Metagenome Family F061001

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F061001
Family Type	Metagenome
Number of Sequences	132
Average Sequence Length	43 residues
Representative Sequence	MSKKSKRIAMILVGVVMALLAVAQHFGWIAGPPPLLAPGIQ
Number of Associated Samples	100
Number of Associated Scaffolds	132

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	65.91 %
% of genes near scaffold ends (potentially truncated)	43.94 %
% of genes from short scaffolds (< 2000 bps)	86.36 %
Associated GOLD sequencing projects	95
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.47

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (62.879 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (8.333 % of family members)
Environment Ontology (ENVO)	Unclassified (38.636 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (63.636 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	Yes	Secondary Structure distribution:	α-helix: 33.33% β-sheet: 0.00% Coil/Unstructured: 66.67%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.47
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.47
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 132 Family Scaffolds
PF02472	ExbD	6.06
PF02687	FtsX	2.27
PF01988	VIT1	2.27
PF00719	Pyrophosphatase	1.52
PF13847	Methyltransf_31	1.52
PF07694	5TM-5TMR_LYT	1.52
PF00005	ABC_tran	1.52
PF07676	PD40	1.52
PF12704	MacB_PCD	1.52
PF13193	AMP-binding_C	1.52
PF01425	Amidase	1.52
PF00756	Esterase	0.76
PF04365	BrnT_toxin	0.76
PF00196	GerE	0.76
PF14690	zf-ISL3	0.76
PF03551	PadR	0.76
PF00034	Cytochrom_C	0.76
PF12695	Abhydrolase_5	0.76
PF04070	DUF378	0.76
PF04069	OpuAC	0.76
PF01435	Peptidase_M48	0.76
PF13517	FG-GAP_3	0.76
PF00664	ABC_membrane	0.76
PF00248	Aldo_ket_red	0.76
PF12543	DUF3738	0.76
PF00313	CSD	0.76
PF03989	DNA_gyraseA_C	0.76
PF13535	ATP-grasp_4	0.76
PF07589	PEP-CTERM	0.76
PF00593	TonB_dep_Rec	0.76
PF07638	Sigma70_ECF	0.76
PF00069	Pkinase	0.76
PF02518	HATPase_c	0.76
PF08241	Methyltransf_11	0.76
PF13340	DUF4096	0.76
PF07677	A2M_recep	0.76
PF00326	Peptidase_S9	0.76
PF01464	SLT	0.76
PF06439	3keto-disac_hyd	0.76
PF00561	Abhydrolase_1	0.76
PF06956	RtcR	0.76

COG ID	Name	Functional Category	% Frequency in 132 Family Scaffolds
COG0848	Biopolymer transport protein ExbD	Intracellular trafficking, secretion, and vesicular transport [U]	6.06
COG0515	Serine/threonine protein kinase	Signal transduction mechanisms [T]	3.03
COG1633	Rubrerythrin, includes spore coat protein YhjR	Inorganic ion transport and metabolism [P]	2.27
COG1814	Predicted Fe2+/Mn2+ transporter, VIT1/CCC1 family	Inorganic ion transport and metabolism [P]	2.27
COG0154	Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase	Translation, ribosomal structure and biogenesis [J]	1.52
COG0221	Inorganic pyrophosphatase	Energy production and conversion [C]	1.52
COG3275	Sensor histidine kinase, LytS/YehU family	Signal transduction mechanisms [T]	1.52
COG4650	Sigma54-dependent transcription regulator containing an AAA-type ATPase domain and a DNA-binding domain	Transcription [K]	1.52
COG0188	DNA gyrase/topoisomerase IV, subunit A	Replication, recombination and repair [L]	0.76
COG1595	DNA-directed RNA polymerase specialized sigma subunit, sigma24 family	Transcription [K]	0.76
COG1695	DNA-binding transcriptional regulator, PadR family	Transcription [K]	0.76
COG1733	DNA-binding transcriptional regulator, HxlR family	Transcription [K]	0.76
COG1846	DNA-binding transcriptional regulator, MarR family	Transcription [K]	0.76
COG2155	Uncharacterized membrane protein YuzA, DUF378 family	Function unknown [S]	0.76
COG2929	Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system	Defense mechanisms [V]	0.76

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	62.88 %
Unclassified	root	N/A	37.12 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	62.88 %
Unclassified	root	N/A	37.12 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	62.88 %
Unclassified	root	N/A	37.12 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.12 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	21.21 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	9.09 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	4.55 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	2.27 %
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	1.52 %
Nitrospirae	phylum	All Organisms → cellular organisms → Bacteria → Nitrospirae	0.76 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.12 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	9.09 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	3.03 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	2.27 %
