NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F060887

Metagenome / Metatranscriptome Family F060887

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F060887
Family Type Metagenome / Metatranscriptome
Number of Sequences 132
Average Sequence Length 47 residues
Representative Sequence MIVAAWICLLTPLGAALLITLCGTRLSRRGAGYLATVSVAVSFVAA
Number of Associated Samples 120
Number of Associated Scaffolds 132

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 32.82 %
% of genes near scaffold ends (potentially truncated) 99.24 %
% of genes from short scaffolds (< 2000 bps) 96.97 %
Associated GOLD sequencing projects 118
AlphaFold2 3D model prediction Yes
3D model pTM-score0.67

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (68.182 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(21.212 % of family members)
Environment Ontology (ENVO) Unclassified
(34.091 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(55.303 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 56.76%    β-sheet: 0.00%    Coil/Unstructured: 43.24%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.67
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 132 Family Scaffolds
PF00420Oxidored_q2 68.94
PF00499Oxidored_q3 18.94
PF00037Fer4 5.30
PF00146NADHdh 3.79
PF04085MreC 0.76
PF10589NADH_4Fe-4S 0.76
PF00491Arginase 0.76
PF12838Fer4_7 0.76

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 132 Family Scaffolds
COG0839NADH:ubiquinone oxidoreductase subunit 6 (chain J)Energy production and conversion [C] 18.94
COG0650Formate hydrogenlyase subunit HyfCEnergy production and conversion [C] 3.79
COG1005NADH:ubiquinone oxidoreductase subunit 1 (chain H)Energy production and conversion [C] 3.79
COG0010Arginase/agmatinase family enzymeAmino acid transport and metabolism [E] 0.76
COG1792Cell shape-determining protein MreCCell cycle control, cell division, chromosome partitioning [D] 0.76

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms68.18 %
UnclassifiedrootN/A31.82 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908016|OU_2_1_1_newblercontig155196Not Available547Open in IMG/M
3300000579|AP72_2010_repI_A01DRAFT_1033429All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales743Open in IMG/M
3300000837|AP72_2010_repI_A100DRAFT_1033528All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria721Open in IMG/M
3300001686|C688J18823_10599492All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales703Open in IMG/M
3300002568|C688J35102_120188382All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales918Open in IMG/M
3300004157|Ga0062590_100918120All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria822Open in IMG/M
3300004643|Ga0062591_102436801Not Available549Open in IMG/M
3300005179|Ga0066684_10483543All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales832Open in IMG/M
3300005355|Ga0070671_100252642All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1498Open in IMG/M
3300005440|Ga0070705_100666956All Organisms → cellular organisms → Bacteria813Open in IMG/M
3300005457|Ga0070662_100146304All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1836Open in IMG/M
3300005536|Ga0070697_100849197All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria809Open in IMG/M
3300005546|Ga0070696_101454505All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales585Open in IMG/M
3300005556|Ga0066707_10820949All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300005561|Ga0066699_10353685All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1050Open in IMG/M
3300005578|Ga0068854_101744389All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria570Open in IMG/M
3300005844|Ga0068862_100164634All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1981Open in IMG/M
3300005937|Ga0081455_10849035All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria570Open in IMG/M
3300006046|Ga0066652_100551118All Organisms → cellular organisms → Bacteria1080Open in IMG/M
