Basic Information | |
---|---|
Family ID | F060397 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 133 |
Average Sequence Length | 45 residues |
Representative Sequence | MRLRLGAAAGAAIVLVGVVGAPTLPVMIGATLAYAWLLWRAVGAR |
Number of Associated Samples | 94 |
Number of Associated Scaffolds | 133 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 66.15 % |
% of genes near scaffold ends (potentially truncated) | 33.08 % |
% of genes from short scaffolds (< 2000 bps) | 86.47 % |
Associated GOLD sequencing projects | 83 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.46 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (86.466 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (27.820 % of family members) |
Environment Ontology (ENVO) | Unclassified (45.113 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.135 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.42% β-sheet: 0.00% Coil/Unstructured: 46.58% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 133 Family Scaffolds |
---|---|---|
PF00543 | P-II | 14.29 |
PF13414 | TPR_11 | 13.53 |
PF14559 | TPR_19 | 8.27 |
PF02705 | K_trans | 6.77 |
PF00909 | Ammonium_transp | 6.77 |
PF13432 | TPR_16 | 5.26 |
PF13176 | TPR_7 | 2.26 |
PF07719 | TPR_2 | 2.26 |
PF00324 | AA_permease | 1.50 |
PF00589 | Phage_integrase | 0.75 |
PF00196 | GerE | 0.75 |
PF13520 | AA_permease_2 | 0.75 |
PF03951 | Gln-synt_N | 0.75 |
PF13371 | TPR_9 | 0.75 |
PF14514 | TetR_C_9 | 0.75 |
PF00903 | Glyoxalase | 0.75 |
COG ID | Name | Functional Category | % Frequency in 133 Family Scaffolds |
---|---|---|---|
COG0347 | Nitrogen regulatory protein PII | Signal transduction mechanisms [T] | 14.29 |
COG0004 | Ammonia channel protein AmtB | Inorganic ion transport and metabolism [P] | 6.77 |
COG3158 | K+ uptake protein Kup | Inorganic ion transport and metabolism [P] | 6.77 |
COG0531 | Serine transporter YbeC, amino acid:H+ symporter family | Amino acid transport and metabolism [E] | 1.50 |
COG0833 | Amino acid permease | Amino acid transport and metabolism [E] | 1.50 |
COG1113 | L-asparagine transporter or related permease | Amino acid transport and metabolism [E] | 1.50 |
COG1115 | Na+/alanine symporter | Amino acid transport and metabolism [E] | 1.50 |
COG0174 | Glutamine synthetase | Amino acid transport and metabolism [E] | 0.75 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 86.47 % |
Unclassified | root | N/A | 13.53 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002908|JGI25382J43887_10067986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1926 | Open in IMG/M |
3300005166|Ga0066674_10070470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1600 | Open in IMG/M |
3300005166|Ga0066674_10235330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 870 | Open in IMG/M |
3300005167|Ga0066672_11034591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 500 | Open in IMG/M |
3300005171|Ga0066677_10606687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 621 | Open in IMG/M |
3300005172|Ga0066683_10007608 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5472 | Open in IMG/M |
3300005172|Ga0066683_10406672 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
3300005174|Ga0066680_10379063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 900 | Open in IMG/M |
3300005174|Ga0066680_10965445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 501 | Open in IMG/M |
3300005178|Ga0066688_10953470 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 526 | Open in IMG/M |
3300005180|Ga0066685_10126977 | All Organisms → cellular organisms → Bacteria | 1722 | Open in IMG/M |
3300005180|Ga0066685_10294106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1123 | Open in IMG/M |
3300005186|Ga0066676_10340875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1000 | Open in IMG/M |
