res | 0.75 |
PF13751 | DDE_Tnp_1_6 | 0.75 |
PF07475 | Hpr_kinase_C | 0.75 |
PF10387 | DUF2442 | 0.75 |
PF02403 | Seryl_tRNA_N | 0.75 |
PF13147 | Obsolete Pfam Family | 0.75 |
PF12911 | OppC_N | 0.75 |
PF00905 | Transpeptidase | 0.75 |
PF12838 | Fer4_7 | 0.75 |
PF14537 | Cytochrom_c3_2 | 0.75 |
PF00291 | PALP | 0.75 |
PF07690 | MFS_1 | 0.75 |
PF02603 | Hpr_kinase_N | 0.75 |
PF02482 | Ribosomal_S30AE | 0.75 |
PF14378 | PAP2_3 | 0.75 |
PF00347 | Ribosomal_L6 | 0.75 |
PF03401 | TctC | 0.75 |
COG ID | Name | Functional Category | % Frequency in 133 Family Scaffolds |
---|---|---|---|
COG1286 | Colicin V production accessory protein CvpA, regulator of purF expression and biofilm formation | Cell wall/membrane/envelope biogenesis [M] | 6.02 |
COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 3.01 |
COG2301 | Citrate lyase beta subunit | Carbohydrate transport and metabolism [G] | 3.01 |
COG3836 | 2-keto-3-deoxy-L-rhamnonate aldolase RhmA | Carbohydrate transport and metabolism [G] | 3.01 |
COG3088 | Cytochrome c-type biogenesis protein CcmH/NrfF | Posttranslational modification, protein turnover, chaperones [O] | 2.26 |
COG0113 | Delta-aminolevulinic acid dehydratase, porphobilinogen synthase | Coenzyme transport and metabolism [H] | 1.50 |
COG0115 | Branched-chain amino acid aminotransferase/4-amino-4-deoxychorismate lyase | Amino acid transport and metabolism [E] | 1.50 |
COG1493 | Serine kinase of the HPr protein, regulates carbohydrate metabolism | Signal transduction mechanisms [T] | 1.50 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 1.50 |
COG0008 | Glutamyl- or glutaminyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.75 |
COG0018 | Arginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.75 |
COG0097 | Ribosomal protein L6P/L9E | Translation, ribosomal structure and biogenesis [J] | 0.75 |
COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.75 |
COG0148 | Enolase | Carbohydrate transport and metabolism [G] | 0.75 |
COG0172 | Seryl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.75 |
COG0215 | Cysteinyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.75 |
COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.75 |
COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.75 |
COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.75 |
COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.75 |
COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.75 |
COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.75 |
COG1434 | Lipid carrier protein ElyC involved in cell wall biogenesis, DUF218 family | Cell wall/membrane/envelope biogenesis [M] | 0.75 |
COG1508 | DNA-directed RNA polymerase specialized sigma subunit, sigma54 homolog | Transcription [K] | 0.75 |
COG1526 | Formate dehydrogenase assembly factor FdhD, a sulfurtransferase | Energy production and conversion [C] | 0.75 |
COG1544 | Ribosome-associated translation inhibitor RaiA | Translation, ribosomal structure and biogenesis [J] | 0.75 |
COG1784 | TctA family transporter | General function prediction only [R] | 0.75 |
COG1802 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 0.75 |
COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.75 |
COG1995 | 4-hydroxy-L-threonine phosphate dehydrogenase PdxA | Coenzyme transport and metabolism [H] | 0.75 |
COG2076 | Multidrug transporter EmrE and related cation transporters | Defense mechanisms [V] | 0.75 |
COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 0.75 |
COG2423 | Ornithine cyclodeaminase/archaeal alanine dehydrogenase, mu-crystallin family | Amino acid transport and metabolism [E] | 0.75 |
COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.75 |
COG2949 | Uncharacterized periplasmic protein SanA, affects membrane permeability for vancomycin | Cell wall/membrane/envelope biogenesis [M] | 0.75 |
COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.75 |
COG3333 | TctA family transporter | General function prediction only [R] | 0.75 |
COG5267 | Uncharacterized conserved protein, DUF1800 family | Function unknown [S] | 0.75 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 87.22 % |