3300006573|Ga0074055_11764975All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales765Open in IMG/M
3300006605|Ga0074057_12093699All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales683Open in IMG/M
3300006847|Ga0075431_100491245All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1219Open in IMG/M
3300006871|Ga0075434_100862498All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria921Open in IMG/M
3300006894|Ga0079215_10304512All Organisms → cellular organisms → Bacteria → Acidobacteria882Open in IMG/M
3300009012|Ga0066710_103421092Not Available602Open in IMG/M
3300009101|Ga0105247_10562879All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales840Open in IMG/M
3300009137|Ga0066709_100913175All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1280Open in IMG/M
3300009148|Ga0105243_10946297All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales860Open in IMG/M
3300009148|Ga0105243_12592686Not Available547Open in IMG/M
3300009156|Ga0111538_10740906All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1245Open in IMG/M
3300009162|Ga0075423_10490949All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1291Open in IMG/M
3300009162|Ga0075423_12639656Not Available549Open in IMG/M
3300009792|Ga0126374_10131422All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1483Open in IMG/M
3300010301|Ga0134070_10406981Not Available537Open in IMG/M
3300010321|Ga0134067_10188407All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter753Open in IMG/M
3300010335|Ga0134063_10226119All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales886Open in IMG/M
3300010337|Ga0134062_10766997Not Available513Open in IMG/M
3300010359|Ga0126376_12686684Not Available547Open in IMG/M
3300010360|Ga0126372_11516641All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter707Open in IMG/M
3300010397|Ga0134124_12024435Not Available613Open in IMG/M
3300010397|Ga0134124_12552235All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria553Open in IMG/M
3300010400|Ga0134122_10410831All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1198Open in IMG/M
3300010401|Ga0134121_12734413Not Available539Open in IMG/M
3300011119|Ga0105246_11171979Not Available706Open in IMG/M
3300012200|Ga0137382_10418068All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales946Open in IMG/M
3300012200|Ga0137382_10995956All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia602Open in IMG/M
3300012355|Ga0137369_10352929All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1074Open in IMG/M
3300012359|Ga0137385_11631273Not Available509Open in IMG/M
3300012532|Ga0137373_10809417All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales692Open in IMG/M
3300012681|Ga0136613_10081367All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1855Open in IMG/M
3300012897|Ga0157285_10198764All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales629Open in IMG/M
3300012898|Ga0157293_10209811Not Available592Open in IMG/M
3300012899|Ga0157299_10186614Not Available614Open in IMG/M
3300012901|Ga0157288_10329834Not Available545Open in IMG/M
3300012907|Ga0157283_10021239All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1233Open in IMG/M
3300012914|Ga0157297_10180269Not Available714Open in IMG/M
3300012916|Ga0157310_10498214Not Available529Open in IMG/M
3300012948|Ga0126375_11042262Not Available669Open in IMG/M
3300012988|Ga0164306_11170712All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales643Open in IMG/M
3300013297|Ga0157378_10807765All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales964Open in IMG/M
3300013770|Ga0120123_1160285Not Available537Open in IMG/M
3300014166|Ga0134079_10119715All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1029Open in IMG/M
3300014166|Ga0134079_10192310All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales851Open in IMG/M