Planctomycetes	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	2.27 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2.27 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	1.52 %
Vicinamibacteria	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria	1.52 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1.52 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.76 %
Nitrospira	class	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira	0.76 %
Blastocatellia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia	0.76 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.12 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	8.33 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	3.03 %
Planctomycetia	class	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia	2.27 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	2.27 %
Dehalococcoidia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia	1.52 %
Vicinamibacterales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales	1.52 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1.52 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	1.52 %
unclassified Blastocatellia	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia	0.76 %
Acidobacteria bacterium 13_1_40CM_65_14	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_65_14	0.76 %
unclassified Betaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria	0.76 %
Nitrospirales	order	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales	0.76 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.12 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	8.33 %
Pirellulales	order	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales	2.27 %
unclassified Dehalococcoidia	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia	1.52 %
Vicinamibacteraceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae	1.52 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1.52 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	1.52 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.76 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.76 %
unclassified Actinomycetia	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia	0.76 %
Desulfuromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales	0.76 %
unclassified Deltaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria	0.76 %
Nitrospiraceae	family	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae	0.76 %
Bradymonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Bradymonadales	0.76 %
Acidobacteria bacterium 13_1_40CM_65_14	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_65_14	0.76 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.12 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	8.33 %
Pirellulales	order	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales	2.27 %
Luteitalea	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea	1.52 %
Dehalococcoidia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium	1.52 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	1.52 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.76 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	0.76 %
Afipia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia	0.76 %
unclassified Desulfuromonadales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales	0.76 %
unclassified Nitrospiraceae	no rank	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae	0.76 %
Bradymonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Bradymonadales → Bradymonadaceae	0.76 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.76 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.76 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.76 %
Acidobacteria bacterium 13_1_40CM_65_14	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_65_14	0.76 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.12 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	8.33 %
Pirellulales	order	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales	2.27 %
Luteitalea pratensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis	1.52 %
Dehalococcoidia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium	1.52 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	1.52 %
unclassified Bradymonadaceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Bradymonadales → Bradymonadaceae → unclassified Bradymonadaceae	0.76 %
Nitrospiraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium	0.76 %