3300005332|Ga0066388_100305239 | All Organisms → cellular organisms → Bacteria | 2237 | Open in IMG/M |
3300005332|Ga0066388_101799826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1089 | Open in IMG/M |
3300005332|Ga0066388_102946358 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
3300005332|Ga0066388_103499332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 802 | Open in IMG/M |
3300005332|Ga0066388_108055792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 527 | Open in IMG/M |
3300005332|Ga0066388_108337536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 517 | Open in IMG/M |
3300005336|Ga0070680_101721198 | Not Available | 543 | Open in IMG/M |
3300005445|Ga0070708_100718465 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
3300005445|Ga0070708_100718967 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
3300005446|Ga0066686_10198496 | All Organisms → cellular organisms → Bacteria | 1343 | Open in IMG/M |
3300005446|Ga0066686_10992306 | Not Available | 546 | Open in IMG/M |
3300005447|Ga0066689_10333439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 944 | Open in IMG/M |
3300005467|Ga0070706_101448701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 628 | Open in IMG/M |
3300005468|Ga0070707_100284042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1608 | Open in IMG/M |
3300005468|Ga0070707_100873172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 864 | Open in IMG/M |
3300005518|Ga0070699_100649661 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 963 | Open in IMG/M |
3300005529|Ga0070741_10008132 | All Organisms → cellular organisms → Bacteria | 21230 | Open in IMG/M |
3300005536|Ga0070697_100146681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1987 | Open in IMG/M |
3300005536|Ga0070697_100236096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1561 | Open in IMG/M |
3300005536|Ga0070697_100481355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1084 | Open in IMG/M |
3300005536|Ga0070697_100893147 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
3300005555|Ga0066692_10325222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 975 | Open in IMG/M |
3300005555|Ga0066692_10545931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 733 | Open in IMG/M |
3300005555|Ga0066692_10641932 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
3300005566|Ga0066693_10221994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 742 | Open in IMG/M |
3300005568|Ga0066703_10702130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 582 | Open in IMG/M |
3300005764|Ga0066903_100299416 | All Organisms → cellular organisms → Bacteria | 2543 | Open in IMG/M |
3300006032|Ga0066696_10615103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 704 | Open in IMG/M |
3300006163|Ga0070715_10185590 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
3300006797|Ga0066659_11381720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 588 | Open in IMG/M |
3300006852|Ga0075433_11457271 | Not Available | 592 | Open in IMG/M |
3300006854|Ga0075425_100133489 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2839 | Open in IMG/M |
3300006854|Ga0075425_100746382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1123 | Open in IMG/M |
3300006854|Ga0075425_101057909 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
3300006871|Ga0075434_100436170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1331 | Open in IMG/M |
3300009012|Ga0066710_100397090 | All Organisms → cellular organisms → Bacteria | 2054 | Open in IMG/M |
3300009012|Ga0066710_101191458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1180 | Open in IMG/M |
3300009012|Ga0066710_103008763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 656 | Open in IMG/M |