3300014745|Ga0157377_10285032All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1084Open in IMG/M
3300015372|Ga0132256_102785289Not Available587Open in IMG/M
3300015373|Ga0132257_104015656Not Available535Open in IMG/M
3300017947|Ga0187785_10645563Not Available549Open in IMG/M
3300018431|Ga0066655_10213225All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1204Open in IMG/M
3300018431|Ga0066655_10989874Not Available580Open in IMG/M
3300018468|Ga0066662_11830901All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria635Open in IMG/M
3300018482|Ga0066669_10461370All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1093Open in IMG/M
3300021344|Ga0193719_10384390Not Available580Open in IMG/M
3300021951|Ga0222624_1141932All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia777Open in IMG/M
3300023057|Ga0247797_1000657All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2873Open in IMG/M
3300023066|Ga0247793_1053106Not Available651Open in IMG/M
3300023261|Ga0247796_1034302All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium839Open in IMG/M
3300025901|Ga0207688_10675257All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales653Open in IMG/M
3300025901|Ga0207688_11036317Not Available518Open in IMG/M
3300025905|Ga0207685_10848387Not Available506Open in IMG/M
3300025906|Ga0207699_10984627All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia623Open in IMG/M
3300025910|Ga0207684_10738799All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium835Open in IMG/M
3300025917|Ga0207660_10660676All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales852Open in IMG/M
3300025920|Ga0207649_10696660All Organisms → cellular organisms → Bacteria788Open in IMG/M
3300025922|Ga0207646_10166470All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1990Open in IMG/M
3300025926|Ga0207659_11582714Not Available560Open in IMG/M
3300025928|Ga0207700_11634882Not Available569Open in IMG/M
3300025929|Ga0207664_10251376All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1543Open in IMG/M
3300025933|Ga0207706_10649954All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales903Open in IMG/M
3300025934|Ga0207686_11614446Not Available536Open in IMG/M
3300025937|Ga0207669_10133547All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1710Open in IMG/M
3300025942|Ga0207689_10492168All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1027Open in IMG/M
3300025960|Ga0207651_11870994Not Available540Open in IMG/M
3300025961|Ga0207712_10666656All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales905Open in IMG/M
3300026023|Ga0207677_10269347All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1392Open in IMG/M
3300026342|Ga0209057_1111968All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1055Open in IMG/M
3300026538|Ga0209056_10280981All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1163Open in IMG/M
3300026542|Ga0209805_1279976Not Available637Open in IMG/M
3300026547|Ga0209156_10391637All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales584Open in IMG/M
3300026552|Ga0209577_10325313All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1140Open in IMG/M
3300026789|Ga0207513_100499All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales736Open in IMG/M
3300026812|Ga0207518_104221Not Available545Open in IMG/M
3300027378|Ga0209981_1076611Not Available519Open in IMG/M
3300027775|Ga0209177_10416863Not Available542Open in IMG/M
3300028065|Ga0247685_1004535All Organisms → cellular organisms → Bacteria1816Open in IMG/M
3300028715|Ga0307313_10254563Not Available546Open in IMG/M
3300028717|Ga0307298_10063047All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1026Open in IMG/M
3300028768|Ga0307280_10209575Not Available691Open in IMG/M
3300028768|Ga0307280_10312144All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales575Open in IMG/M
3300028784|Ga0307282_10597284Not Available535Open in IMG/M