Desulfuromonadales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium	0.76 %
Bradyrhizobium cajani	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium cajani	0.76 %
Afipia felis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia felis	0.76 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.76 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	0.76 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.76 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.76 %
Acidobacteria bacterium 13_1_40CM_65_14	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_65_14	0.76 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	37.12 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	8.33 %
Pirellulales	order	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales	2.27 %
Luteitalea pratensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis	1.52 %
Dehalococcoidia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium	1.52 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	1.52 %
Bradymonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Bradymonadales → Bradymonadaceae → unclassified Bradymonadaceae → Bradymonadaceae bacterium	0.76 %
Nitrospiraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium	0.76 %
Desulfuromonadales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium	0.76 %
Bradyrhizobium cajani	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium cajani	0.76 %
Afipia felis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia felis	0.76 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.76 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	0.76 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.76 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.76 %
Acidobacteria bacterium 13_1_40CM_65_14	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_65_14	0.76 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2170459004\|F62QY1Z02JUAY2	Not Available	508	Open in IMG/M
3300000956\|JGI10216J12902_100538283	All Organisms → cellular organisms → Bacteria → Proteobacteria	4874	Open in IMG/M
3300000956\|JGI10216J12902_102463938	Not Available	974	Open in IMG/M
3300001431\|F14TB_100136310	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	928	Open in IMG/M
3300001686\|C688J18823_10307463	Not Available	1039	Open in IMG/M
3300004114\|Ga0062593_101989020	Not Available	645	Open in IMG/M
3300004153\|Ga0063455_100442224	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	785	Open in IMG/M
3300004153\|Ga0063455_101151345	All Organisms → cellular organisms → Bacteria → Acidobacteria	578	Open in IMG/M
3300004156\|Ga0062589_101178944	All Organisms → cellular organisms → Bacteria	731	Open in IMG/M
3300004156\|Ga0062589_101200775	All Organisms → cellular organisms → Bacteria	726	Open in IMG/M
3300004157\|Ga0062590_102751882	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → unclassified Desulfuromonadales → Desulfuromonadales bacterium	525	Open in IMG/M
3300004463\|Ga0063356_100313024	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1956	Open in IMG/M
3300004463\|Ga0063356_103293228	Not Available	696	Open in IMG/M
3300004463\|Ga0063356_104091844	All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium	628	Open in IMG/M
3300004463\|Ga0063356_105538396	Not Available	542	Open in IMG/M
3300004479\|Ga0062595_100046039	All Organisms → cellular organisms → Bacteria → Proteobacteria	1953	Open in IMG/M
3300004480\|Ga0062592_101654122	Not Available	621	Open in IMG/M
3300004643\|Ga0062591_101310196	All Organisms → cellular organisms → Bacteria → Acidobacteria	713	Open in IMG/M
3300005093\|Ga0062594_103328576	Not Available	505	Open in IMG/M
3300005179\|Ga0066684_10362990	All Organisms → cellular organisms → Bacteria	970	Open in IMG/M
3300005289\|Ga0065704_10339764	Not Available	825	Open in IMG/M
3300005290\|Ga0065712_10068292	All Organisms → cellular organisms → Bacteria → Proteobacteria	12137	Open in IMG/M
3300005328\|Ga0070676_11269307	Not Available	562	Open in IMG/M
3300005331\|Ga0070670_100306731	All Organisms → cellular organisms → Bacteria	1389	Open in IMG/M
3300005331\|Ga0070670_101458292	All Organisms → cellular organisms → Bacteria	628	Open in IMG/M
3300005332\|Ga0066388_101770965	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium cajani	1097	Open in IMG/M
3300005332\|Ga0066388_104529543	Not Available	708	Open in IMG/M
3300005332\|Ga0066388_107613725	Not Available	543	Open in IMG/M
3300005335\|Ga0070666_10586134	All Organisms → cellular organisms → Bacteria → Proteobacteria	813	Open in IMG/M