3300009012|Ga0066710_104277010 | Not Available | 533 | Open in IMG/M |
3300009038|Ga0099829_10221995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1535 | Open in IMG/M |
3300009089|Ga0099828_10034959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 4080 | Open in IMG/M |
3300009090|Ga0099827_10730699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 856 | Open in IMG/M |
3300009137|Ga0066709_101314402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1059 | Open in IMG/M |
3300009147|Ga0114129_10827408 | Not Available | 1179 | Open in IMG/M |
3300010320|Ga0134109_10132957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 886 | Open in IMG/M |
3300010320|Ga0134109_10225016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 700 | Open in IMG/M |
3300010333|Ga0134080_10155359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 972 | Open in IMG/M |
3300010358|Ga0126370_12071832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 558 | Open in IMG/M |
3300010391|Ga0136847_11745158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1266 | Open in IMG/M |
3300010398|Ga0126383_11113321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 879 | Open in IMG/M |
3300010398|Ga0126383_12783142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 571 | Open in IMG/M |
3300011269|Ga0137392_11051343 | Not Available | 668 | Open in IMG/M |
3300011270|Ga0137391_10229617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1611 | Open in IMG/M |
3300011271|Ga0137393_10983445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 719 | Open in IMG/M |
3300012096|Ga0137389_10753147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 837 | Open in IMG/M |
3300012189|Ga0137388_10042926 | All Organisms → cellular organisms → Bacteria | 3616 | Open in IMG/M |
3300012189|Ga0137388_11369996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 647 | Open in IMG/M |
3300012189|Ga0137388_11701107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 565 | Open in IMG/M |
3300012203|Ga0137399_10892987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 748 | Open in IMG/M |
3300012206|Ga0137380_10947508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 738 | Open in IMG/M |
3300012206|Ga0137380_11128223 | Not Available | 667 | Open in IMG/M |
3300012209|Ga0137379_10550040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1062 | Open in IMG/M |
3300012210|Ga0137378_11641075 | Not Available | 551 | Open in IMG/M |
3300012211|Ga0137377_11028896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 754 | Open in IMG/M |
3300012362|Ga0137361_10256850 | All Organisms → cellular organisms → Bacteria | 1593 | Open in IMG/M |
3300012362|Ga0137361_10739029 | Not Available | 898 | Open in IMG/M |
3300012362|Ga0137361_11521014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 591 | Open in IMG/M |
3300012363|Ga0137390_11916065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 521 | Open in IMG/M |
3300012923|Ga0137359_10312621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1398 | Open in IMG/M |
3300012929|Ga0137404_10293630 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1408 | Open in IMG/M |
3300012976|Ga0134076_10126736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1031 | Open in IMG/M |
3300014166|Ga0134079_10704648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 515 | Open in IMG/M |
3300015356|Ga0134073_10147948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 740 | Open in IMG/M |
3300015358|Ga0134089_10481935 | Not Available | 541 | Open in IMG/M |
3300015371|Ga0132258_10259276 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4255 | Open in IMG/M |
3300017654|Ga0134069_1025635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1789 | Open in IMG/M |