3300028791|Ga0307290_10220214All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales695Open in IMG/M
3300028793|Ga0307299_10123891All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia970Open in IMG/M
3300028799|Ga0307284_10070422All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1266Open in IMG/M
3300028807|Ga0307305_10137712All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1127Open in IMG/M
3300028814|Ga0307302_10236486All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium894Open in IMG/M
3300028819|Ga0307296_10363833All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales790Open in IMG/M
3300028828|Ga0307312_10019746All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia3826Open in IMG/M
3300028828|Ga0307312_10086819All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1921Open in IMG/M
3300028828|Ga0307312_10322873All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1007Open in IMG/M
3300028875|Ga0307289_10071127All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1404Open in IMG/M
3300028885|Ga0307304_10037881All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1731Open in IMG/M
3300028885|Ga0307304_10551261Not Available531Open in IMG/M
3300031152|Ga0307501_10112060All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales702Open in IMG/M
3300031892|Ga0310893_10566101Not Available516Open in IMG/M
3300031938|Ga0308175_100574828All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1209Open in IMG/M
3300031944|Ga0310884_10774270All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter585Open in IMG/M
3300032003|Ga0310897_10087752All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1211Open in IMG/M
3300032012|Ga0310902_10496477All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter795Open in IMG/M
3300032783|Ga0335079_11741284Not Available608Open in IMG/M
3300032828|Ga0335080_10037081All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter5353Open in IMG/M
3300034819|Ga0373958_0017513All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1289Open in IMG/M
3300034819|Ga0373958_0096420All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria688Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil21.21%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.82%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.06%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil4.55%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil4.55%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.79%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.79%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.03%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.03%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.03%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.03%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.27%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.27%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.52%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.52%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.52%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.52%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.52%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.52%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.52%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.52%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.52%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil1.52%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.52%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.52%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.76%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.76%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.76%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.76%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.76%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.76%