3300005336\|Ga0070680_101342492	All Organisms → cellular organisms → Bacteria	619	Open in IMG/M
3300005354\|Ga0070675_100084648	All Organisms → cellular organisms → Bacteria → Proteobacteria	2648	Open in IMG/M
3300005364\|Ga0070673_100488609	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales	1112	Open in IMG/M
3300005364\|Ga0070673_102324009	All Organisms → cellular organisms → Bacteria	510	Open in IMG/M
3300005438\|Ga0070701_10202990	All Organisms → cellular organisms → Bacteria	1173	Open in IMG/M
3300005457\|Ga0070662_100411101	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1118	Open in IMG/M
3300005526\|Ga0073909_10269706	All Organisms → cellular organisms → Bacteria	763	Open in IMG/M
3300005536\|Ga0070697_100989841	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	747	Open in IMG/M
3300005543\|Ga0070672_101599560	Not Available	585	Open in IMG/M
3300005577\|Ga0068857_102380285	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	520	Open in IMG/M
3300005617\|Ga0068859_100253858	All Organisms → cellular organisms → Bacteria	1849	Open in IMG/M
3300005617\|Ga0068859_101274328	Not Available	810	Open in IMG/M
3300005719\|Ga0068861_100068063	All Organisms → cellular organisms → Bacteria	2750	Open in IMG/M
3300005719\|Ga0068861_101823654	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium	604	Open in IMG/M
3300005764\|Ga0066903_100106738	All Organisms → cellular organisms → Bacteria	3815	Open in IMG/M
3300005764\|Ga0066903_100817183	Not Available	1670	Open in IMG/M
3300005764\|Ga0066903_101652462	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1217	Open in IMG/M
3300005764\|Ga0066903_105187582	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	689	Open in IMG/M
3300005764\|Ga0066903_108662816	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Bradymonadales → Bradymonadaceae → unclassified Bradymonadaceae → Bradymonadaceae bacterium	517	Open in IMG/M
3300005841\|Ga0068863_100488074	All Organisms → cellular organisms → Bacteria	1212	Open in IMG/M
3300005843\|Ga0068860_101647834	All Organisms → cellular organisms → Bacteria → Acidobacteria	663	Open in IMG/M
3300006046\|Ga0066652_100791748	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	906	Open in IMG/M
3300006237\|Ga0097621_100241336	All Organisms → cellular organisms → Bacteria	1580	Open in IMG/M
3300006847\|Ga0075431_100903725	Not Available	852	Open in IMG/M
3300006852\|Ga0075433_11166772	Not Available	669	Open in IMG/M
3300006854\|Ga0075425_101036165	All Organisms → cellular organisms → Bacteria	936	Open in IMG/M
3300006871\|Ga0075434_100431742	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1338	Open in IMG/M
3300006881\|Ga0068865_100776710	All Organisms → cellular organisms → Bacteria	825	Open in IMG/M
3300009092\|Ga0105250_10380004	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	623	Open in IMG/M
3300009100\|Ga0075418_10443752	All Organisms → cellular organisms → Bacteria	1390	Open in IMG/M
3300009100\|Ga0075418_10792217	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1023	Open in IMG/M
3300009100\|Ga0075418_11456007	Not Available	743	Open in IMG/M
3300009148\|Ga0105243_11818141	Not Available	641	Open in IMG/M
3300009148\|Ga0105243_12316649	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	575	Open in IMG/M
3300009148\|Ga0105243_12796294	All Organisms → cellular organisms → Bacteria	528	Open in IMG/M
3300009156\|Ga0111538_10479936	All Organisms → cellular organisms → Bacteria	1576	Open in IMG/M
3300009162\|Ga0075423_10353983	All Organisms → cellular organisms → Bacteria	1540	Open in IMG/M
3300009162\|Ga0075423_12618657	Not Available	551	Open in IMG/M
3300009176\|Ga0105242_12123801	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	606	Open in IMG/M
3300009177\|Ga0105248_10328937	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia felis	1721	Open in IMG/M
3300009177\|Ga0105248_11696945	Not Available	716	Open in IMG/M
3300010362\|Ga0126377_10002299	All Organisms → cellular organisms → Bacteria	13091	Open in IMG/M
3300010373\|Ga0134128_10446424	Not Available	1443	Open in IMG/M
3300010397\|Ga0134124_11569765	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	688	Open in IMG/M
3300010401\|Ga0134121_10083908	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2652	Open in IMG/M
3300010403\|Ga0134123_11412088	Not Available	737	Open in IMG/M
3300011271\|Ga0137393_10116084	All Organisms → cellular organisms → Bacteria → Acidobacteria	2203	Open in IMG/M
3300012212\|Ga0150985_119629086	All Organisms → cellular organisms → Bacteria → Acidobacteria	2330	Open in IMG/M