3300017656|Ga0134112_10189505 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 801 | Open in IMG/M |
3300017657|Ga0134074_1342781 | Not Available | 550 | Open in IMG/M |
3300018431|Ga0066655_10037954 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → environmental samples → uncultured Gemmatimonadaceae bacterium | 2403 | Open in IMG/M |
3300018431|Ga0066655_11038059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 569 | Open in IMG/M |
3300018433|Ga0066667_10022014 | All Organisms → cellular organisms → Bacteria | 3413 | Open in IMG/M |
3300018468|Ga0066662_11347909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 735 | Open in IMG/M |
3300018482|Ga0066669_10865054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 806 | Open in IMG/M |
3300019789|Ga0137408_1059275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 698 | Open in IMG/M |
3300021151|Ga0179584_1412896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 502 | Open in IMG/M |
3300025905|Ga0207685_10085606 | All Organisms → cellular organisms → Bacteria | 1315 | Open in IMG/M |
3300025910|Ga0207684_10264896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1483 | Open in IMG/M |
3300025922|Ga0207646_10127592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2288 | Open in IMG/M |
3300025922|Ga0207646_11217366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 660 | Open in IMG/M |
3300026277|Ga0209350_1063022 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1054 | Open in IMG/M |
3300026298|Ga0209236_1248901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 588 | Open in IMG/M |
3300026306|Ga0209468_1175960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 541 | Open in IMG/M |
3300026307|Ga0209469_1048009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1355 | Open in IMG/M |
3300026314|Ga0209268_1018204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2622 | Open in IMG/M |
3300026324|Ga0209470_1151953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1016 | Open in IMG/M |
3300026324|Ga0209470_1194096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 865 | Open in IMG/M |
3300026327|Ga0209266_1304328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 501 | Open in IMG/M |
3300026329|Ga0209375_1075744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1577 | Open in IMG/M |
3300026331|Ga0209267_1035719 | All Organisms → cellular organisms → Bacteria | 2340 | Open in IMG/M |
3300026332|Ga0209803_1347930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 514 | Open in IMG/M |
3300026334|Ga0209377_1100986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1196 | Open in IMG/M |
3300026538|Ga0209056_10171152 | All Organisms → cellular organisms → Bacteria | 1630 | Open in IMG/M |
3300026538|Ga0209056_10216013 | Not Available | 1389 | Open in IMG/M |
3300026538|Ga0209056_10708803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 509 | Open in IMG/M |
3300026550|Ga0209474_10405513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 709 | Open in IMG/M |
3300026550|Ga0209474_10546113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 589 | Open in IMG/M |
3300028536|Ga0137415_11091692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 611 | Open in IMG/M |
3300031716|Ga0310813_11980239 | Not Available | 549 | Open in IMG/M |
3300031720|Ga0307469_10499186 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
3300031720|Ga0307469_10873555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 831 | Open in IMG/M |
3300031720|Ga0307469_11016548 | Not Available | 775 | Open in IMG/M |
3300031740|Ga0307468_102488188 | Not Available | 507 | Open in IMG/M |
3300031820|Ga0307473_10019862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2708 | Open in IMG/M |
3300032180|Ga0307471_103122246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 587 | Open in IMG/M |