Unclassified | root | N/A | 12.78 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300005290|Ga0065712_10643271 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300005293|Ga0065715_10260624 | All Organisms → cellular organisms → Bacteria | 1139 | Open in IMG/M |
3300005327|Ga0070658_10076468 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2745 | Open in IMG/M |
3300005327|Ga0070658_10179067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1783 | Open in IMG/M |
3300005327|Ga0070658_10271390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium mesophilicum | 1443 | Open in IMG/M |
3300005327|Ga0070658_11006553 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 725 | Open in IMG/M |
3300005328|Ga0070676_10001786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 10960 | Open in IMG/M |
3300005328|Ga0070676_10614136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 785 | Open in IMG/M |
3300005329|Ga0070683_100004586 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 11405 | Open in IMG/M |
3300005329|Ga0070683_100193512 | Not Available | 1931 | Open in IMG/M |
3300005329|Ga0070683_100862229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 868 | Open in IMG/M |
3300005331|Ga0070670_100003749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 12653 | Open in IMG/M |
3300005334|Ga0068869_100110631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2089 | Open in IMG/M |
3300005336|Ga0070680_100233896 | All Organisms → cellular organisms → Bacteria | 1552 | Open in IMG/M |
3300005336|Ga0070680_100286366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. URHB0020 | 1396 | Open in IMG/M |
3300005336|Ga0070680_100391733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1184 | Open in IMG/M |
3300005336|Ga0070680_100505203 | Not Available | 1034 | Open in IMG/M |
3300005336|Ga0070680_100745009 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
3300005336|Ga0070680_100980595 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 730 | Open in IMG/M |
3300005337|Ga0070682_100044488 | All Organisms → cellular organisms → Bacteria | 2749 | Open in IMG/M |
3300005337|Ga0070682_101354996 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 607 | Open in IMG/M |
3300005338|Ga0068868_100573592 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 997 | Open in IMG/M |
3300005339|Ga0070660_100020919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 4816 | Open in IMG/M |
3300005339|Ga0070660_100052646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3138 | Open in IMG/M |
3300005339|Ga0070660_100208574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1586 | Open in IMG/M |
3300005339|Ga0070660_100374211 | All Organisms → cellular organisms → Bacteria | 1175 | Open in IMG/M |
3300005339|Ga0070660_100397193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 1140 | Open in IMG/M |
3300005340|Ga0070689_100368870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1208 | Open in IMG/M |
3300005344|Ga0070661_100137041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Noviherbaspirillum → Noviherbaspirillum massiliense | 1842 | Open in IMG/M |
3300005344|Ga0070661_100525290 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 950 | Open in IMG/M |
3300005344|Ga0070661_100839438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 755 | Open in IMG/M |
3300005344|Ga0070661_101351512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 598 | Open in IMG/M |
3300005345|Ga0070692_10073795 | All Organisms → cellular organisms → Bacteria | 1823 | Open in IMG/M |
3300005347|Ga0070668_100193532 | All Organisms → cellular organisms → Bacteria | 1667 | Open in IMG/M |
3300005364|Ga0070673_100384603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1252 | Open in IMG/M |
3300005365|Ga0070688_100199633 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium MnTg03 | 1399 | Open in IMG/M |
3300005366|Ga0070659_100143814 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. URHB0020 | 1942 | Open in IMG/M |
3300005435|Ga0070714_100225801 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1723 | Open in IMG/M |
3300005435|Ga0070714_100834406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 893 | Open in IMG/M |
3300005435|Ga0070714_102382537 | Not Available | 514 | Open in IMG/M |
3300005436|Ga0070713_101516240 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