3300012354\|Ga0137366_10016925	All Organisms → cellular organisms → Bacteria	5712	Open in IMG/M
3300012360\|Ga0137375_10648993	Not Available	870	Open in IMG/M
3300012469\|Ga0150984_102988420	Not Available	905	Open in IMG/M
3300012469\|Ga0150984_122434477	All Organisms → cellular organisms → Bacteria → Acidobacteria	1369	Open in IMG/M
3300012510\|Ga0157316_1082361	Not Available	506	Open in IMG/M
3300012685\|Ga0137397_10395722	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1029	Open in IMG/M
3300012901\|Ga0157288_10322423	Not Available	549	Open in IMG/M
3300012958\|Ga0164299_10393352	Not Available	888	Open in IMG/M
3300012971\|Ga0126369_12451745	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	607	Open in IMG/M
3300013306\|Ga0163162_12373275	All Organisms → cellular organisms → Bacteria → Acidobacteria	610	Open in IMG/M
3300013308\|Ga0157375_10873448	All Organisms → cellular organisms → Bacteria → Acidobacteria	1045	Open in IMG/M
3300015245\|Ga0137409_10221923	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1692	Open in IMG/M
3300015371\|Ga0132258_10031141	All Organisms → cellular organisms → Bacteria	11922	Open in IMG/M
3300015371\|Ga0132258_10124286	All Organisms → cellular organisms → Bacteria	6138	Open in IMG/M
3300015371\|Ga0132258_11328498	All Organisms → cellular organisms → Bacteria	1817	Open in IMG/M
3300015372\|Ga0132256_101334141	Not Available	830	Open in IMG/M
3300015373\|Ga0132257_100003631	All Organisms → cellular organisms → Bacteria	14380	Open in IMG/M
3300015373\|Ga0132257_101592209	Not Available	835	Open in IMG/M
3300015373\|Ga0132257_101822503	Not Available	782	Open in IMG/M
3300015374\|Ga0132255_100485143	Not Available	1813	Open in IMG/M
3300015374\|Ga0132255_100692319	Not Available	1513	Open in IMG/M
3300018476\|Ga0190274_12015733	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_65_14	673	Open in IMG/M
3300018476\|Ga0190274_12711647	Not Available	592	Open in IMG/M
3300018482\|Ga0066669_12160242	Not Available	527	Open in IMG/M
3300022756\|Ga0222622_10004020	Not Available	6446	Open in IMG/M
3300025315\|Ga0207697_10071521	All Organisms → cellular organisms → Bacteria	1453	Open in IMG/M
3300025321\|Ga0207656_10670828	All Organisms → cellular organisms → Bacteria	530	Open in IMG/M
3300025893\|Ga0207682_10054183	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales	1666	Open in IMG/M
3300025901\|Ga0207688_10436271	All Organisms → cellular organisms → Bacteria	815	Open in IMG/M
3300025908\|Ga0207643_10750393	Not Available	632	Open in IMG/M
3300025923\|Ga0207681_10314963	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales	1242	Open in IMG/M
3300025925\|Ga0207650_10052606	All Organisms → cellular organisms → Bacteria → Acidobacteria	3017	Open in IMG/M
3300025926\|Ga0207659_10473047	All Organisms → cellular organisms → Bacteria	1058	Open in IMG/M
3300025926\|Ga0207659_11646223	Not Available	547	Open in IMG/M
3300025934\|Ga0207686_11219779	Not Available	616	Open in IMG/M
3300025936\|Ga0207670_10235123	Not Available	1409	Open in IMG/M
3300025961\|Ga0207712_10750240	All Organisms → cellular organisms → Bacteria → Acidobacteria	855	Open in IMG/M
3300025961\|Ga0207712_12146115	Not Available	500	Open in IMG/M
3300026075\|Ga0207708_10935788	Not Available	751	Open in IMG/M
3300027903\|Ga0209488_11029329	Not Available	568	Open in IMG/M
3300027907\|Ga0207428_10414031	Not Available	986	Open in IMG/M
3300028379\|Ga0268266_11350253	Not Available	688	Open in IMG/M
3300028380\|Ga0268265_11795787	All Organisms → cellular organisms → Bacteria → Acidobacteria	619	Open in IMG/M
3300031538\|Ga0310888_10003907	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis	5006	Open in IMG/M
3300031740\|Ga0307468_100421571	All Organisms → cellular organisms → Bacteria → Acidobacteria	1028	Open in IMG/M
3300031740\|Ga0307468_101109417	Not Available	706	Open in IMG/M
3300031890\|Ga0306925_11779495	Not Available	591	Open in IMG/M
3300031944\|Ga0310884_10042463	All Organisms → cellular organisms → Bacteria → Acidobacteria	1995	Open in IMG/M
3300031995\|Ga0307409_101924753	Not Available	621	Open in IMG/M
3300032013\|Ga0310906_10589706	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	764	Open in IMG/M
3300032179\|Ga0310889_10331633	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	741	Open in IMG/M
3300032261\|Ga0306920_100418997	Not Available	1991	Open in IMG/M
3300032397\|Ga0315287_10012802	All Organisms → cellular organisms → Bacteria	8643	Open in IMG/M