Environmental → Unclassified → Unclassified → Unclassified → Unclassified → 0.76%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.76%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.76%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.76%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.76%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.76%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.76%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908016Sample 642EnvironmentalOpen in IMG/M
3300000579Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A01EnvironmentalOpen in IMG/M
3300000837Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100EnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006573Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006605Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015EnvironmentalOpen in IMG/M
3300010321Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015EnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012681Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ272 (21.06)EnvironmentalOpen in IMG/M
3300012897Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1EnvironmentalOpen in IMG/M
3300012898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1EnvironmentalOpen in IMG/M
3300012899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2EnvironmentalOpen in IMG/M
3300012901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1EnvironmentalOpen in IMG/M
3300012907Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1EnvironmentalOpen in IMG/M
3300012914Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2EnvironmentalOpen in IMG/M
3300012916Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013770Permafrost microbial communities from Nunavut, Canada - A15_5cm_18MEnvironmentalOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300021951Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023057Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S136-409B-6EnvironmentalOpen in IMG/M
3300023066Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S223-509R-6EnvironmentalOpen in IMG/M
3300023261Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S166-409R-6EnvironmentalOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026342Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300026542Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes)EnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300026789Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06A2a-11 (SPAdes)EnvironmentalOpen in IMG/M
3300026812Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A3-10 (SPAdes)EnvironmentalOpen in IMG/M
3300027378Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300028065Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK26EnvironmentalOpen in IMG/M
3300028715Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203EnvironmentalOpen in IMG/M
3300028717Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028791Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144EnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300031152Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_SEnvironmentalOpen in IMG/M
3300031892Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300032003Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300034819Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
OU_011208902124908016LIAAGWICLFAPLGAAIAITLAGQRLSRRGAGYVATTSVAFSFVAALVSFAG
AP72_2010_repI_A01DRAFT_103342913300000579Forest SoilVIVAAWICLVAPLAAAVAITLLGQSLSRRGAGYLATSS
AP72_2010_repI_A100DRAFT_103352813300000837Forest SoilVIVAAWICLVTPLAAALLITLLGNSISRRVSGYVATA
C688J18823_1059949213300001686SoilLIAAAWICLFAPLGAALAITLAGRRLTRRGAGYLATASVGVSFAAA
C688J35102_12018838213300002568SoilVNAAAWICLLTPLAAAIAITLGGTRLSRRGAGYVSTLSTMVSFAA
Ga0062590_10091812033300004157SoilVIVAAWTCLFAPLGAALAITLAGNRITRRGAGYLATSSVGVSFVAAVIAFFELLG