3300005436|Ga0070713_101584526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 636 | Open in IMG/M |
3300005437|Ga0070710_10302318 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
3300005437|Ga0070710_10791762 | Not Available | 676 | Open in IMG/M |
3300005439|Ga0070711_100058017 | All Organisms → cellular organisms → Bacteria | 2683 | Open in IMG/M |
3300005439|Ga0070711_100622146 | All Organisms → cellular organisms → Eukaryota | 903 | Open in IMG/M |
3300005444|Ga0070694_100466291 | All Organisms → cellular organisms → Bacteria | 1000 | Open in IMG/M |
3300005455|Ga0070663_100097315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2190 | Open in IMG/M |
3300005455|Ga0070663_100282691 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1323 | Open in IMG/M |
3300005456|Ga0070678_102245928 | Not Available | 518 | Open in IMG/M |
3300005458|Ga0070681_10395741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1292 | Open in IMG/M |
3300005459|Ga0068867_100244417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1457 | Open in IMG/M |
3300005518|Ga0070699_101312904 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 664 | Open in IMG/M |
3300005518|Ga0070699_101663802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 585 | Open in IMG/M |
3300005530|Ga0070679_100141741 | Not Available | 2382 | Open in IMG/M |
3300005530|Ga0070679_100377859 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1364 | Open in IMG/M |
3300005530|Ga0070679_101107681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 736 | Open in IMG/M |
3300005530|Ga0070679_101947636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 536 | Open in IMG/M |
3300005535|Ga0070684_101317788 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 680 | Open in IMG/M |
3300005539|Ga0068853_100136858 | Not Available | 2196 | Open in IMG/M |
3300005539|Ga0068853_100472227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1182 | Open in IMG/M |
3300005545|Ga0070695_101860297 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 506 | Open in IMG/M |
3300005546|Ga0070696_100002786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 11603 | Open in IMG/M |
3300005546|Ga0070696_100220616 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1423 | Open in IMG/M |
3300005547|Ga0070693_101600992 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300005563|Ga0068855_100243736 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2007 | Open in IMG/M |
3300005563|Ga0068855_102343665 | Not Available | 534 | Open in IMG/M |
3300005564|Ga0070664_100634003 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
3300005577|Ga0068857_100241365 | Not Available | 1654 | Open in IMG/M |
3300005578|Ga0068854_100423369 | All Organisms → cellular organisms → Bacteria | 1106 | Open in IMG/M |
3300005614|Ga0068856_100004519 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 13832 | Open in IMG/M |
3300005616|Ga0068852_100354774 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1433 | Open in IMG/M |
3300005616|Ga0068852_100551167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1153 | Open in IMG/M |
3300005618|Ga0068864_100001285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 20888 | Open in IMG/M |
3300005841|Ga0068863_102013127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 587 | Open in IMG/M |
3300005889|Ga0075290_1051168 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 570 | Open in IMG/M |
3300006175|Ga0070712_101612690 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 568 | Open in IMG/M |
3300006755|Ga0079222_10213716 | All Organisms → cellular organisms → Bacteria | 1174 | Open in IMG/M |
3300006806|Ga0079220_10079335 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1643 | Open in IMG/M |
3300006903|Ga0075426_10377894 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
3300006903|Ga0075426_10654339 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 787 | Open in IMG/M |
3300009093|Ga0105240_10102931 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3470 | Open in IMG/M |
3300009101|Ga0105247_10360376 | Not Available | 1025 | Open in IMG/M |
3300009148|Ga0105243_10724857 | All Organisms → cellular organisms → Bacteria | 972 | Open in IMG/M |