3300033412\|Ga0310810_11493225	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium	502	Open in IMG/M
3300033475\|Ga0310811_10125743	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis	3274	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	54.55%
Environmental	Environmental	45.45%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	54.55%
Terrestrial	Environmental → Terrestrial	43.94%
Aquatic	Environmental → Aquatic	1.52%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	43.94%
Rhizosphere	Host-Associated → Plants → Rhizosphere	31.06%
Rhizoplane	Host-Associated → Plants → Rhizoplane	22.73%
Freshwater	Environmental → Aquatic → Freshwater	0.76%
Sediment	Environmental → Aquatic → Sediment	0.76%
Roots	Host-Associated → Plants → Roots	0.76%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	31.06%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	17.42%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	14.39%
Soil	Host-Associated → Plants → Rhizosphere → Soil	13.64%
Loam	Environmental → Terrestrial → Soil → Loam	12.88%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	8.33%
Lake	Environmental → Aquatic → Freshwater → Lake	0.76%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.76%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.76%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	17.42%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	14.39%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	14.39%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	13.64%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	8.33%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	6.06%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	6.06%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	4.55%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	3.79%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	3.03%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	3.03%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	3.03%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	0.76%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.76%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.76%

Habitat	Taxonomy	Distribution
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	8.33%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	6.06%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	6.06%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	6.06%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	6.06%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	5.30%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	4.55%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	4.55%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	4.55%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	3.79%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	3.79%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	3.03%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	3.03%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	3.03%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	3.03%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	3.03%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	2.27%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	1.52%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	1.52%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	1.52%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	1.52%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	1.52%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	1.52%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	1.52%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	0.76%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.76%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	0.76%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	0.76%
Grass Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil	0.76%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	0.76%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.76%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere	0.76%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere	0.76%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	0.76%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere	0.76%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.76%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.76%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.76%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.76%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.76%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.76%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2170459004	Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm (2)	Environmental	Open in IMG/M