3300032205|Ga0307472_101015940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 778 | Open in IMG/M |
3300033004|Ga0335084_10941288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 872 | Open in IMG/M |
3300033004|Ga0335084_12105070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 548 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 27.82% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 18.80% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 11.28% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 9.77% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 7.52% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.26% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.26% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.51% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.26% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.50% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.50% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.75% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.75% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.75% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.75% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.75% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.75% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300004022 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 | Environmental | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300021151 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025535 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 (SPAdes) | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI25382J43887_100679863 | 3300002908 | Grasslands Soil | MRLRLGAAAGAAIVLVGXXGAPTLPVMIGATLAYAWLLWRAVGAR* |
Ga0055432_100764252 | 3300004022 | Natural And Restored Wetlands | MRVRMAAAASAAIILVGLLGAPVVPVMIGTTIAYAWLVGRSVAAR* |
Ga0066674_100704702 | 3300005166 | Soil | MRLRLGAAVGAAIVLVGILGAPTLPVMIGATLAYAWLLWRAVGAR* |
Ga0066674_102353303 | 3300005166 | Soil | MRLRLGAAAGAAIVLVGVIGAPALPVMIGATLAYAWLLWRAVGAR* |
Ga0066672_110345911 | 3300005167 | Soil | PREGRGMRLRLGAAAGAAIVLVGVIGAPTLPVMIGATLAYAWLLWRAVGAR* |
Ga0066677_106066872 | 3300005171 | Soil | MRLRLGAAAGAAIVLVGVIGAPTLPVMIGATLAYAWLLWRAVGAR* |
Ga0066683_100076085 | 3300005172 | Soil | MRLRLGAAACVAIVLVGIAGAPVLPVMIGASVAYAWLVLRVLATR* |
Ga0066683_104066723 | 3300005172 | Soil | MRLRLGAAAGAAIVLVGILGAPTLPVMIGASLAYAWLLWRAVGAR* |
Ga0066680_103790632 | 3300005174 | Soil | MKLRLGAAACAAIVLVGVMGAPALPVMIGATAAYAWLLWRANVVRSGPEEER* |
Ga0066680_109654451 | 3300005174 | Soil | MRLRLGAAAGAAIVLVGIIGAPTLPVMIGATLAYAWLLWRAVGAR* |
Ga0066688_109534702 | 3300005178 | Soil | MRLRLGAAAGVAIVLVGILGAPTLPVMIGATLAYAWLLWRAVGAR* |
Ga0066685_101269773 | 3300005180 | Soil | MKLRLGAAACAAVVLVGLMGAPALPVMIGATAAYAWLLWRAIATR* |
Ga0066685_102941062 | 3300005180 | Soil | MKLRLGAAACAAIVLVPVMGAPALPVMIGATAAYAWLLWRATSARPGREEER* |
Ga0066676_103408753 | 3300005186 | Soil | MRLRLGAAAGAAIVLVGILGAPTLPVMIGATLAYAWLLWRAVGAR* |
Ga0066676_110833601 | 3300005186 | Soil | MRLRLAATTSAAIVMVGVLGAPVMPVMIGASIAYAWLVWRAL |
Ga0066388_1003052393 | 3300005332 | Tropical Forest Soil | MKLRLGAATCAAIVLVSVMGAPVLPVMIGATAAYAWLLWRASAVRPGREEER* |
Ga0066388_1017998262 | 3300005332 | Tropical Forest Soil | MRLRLAAVAATAIVLIGMLGAPVLPVMIGGTLAYGWLLWRSVAIR* |
Ga0066388_1029463582 | 3300005332 | Tropical Forest Soil | MRLRLGAAAAAAIVLIGVFGAPALPVMIGATAAYGWLLWRSIATR* |
Ga0066388_1034993321 | 3300005332 | Tropical Forest Soil | MRLRLGAATCAAIVLVGVMGAPVLPVMIGATAAYAWLLWRASS |
Ga0066388_1080557922 | 3300005332 | Tropical Forest Soil | MRVRLAAATGAVIVLIAVLGAPVLPVMIGASGAYAWLIWRAAAAR* |
Ga0066388_1083375362 | 3300005332 | Tropical Forest Soil | MRVRLAAATCAVIVLVAVVGAPVLPVMIGATGAYAWLIWRAAAAR* |