3300009156|Ga0111538_11257327 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
3300009174|Ga0105241_10067603 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2766 | Open in IMG/M |
3300009174|Ga0105241_10308922 | Not Available | 1360 | Open in IMG/M |
3300009174|Ga0105241_10732338 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
3300009545|Ga0105237_11919548 | Not Available | 600 | Open in IMG/M |
3300010375|Ga0105239_10323672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. | 1739 | Open in IMG/M |
3300012989|Ga0164305_10855368 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 760 | Open in IMG/M |
3300013102|Ga0157371_10134256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax | 1762 | Open in IMG/M |
3300013104|Ga0157370_10049579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4018 | Open in IMG/M |
3300013105|Ga0157369_12490214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 524 | Open in IMG/M |
3300013307|Ga0157372_11405878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 804 | Open in IMG/M |
3300015371|Ga0132258_10204063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 4797 | Open in IMG/M |
3300021413|Ga0193750_1061891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 752 | Open in IMG/M |
3300025904|Ga0207647_10365997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 815 | Open in IMG/M |
3300025907|Ga0207645_10462481 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 857 | Open in IMG/M |
3300025912|Ga0207707_10034980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4393 | Open in IMG/M |
3300025913|Ga0207695_10346226 | Not Available | 1374 | Open in IMG/M |
3300025913|Ga0207695_10515380 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
3300025914|Ga0207671_10148396 | All Organisms → cellular organisms → Bacteria | 1810 | Open in IMG/M |
3300025915|Ga0207693_11122443 | Not Available | 596 | Open in IMG/M |
3300025917|Ga0207660_10884689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 729 | Open in IMG/M |
3300025917|Ga0207660_10950379 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 701 | Open in IMG/M |
3300025920|Ga0207649_10009149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 5416 | Open in IMG/M |
3300025920|Ga0207649_10439151 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 983 | Open in IMG/M |
3300025921|Ga0207652_10136056 | Not Available | 2194 | Open in IMG/M |
3300025922|Ga0207646_10753846 | Not Available | 869 | Open in IMG/M |
3300025925|Ga0207650_10007106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 7627 | Open in IMG/M |
3300025929|Ga0207664_10701161 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
3300025932|Ga0207690_11625478 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300025942|Ga0207689_10003696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 13945 | Open in IMG/M |
3300025944|Ga0207661_10426920 | All Organisms → cellular organisms → Bacteria | 1204 | Open in IMG/M |
3300025945|Ga0207679_10206504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1644 | Open in IMG/M |
3300025945|Ga0207679_11786534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 562 | Open in IMG/M |
3300025949|Ga0207667_11202807 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
3300025972|Ga0207668_10029409 | All Organisms → cellular organisms → Bacteria | 3601 | Open in IMG/M |
3300025972|Ga0207668_10187985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1634 | Open in IMG/M |
3300025981|Ga0207640_10192823 | Not Available | 1537 | Open in IMG/M |
3300026041|Ga0207639_10565576 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
3300026067|Ga0207678_10004770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 12167 | Open in IMG/M |
3300026078|Ga0207702_10477932 | All Organisms → cellular organisms → Bacteria | 1212 | Open in IMG/M |
3300026116|Ga0207674_10005199 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 15493 | Open in IMG/M |
3300026116|Ga0207674_10035394 | All Organisms → cellular organisms → Bacteria | 5211 | Open in IMG/M |
3300027725|Ga0209178_1100205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 967 | Open in IMG/M |
3300027842|Ga0209580_10484603 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 616 | Open in IMG/M |