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental	Open in IMG/M
3300001431	Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly	Environmental	Open in IMG/M
3300001686	Grasslands soil microbial communities from Hopland, California, USA	Environmental	Open in IMG/M
3300004114	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5	Environmental	Open in IMG/M
3300004153	Grasslands soil microbial communities from Hopland, California, USA (version 2)	Environmental	Open in IMG/M
3300004156	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1	Environmental	Open in IMG/M
3300004157	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2	Environmental	Open in IMG/M
3300004463	Combined assembly of Arabidopsis thaliana microbial communities	Host-Associated	Open in IMG/M
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental	Open in IMG/M
3300004480	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4	Environmental	Open in IMG/M
3300004643	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3	Environmental	Open in IMG/M
3300005093	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks	Environmental	Open in IMG/M
3300005179	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133	Environmental	Open in IMG/M
3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2	Host-Associated	Open in IMG/M
3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1	Host-Associated	Open in IMG/M
3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Host-Associated	Open in IMG/M
3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Host-Associated	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Host-Associated	Open in IMG/M
3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Environmental	Open in IMG/M
3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Host-Associated	Open in IMG/M
3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Host-Associated	Open in IMG/M
3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Environmental	Open in IMG/M
3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Host-Associated	Open in IMG/M
3300005526	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1	Environmental	Open in IMG/M
3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Environmental	Open in IMG/M
3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Host-Associated	Open in IMG/M
3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Host-Associated	Open in IMG/M
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated	Open in IMG/M
3300006046	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101	Environmental	Open in IMG/M
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated	Open in IMG/M
3300006847	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Host-Associated	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Host-Associated	Open in IMG/M
3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Host-Associated	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated	Open in IMG/M
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental	Open in IMG/M
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental	Open in IMG/M
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300011271	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG	Environmental	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012354	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG	Environmental	Open in IMG/M
3300012360	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG	Environmental	Open in IMG/M
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated	Open in IMG/M
3300012510	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610	Host-Associated	Open in IMG/M
3300012685	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG	Environmental	Open in IMG/M
3300012901	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1	Environmental	Open in IMG/M
3300012958	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated	Open in IMG/M
3300015245	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300018476	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T	Environmental	Open in IMG/M
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental	Open in IMG/M
3300022756	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1	Environmental	Open in IMG/M