Ga0062591_10243680113300004643SoilVIVAAWICLFAPLGAALAITLAGQRLSRRGAGFLATTAVGASFVA
Ga0066684_1048354333300005179SoilMSPGEPPVIVAAWICLVAPLAATLAITLLGQSLSRRAAAYVASAS
Ga0070671_10025264243300005355Switchgrass RhizosphereMIAAAWTCLISPLVATGLITVGGNRLSRRGAGFLATFSVLVSLIAAVV
Ga0070705_10066695613300005440Corn, Switchgrass And Miscanthus RhizosphereLIAAGWICLFAPLGAAIAITLAGQRLSRRGAGYVATTSVAISFVAALVSFAGLLGDQPS
Ga0070662_10014630453300005457Corn RhizosphereVITAAWICLFAPLGAALAITLAGQRLSRRGAGFLATTGVGVSFVAAVVSFIG
Ga0070697_10084919733300005536Corn, Switchgrass And Miscanthus RhizosphereLIAAAWICLFAPLGAAIAITLAGQRLTRRGAGYVATTSVAFSFIAALVSFAGLLGDSP
Ga0070696_10145450533300005546Corn, Switchgrass And Miscanthus RhizosphereMIAAAWICLISPLVATALITASGNRLSRRGAGFLATFSVFVSFVA
Ga0066707_1082094933300005556SoilMIIGAWLCLVSPLAAAALITLGGNRLSRRGAGYLATL
Ga0066699_1035368513300005561SoilLIAAAWICLFAPLGAAIAITLAGQRLTRRGAGYLATTSVGMSFVAALVSFAGLLGDS
Ga0068854_10174438923300005578Corn RhizosphereVITAAWICLFAPLGAALAITLAGQRLSRRGAGFLATTGVGVSFVAAVVSFIGLLGDSPDDRSHPSTLWRWLTAGPYHFDLRI
Ga0068862_10016463413300005844Switchgrass RhizosphereMIAAAWICLISPLVAAFLITLGWNRLSRRGAGYLATLSVA
Ga0081455_1084903523300005937Tabebuia Heterophylla RhizosphereMIAAAWICLLTPLGAALLITLCGTRLSRRGAGYLATLSVAVSFVAAVVTFVALLGDSPAKRYHPSTLWQWL
Ga0066652_10055111813300006046SoilLIPAAWICLFSPLAAALVITLWGTRLSRRGAGYIATLSVGVSFVAALVTFALLLGDK
Ga0074055_1176497533300006573SoilLTIAAWICLFAPLGATLLITLAGERLSRRGAGYLATASVG
Ga0074057_1209369913300006605SoilLTVAAWICLFAPLGATLLITLAGERLSRRGAGYLATASVGVSFVAALVTFVLLLGDS
Ga0075431_10049124513300006847Populus RhizosphereMIVAAWICLLTPLGAALLITLCGSRLSRRGAGYLATLSVAVSFVAAVVSFVAL
Ga0075434_10086249813300006871Populus RhizosphereVIVAAWICLFAPLGAALAITLAGNRITRRGAGYLATFSVGVSFVSAVVAFFELLGDSPEHRYHPS
Ga0079215_1030451213300006894Agricultural SoilLTAAAWICLFAPLAAATLITLLGNVQSRRTAGYIATASTVISFAAAVVAFLQ
Ga0066710_10342109213300009012Grasslands SoilMTVAIYGAWICLLSPLAAAGLITLAGGRISRRGAGYLA
Ga0105247_1056287913300009101Switchgrass RhizosphereMIVAAWICLISPLAAAFLITLAANRLSRRGAGYLATLSVAVSFVAAIVSFAGLLGDSPNHRYHPSTLWNWLT
Ga0066709_10091317543300009137Grasslands SoilLIAAAWICLFAPLGAAIAITLAGQRLTRRGAGYLATTSVGMSFVAALVSFAG
Ga0105243_1094629733300009148Miscanthus RhizosphereVIVAAWICLVAPLVAALLITLLGNSISRRVAGYVATP
Ga0105243_1259268613300009148Miscanthus RhizosphereMIAAAWICLISPLAATALIALAGNRLTRRGAGYLSTLSVAVSFVAA
Ga0111538_1074090643300009156Populus RhizosphereVITAAWICLVAPLAATLAITLLGQSLSRRAAGYLATASVLGSFAAAV
Ga0075423_1049094943300009162Populus RhizosphereVIVGAWICLLAPLVGALLVTLGGNALPRRGAAYLV
Ga0075423_1263965613300009162Populus RhizosphereLIAAAWTCLFAPLGAALAITVAGQRITRRGAGYLATFSVGVSFVGAVVAFFALLGDSP
Ga0126374_1013142243300009792Tropical Forest SoilMIAAAWTCLISPLVATALITVSGNRLSRRGAGFLSTFSVFVSFVGAVVAFV
Ga0134070_1040698113300010301Grasslands SoilLIPAAWICLFSPLAAALVITLWGTRLSRRGAGYIATLSVGVS
Ga0134067_1018840713300010321Grasslands SoilVIVAAWICLVAPLAAALLITLLGTGISRRGAAYIATT
Ga0134063_1022611913300010335Grasslands SoilMSPGEPPVIVAAWICLVAPLAAALAITLLGQSLSRRAAA
Ga0134062_1076699723300010337Grasslands SoilVIVAAWICLLAPLGAVLAITVAGGRLTRRGAGYLA
Ga0126376_1268668413300010359Tropical Forest SoilMIAAAWTCLISPLVAAALVTAGGNRLSRCGAGFLSTFSVLV
Ga0126372_1151664113300010360Tropical Forest SoilMIAAAWTCLISPLVATALITIGGNRLSRRGAGFLST
Ga0134124_1202443533300010397Terrestrial SoilMIAAAWICLISPLVAAFLITLGWNRLSRRGAGYLATLSVAVSFVAAIVS
Ga0134124_1255223533300010397Terrestrial SoilVIVAAWICLAAPLAAALLITLVGTSISRRAAAYAATTS
Ga0134122_1041083113300010400Terrestrial SoilMIVAAWICLISPLAATALIALAGNRLTRRGAGYLSTLSVAVSFVAAIVAFAGLLGDSPDDRYHPSTL
Ga0134121_1273441313300010401Terrestrial SoilMIAAAWICLISPLVAAFLITLGWNRLSRRGAGYLATLSVAFVF
Ga0105246_1117197913300011119Miscanthus RhizosphereMIAAAWICLFAPLGAALAITLAGQRLSRRGAGFLATTGVGVSFVAAVVS
Ga0137382_1041806833300012200Vadose Zone SoilVIIAAWICLLTPLGATLAITLAGQRLSRRGAGYLATGSVGISFVAA
Ga0137382_1099595633300012200Vadose Zone SoilVIVAAWICLAAPLAAALLITLLGTSLSRRAAGYIAT