3300031938|Ga0308175_100290290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1662 | Open in IMG/M |
3300031938|Ga0308175_100711498 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1091 | Open in IMG/M |
3300031939|Ga0308174_11902209 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300031996|Ga0308176_11151467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 821 | Open in IMG/M |
3300032074|Ga0308173_10016747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 4806 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 17.29% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 16.54% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 12.78% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 12.03% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 6.77% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.51% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.76% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 3.01% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.01% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.01% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.26% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.26% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.26% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.50% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.50% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.50% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.50% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.75% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.75% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.75% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.75% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.75% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.75% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005889 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_201 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300021413 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c1 | Environmental | Open in IMG/M |
3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0065712_106432712 | 3300005290 | Miscanthus Rhizosphere | MKHPPTLAPLAAPQGAGQSVGAALPDWMKHPPTLAPLAAPQGASQSVGAALPD* |
Ga0065715_102606242 | 3300005293 | Miscanthus Rhizosphere | MKHPPTLAPLAAPQGAGQSVGAALPDWMKHPPTLAPLAAPQGAGQSVGAALP |
Ga0070658_100764683 | 3300005327 | Corn Rhizosphere | MERPPTLAPLAAPRGADQSVGVALPDWDERPPTLAPLAAPRGADQSVGAALPD* |
Ga0070658_101790671 | 3300005327 | Corn Rhizosphere | MELRPTLAALAAPRGADQSVGAALPDWMERPPTLAALAAPRGADQSVG |
Ga0070658_102713902 | 3300005327 | Corn Rhizosphere | MKRPPTLAALAAPRGAGQSVGAALPDSDEHPPTLAVLAAPRGAGQSVGAALPD* |
Ga0070658_110065532 | 3300005327 | Corn Rhizosphere | MKRPRTLASLAAPRRAVQSVRAALPDWDERPPTLASLAAPRGAGQSLGAALHD* |
Ga0070676_100017864 | 3300005328 | Miscanthus Rhizosphere | MKHPPTLAPLAAPQGAGQSVGAALPDWMKHPPTLAPLAAPQGAGQSVGAALPD* |
Ga0070676_106141362 | 3300005328 | Miscanthus Rhizosphere | MKHPPTLAPLAALQGAGQSVGAALPDSDQLPPTLAPLAAP |
Ga0070683_1000045861 | 3300005329 | Corn Rhizosphere | DERPPTLAPLAAPEGADQSVGAALPDWDERPPTLAPLAAPEGADQSVGAALPD* |
Ga0070683_1001935121 | 3300005329 | Corn Rhizosphere | MKPPPTLAPLAAPEGADQSVGAALPDWDARPPTLAPLAAPEGADQSVGAALPDWDERPPTLA |
Ga0070683_1008622291 | 3300005329 | Corn Rhizosphere | MERPPTLAALAAPRGADQSVGAALPDWMERPPTLAALAAPRGADQSVG |
Ga0070670_10000374914 | 3300005331 | Switchgrass Rhizosphere | MKHPPTLAPLAAPQGASQSVGAALPDWMKHPPMLAPLAAPQGASQSVGAALPD* |
Ga0068869_1001106312 | 3300005334 | Miscanthus Rhizosphere | MKHPPTLAPLAAPQGAGQSVGAALPDSMKHPPTLAPLAAPQGAGQSVGAALPD* |
Ga0070680_1002338961 | 3300005336 | Corn Rhizosphere | MKPPPTLAPLAAPEGADQSVGAALPDWDERPPTLAPLAAPEGADQSVGAALPDWD |
Ga0070680_1002863662 | 3300005336 | Corn Rhizosphere | MKHPPTLAPLAAPPGAGQSFGAALHDWDEHPPTLAPLAAPRGAGQSFGAALHD* |
Ga0070680_1003917331 | 3300005336 | Corn Rhizosphere | LRDWKRPPTLAALAAPRGAGQSLGSALRDWKRPPTLAALAAPRGAGQSLGSALRD* |
Ga0070680_1005052032 | 3300005336 | Corn Rhizosphere | RPPTLAALAAPRGADQSVGAALPDWMERPPTLAALAAPRGADQSVGAALPD* |
Ga0070680_1007450092 | 3300005336 | Corn Rhizosphere | GAALPDWDERPPTLAPLAAPEGADQSVGAALPDWDARPPTLAPLAAPEGADQSVGAALPD |