Ga0070680_1017211982 | 3300005336 | Corn Rhizosphere | MRTRLAAALCAAIVLVGVVGAPAVPVMIGATVAYGWLLWRAVASR* |
Ga0070708_1007184652 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLRLGAAACAAIVLVCVMGAPALPVMIGATAAYAWLLWRATSARPGREEER* |
Ga0070708_1007189672 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VRLRLGAALCAAIVLVVMVGAPAVPVMIGATAAYAWLLWRATASR* |
Ga0066686_101984963 | 3300005446 | Soil | MRLRLGAAASAAIVLVGVIGAPTLPVMIGATLAYAWLLWRAVGAR* |
Ga0066686_109923062 | 3300005446 | Soil | VRVRIAAATSAALVLVGLLGAPALPVLGGIALAYGWLLWRELASR* |
Ga0066689_103334392 | 3300005447 | Soil | MRLRLGAAAGAAIVLVGVVGAPTLPVMIGATLAYAWLLWRAVGAR* |
Ga0070706_1014487012 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VRLRLGAALCAAIVLVVMVGAPAVPVMIGVTAAYAWLLWRATASR* |
Ga0070707_1002840423 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLRLGAAAAAAILLVGVLGAPPLSVMIGATAAYAWLLWRSVASR* |
Ga0070707_1008731722 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MMRFRLGAGAIAAIVLVGLVGAPVLPVMIGATAAYAWLLWKAVATR* |
Ga0070699_1006496612 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLRLGAAAAAAILLVGVLGAPTLPVMIGSTAAYAWLLWRSVASR* |
Ga0070741_1000813216 | 3300005529 | Surface Soil | MRLRLGATVSAAIVLVGVLGAPVVPVMVGATAAYAWLLWRSRAPT* |
Ga0070697_1001466812 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLRLAAAASAAIVMVGLLGAPALPVMIGATAAYVWLLWKSLARS* |
Ga0070697_1002360962 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MRFRLGAGAIAAIVLVGLVGAPVLPVMIGATAAYAWLLWKAVATR* |
Ga0070697_1004813553 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLRLGAAAAAAILLVGVLGAPPLPVMIGATAAYVLLLWRSVASR* |
Ga0070697_1008931473 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VLVCVMGAPALPVMIGATAAYAWLLWRATSARPGREEER* |
Ga0066692_103252222 | 3300005555 | Soil | MRLRLGAAAGAAFVLVGVIGAPTLPVMIGATLAYAWLLWRAVGAR* |
Ga0066692_105459313 | 3300005555 | Soil | GAAVGAAIVLVGILGAPTLPVMIGATLAYAWLLWRAVGAR* |
Ga0066692_106419321 | 3300005555 | Soil | AIVLVGIAGAPVLPVMIGASVAYAWLVLRVLATR* |
Ga0066693_102219941 | 3300005566 | Soil | WPREERGMRLRLGAAVGAAIVLVGILGAPTLPVMIGATLAYAWLLWRAVGAR* |
Ga0066703_107021302 | 3300005568 | Soil | MKLRLGAAACAAIVLVGVMGAPALPVMIGATAAYAWLLW |
Ga0066903_1002994164 | 3300005764 | Tropical Forest Soil | MKLRLGAAACAAIVLVGVMGAPALPVMIGATAAYAWLLWRASAARPGHEEER* |
Ga0066696_106151033 | 3300006032 | Soil | MRLRLGAAACVAIVLVGIAGAPVLPVMIGASVAYAWLVLRVL |
Ga0070715_101855903 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLRLGAAACAAIVLVGVMGAPALPVMIGATAAYAWLLWRATSARPGREEER* |
Ga0066659_113817201 | 3300006797 | Soil | MRLRLGAAACVAIVLVGIAGAPVLPVMIGASVAYAWL |
Ga0075433_114572711 | 3300006852 | Populus Rhizosphere | TAIVLIGMLGAPVLPVMIGGTLAYGWLLWRSVAIR* |
Ga0075425_1001334894 | 3300006854 | Populus Rhizosphere | MRVRLAAATCAAIVLIGILGAPALPVMIGATGAYALLIWRAVATR* |
Ga0075425_1007463824 | 3300006854 | Populus Rhizosphere | MKLRLGAAACAAIVLVCVMGAPALPVMIGATAAYAWLLWRATSARPG |
Ga0075425_1010579092 | 3300006854 | Populus Rhizosphere | MKLRLGAAACAAIVLVGVMGAPALPVMIGATAAYAWLLWRASAARPGTEEER* |
Ga0075434_1004361701 | 3300006871 | Populus Rhizosphere | MRLRLGAATAAALVLVGIVGAPVLPVMIGATVAYALLLWRGAMRS* |
Ga0066710_1003970904 | 3300009012 | Grasslands Soil | MKLRLGAATCTAIVLIGVFGAPALPVMIGATAAYAWLLWRAVATR |
Ga0066710_1011914582 | 3300009012 | Grasslands Soil | MRLRLAAAASAAIVMVGVLGAPVLPVMVGATAAYVWLIWRSLARS |
Ga0066710_1030087632 | 3300009012 | Grasslands Soil | MKLRLGAAACAAVVLVGLMGAPALPVMIGASAAYAWLLWGAIASR |
Ga0066710_1042770102 | 3300009012 | Grasslands Soil | MRVTLAATTSAVIVLVGLLGAPALPVMIGATGTWAWLVWRAVATRRRI |
Ga0099829_102219952 | 3300009038 | Vadose Zone Soil | MRFRLGAGAIAAIVLVGLVGAPVLPVMIGATAGYALRL* |
Ga0099828_100349591 | 3300009089 | Vadose Zone Soil | AAIVLVVMVGAPAVPVMIGATAAYAWLLWRATASR* |
Ga0099827_107306992 | 3300009090 | Vadose Zone Soil | MKLRLGAVVCATIVLVGVFGAPVLPVMIGATAAYAWLLWTAASSR* |