Ga0137369_1035292913300012355Vadose Zone SoilVIAASWICLLSPLAAALAITLLGHSLTRRGAGYLAS
Ga0137385_1163127313300012359Vadose Zone SoilLIAAAWICLFLPLLSALLITVRGNTITRRGAGFLATLAVFGS
Ga0137373_1080941713300012532Vadose Zone SoilVIAAGWICLFAPLGAALAITLAGQRLTRRGAGYRATASVGVSFVAALVS
Ga0136613_1008136713300012681Polar Desert SandLVAPAWICLLAPLAGALAITLLGRRISRRLAGLLSTGS
Ga0157285_1019876413300012897SoilMTTVAVSGWVCLLSPLTAALLITLAGGKLSRRGAGYLATT
Ga0157293_1020981133300012898SoilMIVAAWICLLTPLGAALLITLCGTRLSRRGAGYLATVSVAVSFVAAVVTFV
Ga0157299_1018661413300012899SoilMIVAAWICLLTPLGAALLITLCGTRLSRRGAGYLATVSVAVSFVAAVVTFVALLGDSPKDRYHPSTLWQ
Ga0157288_1032983433300012901SoilMIVAAWICLLTPLGAALLITLCGTRLSRRGAGYLATLSVAVSFVAAVVS
Ga0157283_1002123913300012907SoilMIVAAWICLLTPLGAALLITLCGTRLSRRGAGYLATVSVAVS
Ga0157297_1018026913300012914SoilMIVAAWICLLTPLGAALLITVCGTRLSRRGAGYLATVSVAVSFVAA
Ga0157310_1049821423300012916SoilMIVAAWICLLTPLGAALLITLCGTRLSRRGAGYLATVSVAVSFVAAVVTFVALLG
Ga0126375_1104226233300012948Tropical Forest SoilVIDAAWICLVAPLAAALAITLLGQGLSRRGAGYLATASVLGSF
Ga0164306_1117071213300012988SoilMVVASWICLISPLAAAFLITLAGNRISRRGAGYLATLSVAVSFVAAIVAFAGLLGDSP
Ga0157378_1080776513300013297Miscanthus RhizosphereMIAAAWICLISPLVAAFLITLGLNRLSRRGAGYLATLSVAVSFVAAIVSFADLLGHSPEDRYHPSTL
Ga0120123_116028513300013770PermafrostLIAAAWFCLLAPLGAALAITLAGDRITRRGAGYLATASVAASFVAAVVVF
Ga0134079_1011971543300014166Grasslands SoilVIAAAWICLFAPLGAALAITLAGGRLTRRGAGYLAT
Ga0134079_1019231033300014166Grasslands SoilVIVAAWICLVAPLAAALLITLLGTGISRRGAAYIAT
Ga0157377_1028503233300014745Miscanthus RhizosphereVITAAWICLFAPLGAALAITLAGQRLSRRGAGFLATTGVGVSFVAAVVSFIGLLGDSPDDRSHPSTLWRWLTAGPYHFDLRILV
Ga0132256_10278528913300015372Arabidopsis RhizosphereMIVAAWICLVAPLAATLVITLFDQTLSRRAAGYLATASVLGS
Ga0132257_10401565613300015373Arabidopsis RhizosphereMNAAAWTCLLLPLAAATAITLAGGRLTRRQAGYVST
Ga0187785_1064556323300017947Tropical PeatlandVIVAAWICLLTPLGATLAITLAGQRLTRRGAGYLATASVGVSFIGALVTFGFLLSKSPSDRQ
Ga0066655_1021322513300018431Grasslands SoilMIVAAWICLVAPLAAALLITLLGTGISRRAAAYVATTSVL
Ga0066655_1098987433300018431Grasslands SoilMIFGAWLCLVSPLAAAVLITLGGNRLSRRGAGYLATLATFVAFVGAAI
Ga0190268_1228078213300018466SoilMTTAAWICLFSPLAGALAITLLGTSIPRRVAGYIATASTTVSFVCAVIAFFAL
Ga0066662_1183090133300018468Grasslands SoilMIFGAWLCLVSPLAAAVLITLGGNRLSRRGAGYLATLATFVAFVGAAISFFSL
Ga0066669_1046137013300018482Grasslands SoilVIVAAWICLLAPLGAALAITLAGGRLTRRGAGYLATAS
Ga0193719_1038439023300021344SoilLIAAAWICLLTPLGAALAITLAGNRFTRRGAGYLASASVAASFVSAVVAFALLLGDPPEHRSHPST
Ga0222624_114193233300021951Groundwater SedimentMVYGSWICLLSPLAAAGLITLAGERITRRGAGYLA
Ga0247797_100065763300023057SoilMIVAAWICLLTPLGAALLITLCGTRLSRRGAGYLATVSVAV
Ga0247793_105310613300023066SoilMIVAAWICLLTPLGAALLITLCGTRLSRRGAGYLA
Ga0247796_103430233300023261SoilMIVAAWICLLTPLGAALLITLCGTRLSRRGAGYLATVSVAVSFVAAVVTFVALLGDSPKDRYH
Ga0207688_1067525733300025901Corn, Switchgrass And Miscanthus RhizosphereVITAAWICLFAPLGAALAITLAGQRLSRRGAGFLATTGVGVHA
Ga0207688_1103631713300025901Corn, Switchgrass And Miscanthus RhizosphereMIAAAWICLISPLVAAFLITLGWNRLSRRGAGYLATLS
Ga0207685_1084838713300025905Corn, Switchgrass And Miscanthus RhizosphereVIVAAWICLVAPLAAALLITLLGNSISRRVAGYVATASVL
Ga0207699_1098462733300025906Corn, Switchgrass And Miscanthus RhizosphereVIVAAWICLLSPLGAALLITLFGNGLSRRGAGYLATFAT
Ga0207684_1073879933300025910Corn, Switchgrass And Miscanthus RhizosphereLIAAAWICLFAPLGAAIAITLAGQRLTRRGAGYVATTSVAFSFIAALVS
Ga0207660_1066067613300025917Corn RhizosphereVITAAWICLFAPLGAALAITLAGQRLSRRGAGFVATTG
Ga0207649_1069666013300025920Corn RhizosphereMIAAAWICLISPLVAAFLITLGWNRLSRRGAGYLATLSVAVSFVAAIV
Ga0207646_1016647013300025922Corn, Switchgrass And Miscanthus RhizosphereVIVAAWICLVAPLAAALLITLLGTSISRRVAAYVATTSV
Ga0207659_1158271413300025926Miscanthus RhizosphereMIVAAWICLISPLAAAFLITLAANRLSRRGAGYLATLSV
Ga0207700_1163488233300025928Corn, Switchgrass And Miscanthus RhizosphereVIVAAWICLVAPLAAALLITLLGNSISRRVAGYVATASVLGS
Ga0207664_1025137643300025929Agricultural SoilMIVAAWICLISPLAATALITAGGNRLSRRGAGFLATSSVFVSFVATLVAFAGLLGD