Ga0070680_1009805952 | 3300005336 | Corn Rhizosphere | MKHPPTLAPLAAPRGAGQSVGAALPDWDEHPPTLAPLAAPRGAGQSVGAALPD* |
Ga0070682_1000444882 | 3300005337 | Corn Rhizosphere | MKPPPTLAPLAAPEGADQSVGAALPDWDERPPTLAPLAAPE |
Ga0070682_1013549962 | 3300005337 | Corn Rhizosphere | MKHPPTLAPLAAPPGAGQSFGAALHDWDEHPPTLAPLAAPRGAGQS |
Ga0068868_1005735922 | 3300005338 | Miscanthus Rhizosphere | MKHPPTLAPLAALQGAGQSVGAALPDSDQLPPTLAPLAAPQGAGQSVGAALPD* |
Ga0070660_1000209193 | 3300005339 | Corn Rhizosphere | MEHPPTLAPLAAPRGAGQSLGAARRDSEEHPPTLAPLAAPRGAGQSLGAARRD* |
Ga0070660_1000526461 | 3300005339 | Corn Rhizosphere | MERPPTLAALAAPRGADQSVGAALPDWMERPPTLAALAAPRGADQSVGA |
Ga0070660_1002085742 | 3300005339 | Corn Rhizosphere | REGVSRLMAHPPTRAPLAAPRGAGQSVGAALPDWDERPPTLAPLAAPRGAGQSVGTALPD |
Ga0070660_1003742112 | 3300005339 | Corn Rhizosphere | MKPPPTLAALAAPEGADQSVGAALPDWDERPPTLAPLAAPEGADQSVGAALPD* |
Ga0070660_1003971933 | 3300005339 | Corn Rhizosphere | MKHPPTLAALAAPRGAGQSVGAALPDWDEHPPTLAALAAPRGAGQSVGAALPD* |
Ga0070689_1003688701 | 3300005340 | Switchgrass Rhizosphere | PPTLAPLAAPQGAGQSVGAALPDSMKHPPTLAPLAAPQGAGQSVGAALPD* |
Ga0070661_1001370413 | 3300005344 | Corn Rhizosphere | MKPPLTLAALAAPEGADQSVGAALPDWDERPPTLAALAAPEGADQSVGAALPD* |
Ga0070661_1005252901 | 3300005344 | Corn Rhizosphere | TLAALAAPQGAGQSLGTARRDSVKRPPTLAALAAPQGAGQSLGTARRD* |
Ga0070661_1008394382 | 3300005344 | Corn Rhizosphere | MELRPTLAALAAPRGADQSVGAALPDWMERPPTLAALAAPRGADQSVGAALPD* |
Ga0070661_1013515122 | 3300005344 | Corn Rhizosphere | GAALPDSMKHPPTLAPLAAPQGAGQSVGAALPDSMKHPPTLAPLAAPQGAGQSVGAALPD |
Ga0070692_100737951 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MKPPPTLAPLAAPEGADQSVGAALPDWDERPPTLAPLAAPEGADQSVGAALPDWDE |
Ga0070668_1001935321 | 3300005347 | Switchgrass Rhizosphere | MKHPPTLAPLAAPQGASQSVGAALPDWMKHPPTLAPLAAPQGASQSVGAALPD |
Ga0070673_1003846033 | 3300005364 | Switchgrass Rhizosphere | MKHPPTLAPLAALQGAGQSVGAALPDSDQLPPTLAPLAALQGAGQSVGAALPD* |
Ga0070688_1001996331 | 3300005365 | Switchgrass Rhizosphere | MKHPPTLAPLAAPQGASQSVGAALPDWMKHPPTLAPLAAPQGA |
Ga0070659_1001438142 | 3300005366 | Corn Rhizosphere | MEHPPTLAPLAAPPGAGQSFGAALHDWDEHPPTLAPLAAPRGAGQSFGAALHD* |
Ga0070714_1002258012 | 3300005435 | Agricultural Soil | MKHPPTLAPLAAPQGADQSVGAALPDWDEHPPTLAPLAAPRGADQSVGAALPD* |
Ga0070714_1008344063 | 3300005435 | Agricultural Soil | MKHPPTLAPLAAPQGAGQSVGAALPDWDGHPPTLAPLAAPRGAGQSVGAALPD* |
Ga0070714_1023825371 | 3300005435 | Agricultural Soil | MKHPPTLALLAAPQGAGQSVGAALPDWDEHPPTLALLAAPQGAGQSVGAALPD* |
Ga0070713_1015162401 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | WDEHPPTLAPLAAPRGAGQSVGAALPAWDEHPPTLAPLAAPRGAGQSVGAALPA* |
Ga0070713_1015845262 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MERPPTLAPLAAPRGADQSVGAALPDWDERPPTLAPLAAPRGAGQSVGAALPDW |
Ga0070710_103023181 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MKHPPTLALLAAPQGAGQPVGAALPGWDEHPPTLALLAAPQGAGQPVGAALPG* |
Ga0070710_107917621 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MKHPPTLAPLAARRGAGQSVGAALPDWDGHPPTLALLAAPRGAGQSVGAALPD |
Ga0070711_1000580172 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MKHPPTLAPLAAPQGAGQSVGAALPDWDGHPPTLALLAAPQGAGQSVGAALPD* |
Ga0070711_1006221462 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MKHPPTLALLAAPRGAGRLLGAPLRNWDERPPTLAPLAAPRG |
Ga0070694_1004662911 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MKHPPTLAPLAAPQGAGQSVGAALPDWMKHPPMLAPLAAPQG |
Ga0070663_1000973151 | 3300005455 | Corn Rhizosphere | MKHPPTLAALAAPRGAGQSVGAALPDWKHPPTLAALAAPRGAGQSVGAALPD* |
Ga0070663_1002826912 | 3300005455 | Corn Rhizosphere | MKHPPTLAPLAAPQGASQSVGAALPDWMKHPPTLAPLAAPQGAGQSVGAALPD* |
Ga0070678_1022459281 | 3300005456 | Miscanthus Rhizosphere | LAPLAAPQGASQSVGAALPDWMKHPPMLAPLAAPQGASQSVGAALPD* |
Ga0070681_103957411 | 3300005458 | Corn Rhizosphere | MKRPPTLALLAAPRGAGQSVGAALPDWDEHPPTLAPLAAPRG |
Ga0068867_1002444171 | 3300005459 | Miscanthus Rhizosphere | MKHPPTLAPLAAPQGAGQSVGAALPDSMKHPPTLAPLAAPQGAGQSVGAALPD |
Ga0070699_1013129041 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MKHPPTLAPLTAPRGAGQSVGAALPAWDEHPPTLAPLAAP |
Ga0070699_1016638022 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MKHPPTLAALAAPQGAGQSVGAALPDLMKRPPTLAALAAPQGAGQSVGAALPD* |
Ga0070679_1001417413 | 3300005530 | Corn Rhizosphere | MQHPPTLAPLAAPRGAGQSVGAALPDWDERPPTLAPLAAPEGADQSVGAALPDWDE |