Ga0066709_1013144023 | 3300009137 | Grasslands Soil | MRFRLGAAVSAAIVLVGVVGAPTLPVMIGATLAYAWLLWRAVGAR* |
Ga0114129_108274082 | 3300009147 | Populus Rhizosphere | MRLRLGAATAAAVVLVGIVGAPVLPVMIGATVAYALLLWRGAVRS* |
Ga0134109_101329572 | 3300010320 | Grasslands Soil | MRLRLGAAAGAAIVLVGVIGAPSLPVMIGATLAYAWLLWRAVGAR* |
Ga0134109_102250163 | 3300010320 | Grasslands Soil | GAAACAAIVLVGVMGAPALPVMIGATAAYAWLLWRANVVRSGPEEER* |
Ga0134080_101553591 | 3300010333 | Grasslands Soil | MRLRLGAAACVAIVLVGITGAPVLPVMIGASVAYAWLVLRVLATR* |
Ga0126370_120718321 | 3300010358 | Tropical Forest Soil | MKLRLGAATCAAIVLVSVMGAPVLPVMIGATAAYAWLLWRASAVRPGREE |
Ga0136847_117451583 | 3300010391 | Freshwater Sediment | MRLAATLSAVIVLIGIAGAPAMPVMLGAAAAYGWLLWRAAASR* |
Ga0126383_111133212 | 3300010398 | Tropical Forest Soil | AAAACAAIVLIGVMGAPAVPVMIGATGAYAWLVYRAVATRRRHGRAPL* |
Ga0126383_127831422 | 3300010398 | Tropical Forest Soil | MRVRLAAATCAAIVLVAVLGAPVLPVMIGATAAYGWLVWRAVATR* |
Ga0137392_110513432 | 3300011269 | Vadose Zone Soil | RLGAAVCAAIVLVVMVGAPAVPVMIGATAAYAWLLWRATASR* |
Ga0137391_102296172 | 3300011270 | Vadose Zone Soil | MRLRLGAAAMVALVLIGVLGAPALPVMIGATVAYAWLLWRSVATR* |
Ga0137393_109834451 | 3300011271 | Vadose Zone Soil | RLGAGAIAAIVLVGLVGAPVLPVMIGATAAYAWLLWKAVATR* |
Ga0137389_107531472 | 3300012096 | Vadose Zone Soil | MRLRLGAAVSAAIVLVGVIGAPTLPVMIGATLAYAWLLWRTVGAR* |
Ga0137388_100429264 | 3300012189 | Vadose Zone Soil | VRLRLGAAVCAAIVLVVMVGAPAVPVMIGATAAYAWLLWRATASR* |
Ga0137388_113699961 | 3300012189 | Vadose Zone Soil | MKLRLGAVVCATIVLVGVFGAPVLPVMIGATAAYAWLLWT |
Ga0137388_117011072 | 3300012189 | Vadose Zone Soil | MRLRLGAATGAAIVLVGILGAPTLPVMIGATLAYAWLLWRTVGAR* |
Ga0137399_108929873 | 3300012203 | Vadose Zone Soil | LGAAAGAAIVLVGILGAPTLPVMIGATLAYAWLLWRAVGAR* |
Ga0137380_109475081 | 3300012206 | Vadose Zone Soil | MRLRLGAAAGGAIVLVGVIGAPTLPVMIGATLAYAWLLWRAVGAR* |
Ga0137380_111282231 | 3300012206 | Vadose Zone Soil | AVCAAVLLVGAMGAPALPVMIGATAAYAWLLWRAIATR* |
Ga0137379_105500402 | 3300012209 | Vadose Zone Soil | MRLRLGAAVGAAIVLVGVIGAPTLPVMIGATLASAWLLWRAVGAR* |
Ga0137378_116410751 | 3300012210 | Vadose Zone Soil | AVCAAVVLVGVMGAPVLPVMIGATAAYAWLLWRAIATR* |
Ga0137377_110288961 | 3300012211 | Vadose Zone Soil | AAAGAAIVLVGIIGAPTLPVMIGATLAYAWLLWRAVGAR* |
Ga0137361_102568504 | 3300012362 | Vadose Zone Soil | VKLRLGAALGATIVLVGMMGAPTLPVMIGITAGYAWLLFGSPLL |
Ga0137361_107390292 | 3300012362 | Vadose Zone Soil | MKLRLGAAASAAVVLVGLMGAPALPVMIGATAAYAWLLWRAIATR* |
Ga0137361_115210142 | 3300012362 | Vadose Zone Soil | MRLRLGAAVGAAIVLVGILGAPTLPVMIGATLAYAWL |
Ga0137390_119160652 | 3300012363 | Vadose Zone Soil | AVVALVLIGVLGAPALPVMIGATVAYAWLLWRSVATR* |
Ga0137359_103126214 | 3300012923 | Vadose Zone Soil | AAIVLVGVVGAPTLPVMIGATLAYAWLLWRTVGAR* |
Ga0137404_102936303 | 3300012929 | Vadose Zone Soil | ACAAIVLVGVMGAPALPVMIGATAAYAWLLWRANVVRSGPEEER* |
Ga0134076_101267362 | 3300012976 | Grasslands Soil | MRLRLGAAASVAIVLVGVIGAPTLPVMIGATLAYAWLLWRAVGAR* |
Ga0134079_107046482 | 3300014166 | Grasslands Soil | MKLRLGAAACTAIVLVGVMGAPALPVMIGATAAYAWLLWRANVVRSGPEEER* |
Ga0134073_101479481 | 3300015356 | Grasslands Soil | MRLRLGAAAGAAIVLVGVVGAPTLPVMIGATLAYAWLLWRTVGAR* |
Ga0134089_104819352 | 3300015358 | Grasslands Soil | MKLRLGAAACAAIVLVGVMGAPALPVMIGATAAYAWLLWRANTARSGPEEER* |
Ga0132258_102592763 | 3300015371 | Arabidopsis Rhizosphere | MRLRLGAVAATAIVLIGMLGAPVLPVMIGGTLAYGWLLWRSVAIR* |
Ga0134069_10256351 | 3300017654 | Grasslands Soil | MRLRLGAAASAAIVLVGVIDAPTLPVMIGATLAYAWLLWRAVGAR |
Ga0134112_101895051 | 3300017656 | Grasslands Soil | MKLRLGAAACAAIVLVPVMGAPALPVMIGATAAYAWLLWRAIATR |
Ga0134074_13427811 | 3300017657 | Grasslands Soil | AGNRPRMKLRLGAAACAAIVLVGVMGAPALPVMIGATAAYAWLLWRANVVRSGPEEER |
Ga0066655_100379542 | 3300018431 | Grasslands Soil | MRLRLGAAACVAIVLVGIAGAPVLPVMIGASVAYAWLVLRVLATR |