Ga0207706_1064995433300025933Corn RhizosphereVITAAWICLFAPLGAALAITLAGQRLSRRGAGFLATTGVGVSFVAAVVSFIGLLGDSP
Ga0207686_1161444613300025934Miscanthus RhizosphereMIVAAWICLISPLVAAFLITLGWNRLSRRGAGYLATLSVA
Ga0207669_1013354713300025937Miscanthus RhizosphereMIAAAWICLISPLVAAFLITLGWNRLSRRGAGYLATLSVAVS
Ga0207689_1049216833300025942Miscanthus RhizosphereMIAAAWICLISPLAAAFLITLGWNRLSRRGAGYLATLSV
Ga0207651_1187099413300025960Switchgrass RhizosphereVIVAAWICLVAPLAAALLITLLGNSISRRVAGYVATASVLGSFAA
Ga0207712_1066665613300025961Switchgrass RhizosphereMIVAAWICLLTPLGAALLITLCGTRLSRRGAGYLATLSVAVSFVAAVVSFVALLGDSP
Ga0207677_1026934743300026023Miscanthus RhizosphereVITAAWICLFAPLGAALAITLAGQRLSRRGAGFLATTGVGVSFVAAVVSFIGLLGDSPDDRSHPSTLWRWLTAGPY
Ga0209057_111196813300026342SoilVIVAAWICLVAPLAAALLITLLGTGISRRGAAYIATTSVLGAFAA
Ga0209056_1028098113300026538SoilMIVGAWLCLVSPLAAAALITLGGTGLSRRGAGYLATLATFVAFVGAA
Ga0209805_127997633300026542SoilLIAAAWICLFAPLGAAIAITLAGQRLTRRGAGYLATTSVGMSFVAALVSFAGLLGDSP
Ga0209156_1039163733300026547SoilLIPAAWICLFSPLAAALVITLWGTRLSRRGAGYIATLSVGV
Ga0209577_1032531343300026552SoilLIAGAWICLVAPLAGALAITIGGTRLSRRGAAYLSTLSCFVAF
Ga0207513_10049933300026789SoilMIVAAWICLLTPLGAALLITLCGTRLSRRGAGYLATVSVAVSFVAA
Ga0207518_10422113300026812SoilMNAAAWICLALPLGATVAIALAGTLISRRLAGYLATASVL
Ga0209981_107661113300027378Arabidopsis Thaliana RhizosphereMIVAAWICLLTPLGAALLITLCGTRLSRRGAGYLATVSVAVSFVAAVV
Ga0209177_1041686313300027775Agricultural SoilMIAAAWICLISPLVATALITASGNRLSRRGAGFLATFSVFVSFVAS
Ga0247685_100453553300028065SoilMIAAAWICLISPLVATALITASGNRLSRRGAGFLA
Ga0307313_1025456313300028715SoilLIPAAWICLFAPLGAAIAITLLGHRLTRRGAGYLATTSVGMSFVAALVSFAALLGDSPHNREHPSTLWHWLTAG
Ga0307298_1006304713300028717SoilVIVAAWICLFAPLGAALAITLAGQRLGRRGAGFLATTGVGVSFVAA
Ga0307280_1020957533300028768SoilLIAAAWICLFAPLGAAIAITLLGQRLTRRGAGYLATTSVGMSFVAALVSFAALLGDSPHNREHPSTLWHW
Ga0307280_1031214433300028768SoilMIAAAWICLLSPLAATLLITLGWNRLSRRGAGYLATLS
Ga0307282_1059728433300028784SoilLIAAAWTCLLTPLGAALGITLAGNRITRRGAGYLAT
Ga0307290_1022021413300028791SoilLIAAAWICLLTPLGAALAITLAGNRITRRGAGYLATAS
Ga0307299_1012389133300028793SoilLIAAAWICLFAPLGAAIAITLLGHRLTRRGAGYLATTSVGMS
Ga0307284_1007042213300028799SoilLIAAAWICLFAPLGAAIAITLAGQRLTRRGAGYLATTSVGMSFVAALVSFAALLGDSPHNREHPSTLWHW
Ga0307305_1013771243300028807SoilLIAAAWICLLAPLGAAMAITLAGQRLSRRGAGYLATTSVGISFVAALV
Ga0307302_1023648613300028814SoilVTAAAWACLVSPLAAALLITLGGTAWSRRAAGYLATLSTAVSFGAAVVCFFELT
Ga0307296_1036383313300028819SoilLIAAAWICLLAPLGAAMAITLAGQRLSRRGAGYLATTSVGISF
Ga0307312_1001974663300028828SoilLIAAAWICLFAPLGAAIAITLLGQRLTRRGAGYLATTSVGMSFVAALVSFAALLGDSPHNRE
Ga0307312_1008681913300028828SoilLIAAAWICLLTPLGAALAITLAGNRITRRGAGYLATGSVAASFVSAVVAFALLL
Ga0307312_1032287333300028828SoilLIAAAWICLFAPLGAAIAITLLGHRLTRRGAGYLATTSVGM
Ga0307289_1007112713300028875SoilMIAAAWICLISPLAAAFLITLAGNRLSRRGAGYLATLSVAVSFVAAIVSFA
Ga0307304_1003788113300028885SoilLIAAAWICLLAPLGAALAIAIAGNRITRRGAGYLA
Ga0307304_1055126133300028885SoilLIAAAWICLLTPLGAALAITLAGNRITRRGAGYLATGSVAASFVSA
Ga0307501_1011206013300031152SoilVIVSAWICLVAPLAAALLITLLGTSLSRRAAGYIATASVLGSF
Ga0310893_1056610123300031892SoilMIVAAWICLLTPLGAALLITLCGTRLSRRGAGYLATLSVAVSFVAAVVSFVAL
Ga0308175_10057482813300031938SoilMIAAAWFCLISPLAAAALITVAGNRITRRGAGYLSTLSVAVSFVAAVVA
Ga0310884_1077427013300031944SoilMIAAAWICLISPLVATALITASGNRLSRRGAGFLATFSVF
Ga0310897_1008775243300032003SoilMIAAAWICLISPLVATALITASGNRLSRRGAGFLATVSVF
Ga0310902_1049647733300032012SoilMIAAAWICLISPLVATALITASGNRLSRRGAGFLATFSVFVS
Ga0335079_1174128413300032783SoilVIVAAWICLLTPLGATLAITLAGQRLTRRGAGYLATAS
Ga0335080_1003708113300032828SoilVIVAAWICLLTPLGATLAITLAGQRLTRRGAGYLATASVGVSFVAAVVTFGF
Ga0373958_0017513_2_1783300034819Rhizosphere SoilMIVAAWICLISPLAATALITAGGNRLSRRGAGFLATSSVFVSFVATLVAFAGLLGDSPS
Ga0373958_0096420_545_6883300034819Rhizosphere SoilVIVAAWICLVAPLAAALLITLLGNSISRRVAGYVATASVLGSFAAAVV

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.