Ga0070679_1003778593 | 3300005530 | Corn Rhizosphere | MKRSPTLAALAAPRGVGQSVGAALPDWDRHPPTLAALAAPRGVGQSVGAALPD* |
Ga0070679_1011076812 | 3300005530 | Corn Rhizosphere | VKRPPTLAALAAPQGAGQSLGTARRDSVKRPPTLAALAAPQGAGQSLGTARRD |
Ga0070679_1019476362 | 3300005530 | Corn Rhizosphere | MERPPTLAPLAAPRGADQSVGAALPDWDERPPTLAPLAAPRGADQSVGAALPD* |
Ga0070684_1013177882 | 3300005535 | Corn Rhizosphere | MKHSSTLAPLAAPRGARQSLGAARRDFIHPPTLAPLAAPRGAGQSLGAARRD* |
Ga0068853_1001368582 | 3300005539 | Corn Rhizosphere | MKPPPTLAPLAAPEGADQSVGAALPDWDERPPTLAPLAAAE |
Ga0068853_1004722271 | 3300005539 | Corn Rhizosphere | MKRPRTLASLAAPRRAVQSVRAALPDWDERPPTLASLAAPRGA |
Ga0070695_1018602971 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MKHPPTLAPLAAPRGAGQSVGAALPDWDEHPPTLAPLAAPRGA |
Ga0070696_10000278611 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MKHPPTLAPLAAPRGAGQSVGAALPDWDGHPPTLALLAAP |
Ga0070696_1002206163 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | RMKHPPTLAPLAAPQGAGQSVGAALPDWLKHPPTLAPLAALQGAGQSVGAALPD* |
Ga0070693_1016009921 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MKHPPTLAPLAALQGAGQSVGAALPDSDQLPPTLAPLAALQGAGQSVGAALPDSDQLPPTLA |
Ga0068855_1002437363 | 3300005563 | Corn Rhizosphere | LAAPRGAGQSVGAALPDWDERPPTLAALAAPRGAGQSVGAALPD* |
Ga0068855_1023436651 | 3300005563 | Corn Rhizosphere | MKHPPTLAPLATRRGAGQSVGAALPDWDGHPPTLAAPRGAGQSVGAALPDWDGHPPTLAPLA |
Ga0070664_1006340031 | 3300005564 | Corn Rhizosphere | LAPLAAPEGADQSVGAALPDWDERPPTLAALAAPEGADQSVGAALPD* |
Ga0068857_1002413652 | 3300005577 | Corn Rhizosphere | TLAPLAAPQGAGQSVGAALPDWDEHPPTLAPLAAPRGAGQSVGAALPD* |
Ga0068854_1004233691 | 3300005578 | Corn Rhizosphere | MKPPPTLAALAAPEGADQSVGAALPDWDERPPTLAPLAAPEGADQSVG |
Ga0068856_1000045191 | 3300005614 | Corn Rhizosphere | MKPPPTLAPLAAPEGADQSVGAALPDWDERPPTLAPLAAPEGADQSVGAALPDWDARPPTLAPLA |
Ga0068852_1003547743 | 3300005616 | Corn Rhizosphere | MKHPPTLAPLAALQGAGQSVGAALPDSDQLPPTLAPLAALQGAGQSVGA |
Ga0068852_1005511673 | 3300005616 | Corn Rhizosphere | MKHPPTLAALAAPRGAGQSVGAALPDWKHPPTLATLAAPRGAGQSVGAALPD* |
Ga0068864_10000128524 | 3300005618 | Switchgrass Rhizosphere | MKHPPTLAPLAAPQGAGQSVGAALPDWMKHPPMLAPLAAPQGASQSVGAALPD* |
Ga0068863_1020131272 | 3300005841 | Switchgrass Rhizosphere | IRMKHPPTLAPLAAPQGASQSVGAALPDWMKHPPTLAPLAAPQGAGQSVGAALPD* |
Ga0075290_10511681 | 3300005889 | Rice Paddy Soil | MKHPPTLASLAAPRGAGQSVGAALPDWDEHPPTLA |
Ga0070712_1016126902 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MKPPLTLAALAAPEGADQSVGAALPDWDERPPTLAPLAAPRGAGQSVGAALPDW |
Ga0079222_102137162 | 3300006755 | Agricultural Soil | MKHPPTLAPLAAPRGAGLSLGTALRDKHPPTLAPLAAPRGAGPSLGTALRD* |
Ga0079220_100793353 | 3300006806 | Agricultural Soil | MKRPPTLAPLAAPRGARQRVGAALPAWDEDPPTLAPLAAPRGARQSVGAALPA* |
Ga0075426_103778942 | 3300006903 | Populus Rhizosphere | MKPPPTLAALAAPEGADQSVGAALPDWDERPPTLA |
Ga0075426_106543392 | 3300006903 | Populus Rhizosphere | MEHPPTLAPLAAPRGAGQSVGAALPDWDEHPPTLAPLAAPQGAGQSVGAALPD* |
Ga0105240_101029315 | 3300009093 | Corn Rhizosphere | MKRPPTLAPLAAPRGARQRVGAALPAWDEDPPTLAPLAA |
Ga0105247_103603761 | 3300009101 | Switchgrass Rhizosphere | MKHPPTLAPLAAPQGASQSVGAALPDWMKHPPMLAPLAAPQGASQSVGAALPD |
Ga0105243_107248571 | 3300009148 | Miscanthus Rhizosphere | PTLAPLAAPQGAGQSVGAALPDWMKHPPTLAPLAAPQGAGQSVGAALPD* |
Ga0111538_112573272 | 3300009156 | Populus Rhizosphere | MKHPPTLAPLDPPQGAGQSVGAALPDWMKHPPTLAPLAAPQGAGQSVGAALPDWMKHPP |
Ga0105241_100676031 | 3300009174 | Corn Rhizosphere | HPPTLASLAAPRGASQSVGAALPDWDEHPPTLASLAAPRGASQSVGAALPD* |
Ga0105241_103089221 | 3300009174 | Corn Rhizosphere | MKPPPTLAPLAAPEGADQSVGAALPDWDERPPMLAPLDAPEGADQSV |
Ga0105241_107323382 | 3300009174 | Corn Rhizosphere | PTSASPRMKPPPTLAPLAAPEGADQSVGAALPDWDERPPTLAPLAAPEGADQSVGAALPD |
Ga0105237_119195482 | 3300009545 | Corn Rhizosphere | MKHPPTLAPLAAPQGASQSVGAALPDWMKHPPTLAPLAAPQGAGQSVGAALPDS |
Ga0105239_103236722 | 3300010375 | Corn Rhizosphere | MEHPPTLAPLAAPQGAGQSFGAALHDWDEHPPTLAPLAAPRGAGQSFGAALHD* |
Ga0164305_108553681 | 3300012989 | Soil | MTHPPTLAPLAAPPGAGQSFGAALHDWDEHPPTLAPLAGP |
Ga0157371_101342563 | 3300013102 | Corn Rhizosphere | MEQPPTLAPLAAPPGAGQSFGAALHDWDEHPPTLAPLAAPRGAGQSFGAALHD* |
Ga0157370_100495792 | 3300013104 | Corn Rhizosphere | MKHPRTLASLAAPRGAGQSVGAALPDWDERPPTLAPLAAPRGAGQSLGAALHD* |