Ga0066655_110380591 | 3300018431 | Grasslands Soil | MRLRLGAAVGAAIVLVGILGAPTLPVMIGATLAYAWLLWRAVGAR |
Ga0066667_100220144 | 3300018433 | Grasslands Soil | MKLRLGAAACAAIVLVGVMGAPALPVMIGATAAYAWLLWRANVVRSGPEEER |
Ga0066662_113479092 | 3300018468 | Grasslands Soil | MRLRLGAAAGAAIVLVGVIGAPTLPVMIGATLAYAWLLWRAVGAR |
Ga0066669_108650542 | 3300018482 | Grasslands Soil | MRLRLGAAVGAAIVLVGILGAPTPPVMIGATLAYAWLLWRAVGAR |
Ga0137408_10592752 | 3300019789 | Vadose Zone Soil | MRLRLGAAAGAAIVLVGIIGAPTLPVMIGATLAYAWLLWRAVGAR |
Ga0179584_14128962 | 3300021151 | Vadose Zone Soil | LGAAAGAAIVLVGILGAPTLPVMIGATLAYAWLLWRAVGAR |
Ga0207423_10153243 | 3300025535 | Natural And Restored Wetlands | MRVRMAAAASAAIILVGLLGAPVVPVMIGTTIAYAWLVGRSVAAR |
Ga0207685_100856063 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLRLGAAACAAIVLVGVMGAPALPVMIGATAAYAWLLWRATSARPGREEER |
Ga0207684_102648963 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VRLRLGAALCAAIVLVVMVGAPAVPVMIGVTAAYAWLLWRATASR |
Ga0207646_101275926 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLRLGAAAAAAILLVGVLGAPPLSVMIGATAAYAWLLWRSVASR |
Ga0207646_112173662 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLRLGAGAIAAIVLVGLVGAPVLPVMIGATAAYAWLLWKAVATR |
Ga0209350_10630224 | 3300026277 | Grasslands Soil | MRLRLGAAAGAAIVLVGVIGAPTLPVMIGATLAYAWLLW |
Ga0209236_12489012 | 3300026298 | Grasslands Soil | MRLRLGAAAGAAIVLVGILGAPTLPVMIGATLAYAWLLWRAVGAR |
Ga0209468_11759602 | 3300026306 | Soil | MRLRLGAAAGAAIVLVGVIGAPALPVMIGATLAYAWLLWRAVGAR |
Ga0209469_10480092 | 3300026307 | Soil | MRLRLGAAAGAAIVLVGVVGAPTLPVMIGATLAYAWLLWRAVGAR |
Ga0209268_10182041 | 3300026314 | Soil | MRLRLGAAAGAAIVLVGVVGAPTLPVMIGATLAYAWLLWRAVGTR |
Ga0209470_11519532 | 3300026324 | Soil | MRLRLGAAAGAAIVLVGILGAPTLPVMIGASLAYAWLLWRAVGAR |
Ga0209470_11940962 | 3300026324 | Soil | MRLRLGAAASAAIVLVGVIGAPTLPVMIGATLAYAWLLWRAVGAR |
Ga0209266_13043282 | 3300026327 | Soil | ALPARPREGRGMRLRLGAAAGAAIVLVGVVGAPTLPVMIGATLAYAWLLWRAVGAR |
Ga0209375_10757441 | 3300026329 | Soil | MKLRLGAAACTAIVLVGVMGAPALPVMIGATAAYAWLLWR |
Ga0209267_10357191 | 3300026331 | Soil | REGRGMRLRLGAAAGAAIVLVGVVGAPTLPVMIGATLAYAWLLWRAVGAR |
Ga0209803_13479301 | 3300026332 | Soil | AAIVLVGIIGAPTLPVMIGATLAYAWLLWRAVGAR |
Ga0209377_11009862 | 3300026334 | Soil | MRLRLGAAAGAAFVLVGVIGAPTLPVMIGATLAYAWLLWRAVGAR |
Ga0209056_101711522 | 3300026538 | Soil | MRLRLGAAVGAAIVLVGILGAPTLPVMIGATLAYAWLLWRAVAAR |
Ga0209056_102160132 | 3300026538 | Soil | VAIVLVGIAGAPVLPVMIGASVAYAWLVLRVLATR |
Ga0209056_107088032 | 3300026538 | Soil | MRLRLGAAAGAAIVLVGVMGAPTLPVMIGATLAYAWLLWRAVGAR |
Ga0209474_104055131 | 3300026550 | Soil | MRLRPGAAACVAIVLVGIAGAPVLPVMIGASVAYAWL |
Ga0209474_105461131 | 3300026550 | Soil | MKLRLGAAACAAVVLVGLMGAPALPVMIGATAAYAWLLW |
Ga0137415_110916922 | 3300028536 | Vadose Zone Soil | AAIVLVGVIDAPTLPVMIGATLAYAWLLWRAVGAR |
Ga0310813_119802392 | 3300031716 | Soil | MRIRLAAALSAAIMLVGIVGAPALPVMLGATVAYGWLLWRAVASR |
Ga0307469_104991861 | 3300031720 | Hardwood Forest Soil | QAAVRGRRMRLRLGAAACAAIVLVGILGAPVLPVMIGTSVGYAWLLWRAGSTR |
Ga0307469_108735551 | 3300031720 | Hardwood Forest Soil | AIAAIVLVGLVGAPVLPVMIGATAAYAWLLWKAVATR |
Ga0307469_110165482 | 3300031720 | Hardwood Forest Soil | MRIRLAAALSAAIVLVGIVGAPALPVMLGATVAYGWLLWRAVASR |
Ga0307468_1024881881 | 3300031740 | Hardwood Forest Soil | MRIRLAAALSAAIVLVGIVGAPALPVMLGATVAYGWLLWR |
Ga0307473_100198624 | 3300031820 | Hardwood Forest Soil | MMRFRLGAGAIAAIVLVGLVGAPVLPVMIGATAAYAWLLWKAVATR |
Ga0307471_1031222462 | 3300032180 | Hardwood Forest Soil | CAAIVLVGILGAPVLPVMIGTSVGYAWLLWRAGSTR |
Ga0307472_1010159402 | 3300032205 | Hardwood Forest Soil | MRFRLGAGAIAAIVLVGLVGAPVLPVMIGATAAYAWLLWKAVATR |
Ga0335084_109412884 | 3300033004 | Soil | MKLRLAAAACAGVVMVHFVGAPVLPVMVGATIAYAWLLWRAAASR |
Ga0335084_121050702 | 3300033004 | Soil | MRLRLGATACAAIVMVGFLHAPVVPVMIGATAAYAWLLWRTLST |
⦗Top⦘ |