Ga0157369_124902142 | 3300013105 | Corn Rhizosphere | MKHPPTLAPLDAPEGADQSVGAALPNWAERPPTLAALAA |
Ga0157372_114058781 | 3300013307 | Corn Rhizosphere | MKPPPTLAALAAPEGADQSVGAALPDWDERPPTLAPLAA |
Ga0132258_102040636 | 3300015371 | Arabidopsis Rhizosphere | MEHPSKLAPLAASQGAGQSVGAALPDSKHPPTLAALAAPRGVGQSVGAAFPD* |
Ga0193750_10618912 | 3300021413 | Soil | MKKILPTLATPRGAGQSVGAARPDSDEHPPTLAPLAAPRGAGQSVGAALPDLT |
Ga0207647_103659972 | 3300025904 | Corn Rhizosphere | MKHPPTLAPLAALQGAGQSVGAALPDSDQLPPTLAPLAALQGAGQSVGAAL |
Ga0207645_104624811 | 3300025907 | Miscanthus Rhizosphere | PPTLAPLAAPQGASQSVGAALPDWMKHPPTLAPLAAPQGASQSVGAALPD |
Ga0207707_100349804 | 3300025912 | Corn Rhizosphere | MKPPPTLAPLAAPEGADQSVGAALPDWDERPPTLAP |
Ga0207695_103462261 | 3300025913 | Corn Rhizosphere | MKPPPTLAPLAAPEGADQSVGAALPDWDARPPTLAPLAA |
Ga0207695_105153801 | 3300025913 | Corn Rhizosphere | WDERPPTLAPLAAPEGADQSVGAALPDWDERPPTLAALAAPEGADQSVGAALPD |
Ga0207671_101483962 | 3300025914 | Corn Rhizosphere | MEHPPTLAPLAAPPGAGQSFGAALHDWDEHPPTLAPLAAPRGAGQSFGAALHD |
Ga0207693_111224432 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRMKHPPTLAPLAARRGAGQSVGAALPDWDEHPPTLAPLAARRGAGQSVGAAL |
Ga0207660_108846892 | 3300025917 | Corn Rhizosphere | MKHPPTLAPLAALQGAGQSVGAALPDSDQLPPTLAPLAALQGAGQSVGAALPD |
Ga0207660_109503791 | 3300025917 | Corn Rhizosphere | MERPPTLAPLAAPRGADQSVGVALPDWDERPPTLAPLAAPRGADQSVGAALPDWDA |
Ga0207649_100091497 | 3300025920 | Corn Rhizosphere | MKHPPTLAPLAALQGAGQSVGAALPDSDQLPPTLAPLAAPQGAGQSVGA |
Ga0207649_104391513 | 3300025920 | Corn Rhizosphere | LTLAALAAPQGAGQSLGTARRDSVKRPPTLAALAAPQGAGQSLGTARRD |
Ga0207652_101360562 | 3300025921 | Corn Rhizosphere | MKPPPTLAPLAAPEGADQSVGAALPDWDERPPTLAPLAAPEGADQSVGAALPDWDERPPT |
Ga0207646_107538461 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRMKHPPTLAPLAARRGAGQSVGAALPDWDEHPPTLAPLAARRGAGQSVGAALPDWDE |
Ga0207650_100071061 | 3300025925 | Switchgrass Rhizosphere | MKHPPTLAPLAAPQGAGQSVGAALPDWMKHPPTLAPL |
Ga0207664_107011611 | 3300025929 | Agricultural Soil | LPDWDERPPTLAPLAAPEGADQSVGAALPDWDERPPTLAPLAAPEGADQSVGAALPD |
Ga0207690_116254782 | 3300025932 | Corn Rhizosphere | MKHPPTLAPLAAPQGAGQSVGAALPDWMKHPPTLAPLAAPQGAG |
Ga0207689_100036962 | 3300025942 | Miscanthus Rhizosphere | MKHPPTLAPLAAPQGAGQSVGAALPDWMKHPPTLAPLAAPQGAGQSVGAALPD |
Ga0207661_104269202 | 3300025944 | Corn Rhizosphere | MKPPPTLAPLAAPEGADQSVGAALPDWDARPPTLAPLAAPEGAD |
Ga0207679_102065041 | 3300025945 | Corn Rhizosphere | MERPPTLAPLAAPRGADQSVGVALPDWDERPPTLAPLAAPRGADQSVGAALPDWDERPP |
Ga0207679_117865341 | 3300025945 | Corn Rhizosphere | PARLGWNVPPTLAALAAPRGADQSVGAALPDWMERPPTLAALAAPRGADQSVGAALPD |
Ga0207667_112028071 | 3300025949 | Corn Rhizosphere | MKHPPTLAPLAAPQGAGQSVGAALPDWMKHPPTLAPLAAP |
Ga0207668_100294094 | 3300025972 | Switchgrass Rhizosphere | MKHPPTFAPLAAPQGAGQSVGAALPDWMKHPPTLAPLAAPQGAGQSVG |
Ga0207668_101879853 | 3300025972 | Switchgrass Rhizosphere | RMKHPPTLAPLAAPQGAGQSVGAALPDWMKHPPTLAPLAAPQGAGQSVGAALPD |
Ga0207640_101928231 | 3300025981 | Corn Rhizosphere | MKPPPTLAALAAPEGADQSVGAALPDWDERPPTLAPLAAPEGADQSVGAA |
Ga0207639_105655761 | 3300026041 | Corn Rhizosphere | MKPPPTLAPLAAPEGADQSVGAALPDWDERPPTLAPLAAAEG |
Ga0207678_100047701 | 3300026067 | Corn Rhizosphere | MKPPPTLAPLAAPEGADQSVGAALPDWDERPPTLA |
Ga0207702_104779322 | 3300026078 | Corn Rhizosphere | MKPPPTLAPLAAPEGADQSVGAALPDWDARPPTLAPLAAPEGA |
Ga0207674_100051993 | 3300026116 | Corn Rhizosphere | MEHPPTLAPLAAPQGAGQSFGAALHDWDEHPPTLAPLAAPRGAGQSFGAALHD |
Ga0207674_100353941 | 3300026116 | Corn Rhizosphere | PTLAPLAAPQGAGQSVGAALPDWDEHPPTLAPLAAPRGAGQSVGAALPD |
Ga0209178_11002051 | 3300027725 | Agricultural Soil | MKHPPTLAPLAAPPGAGQSFGAALHDWDEHPPTLAPL |
Ga0209580_104846031 | 3300027842 | Surface Soil | MKHPPTLAPLAAPRGADQSVGAALPDWDEHPPTLAPLAAPRGADQ |
Ga0308175_1002902904 | 3300031938 | Soil | MRHPPTLALLAAPRGAGQSVGAALPDWDEHPPTLALLAAPRGAGQSLGAAL |
Ga0308175_1007114981 | 3300031938 | Soil | MERFPTLAAPEGADRSVGAALPDWKRPPTLASLAAPRGAGQSVGAALPDWK |
Ga0308174_119022092 | 3300031939 | Soil | MKRPPTLAALAAPEGADQSVGAALPDWDERPPTLAPLAAPEGA |
Ga0308176_111514673 | 3300031996 | Soil | MRHPPTLALLAAPRGAGQSVGAALPDWDEHPPTLA |
Ga0308173_100167473 | 3300032074 | Soil | MKRPTTLVPLAAPREAGQSVGAALPDWMKHPPRSLRSLPPQGAGQSVGAALPD |
⦗Top⦘ |