3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)	Host-Associated	Open in IMG/M
3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)	Host-Associated	Open in IMG/M
3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)	Environmental	Open in IMG/M
3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300027903	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)	Environmental	Open in IMG/M
3300027907	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)	Host-Associated	Open in IMG/M
3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300031538	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1	Environmental	Open in IMG/M
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental	Open in IMG/M
3300031890	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)	Environmental	Open in IMG/M
3300031944	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1	Environmental	Open in IMG/M
3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Host-Associated	Open in IMG/M
3300032013	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3	Environmental	Open in IMG/M
3300032179	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2	Environmental	Open in IMG/M
3300032261	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)	Environmental	Open in IMG/M
3300032397	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0	Environmental	Open in IMG/M
3300033412	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC	Environmental	Open in IMG/M
3300033475	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
E4B_06568340	2170459004	Grass Soil	EAMSKRSKRIALILVGIAMAILAVAQHFGWIAGPPPLLAPGIQ
JGI10216J12902_1005382833	3300000956	Soil	MSKRSKRIALILVGIAMALLAVAQHFGWIAGPPPLLAPGIQ*
JGI10216J12902_1024639383	3300000956	Soil	MGKKSTRIAMILLLLVMAFLAVAQHFGWIAGPPPLLAPGVR*
F14TB_1001363102	3300001431	Soil	MGEKSKRIAMILILVVMALLAVAQHFGWIAGPPPLLAPGVR
C688J18823_103074634	3300001686	Soil	MSNRSKRILLILVGAAIVLLAVAQHFGWIAGPPPLLAPGIQPNS*
Ga0062593_1019890202	3300004114	Soil	MSKTSKRIAMILVGVVMALLAVAQHFGWIAGPPPLLAPGVK*
Ga0063455_1004422242	3300004153	Soil	MSKRSKRIAMISVGVAIALLAVAQYFGWIAGPPPLLAPGI
Ga0063455_1011513451	3300004153	Soil	MSNRSKRILLILVGAAIVLLAVAQHFGWIAGPPPLLAPGIQPNF*
Ga0062589_1011789441	3300004156	Soil	MSKRSKRIALILVGVAIALLAVAQHFGWIAGPPPLLAPGIQ*
Ga0062589_1012007751	3300004156	Soil	GVCAETERLEMISKKSKGIAMILIVVVMAFLAVAQHFGWIAGPPPLLAPGVQ*
Ga0062590_1027518821	3300004157	Soil	EAMSKRSKRIALILVGVGMAFLAVARHFGWIAGPPPLLAPGFQ*
Ga0063356_1003130242	3300004463	Arabidopsis Thaliana Rhizosphere	VGNRQGRKVMSKKSKRIAMILVGVVIALLAVAQHFGWITGPPPLLAPGIQ*
Ga0063356_1032932282	3300004463	Arabidopsis Thaliana Rhizosphere	MSKRSKRIAALILVGGAMALLAVAQHFGWIAGPPPLLAPGIQ*
Ga0063356_1040918441	3300004463	Arabidopsis Thaliana Rhizosphere	AMSQRSKRIALILVGIAMALLAVAQYAGWIAGPPPILAPGIQ*
Ga0063356_1055383962	3300004463	Arabidopsis Thaliana Rhizosphere	MSKKSKRIAMILVVVVMAFLAVAQHFGWIAGPPPLLAPGVH*
Ga0062595_1000460392	3300004479	Soil	VAEGVCAETERLGMISKKSKGIAMILIVVVMAFLAVAQHFGWIAGPPPLLAPGVQ*
Ga0062592_1016541222	3300004480	Soil	MSKRSKRIALILVGVAMALLAVAQHFGWIAGPPPLLAPGIQ*
Ga0062591_1013101961	3300004643	Soil	MSKKSKRIAMILAGVVMALLAVAQHFGWIAGPPPLLAPGIQ*
Ga0062594_1033285762	3300005093	Soil	MSTKSKRIAMILVGVVMALLAVAQHFGWIAGPPPLLAPGIQ*
Ga0066684_103629902	3300005179	Soil	MSKRSKRIALILVGVAMALLAVAQHFGWIAGPPPLLAPGI
Ga0065704_103397642	3300005289	Switchgrass Rhizosphere	MSKKAKRMALIFVGVAMALLAVAQHFGWIAGPPPLLAPGIQ*
Ga0065712_100682924	3300005290	Miscanthus Rhizosphere	MISKKSKGIAMILIVVVMAFLAVAQHFGWIAGPPPLLAPGVQ*
Ga0070676_112693071	3300005328	Miscanthus Rhizosphere	MMSKKSKRIAMILVVVVMALLAVAQHFGWIAGPPPLLAPGVQ*
Ga0070670_1003067312	3300005331	Switchgrass Rhizosphere	MSKKSRRIAMILVGIVMALLAVAQHFGWIAGPPPLLAPGIQ*
Ga0070670_1014582922	3300005331	Switchgrass Rhizosphere	MSKRSKRIALILVGVAMVLLAVAQHFGWIAGPPPLLAPGIQ*
Ga0066388_1017709651	3300005332	Tropical Forest Soil	VSKECRRIAIILVGVTMAFLAVAQQFGWIAGPPPFLATGIH*
Ga0066388_1045295431	3300005332	Tropical Forest Soil	MSRRSKRIALILLGITMALLAVAQHFGWIAGPPPLLAPGIQ*
Ga0066388_1076137252	3300005332	Tropical Forest Soil	MSKKSKRIAMILVGVVMAFLAVAQHFGWIAGPPPLLAPGIH*
Ga0070666_105861342	3300005335	Switchgrass Rhizosphere	VAEGVCAETERLEMISKKSKGIAMILIVVVMAFLAVAQHFGWIAGPPPLLAPGVQ*
Ga0070680_1013424922	3300005336	Corn Rhizosphere	MSKKSKRIAMILVGVAMALLAVAQHFGWIAGPPPLLAPGIQ*
Ga0070675_1000846483	3300005354	Miscanthus Rhizosphere	MSKKSKRIAMILVGVVIALLAVAQHFGWIAGPPPLLAPGIQ*
Ga0070673_1004886091	3300005364	Switchgrass Rhizosphere	MSTKSKRIAMILVGVVMALLAVAQHFGWIAGPPPLLAPGIR*
Ga0070673_1023240091	3300005364	Switchgrass Rhizosphere	TERREAMSKRSARIALIMVGIAMALLAVAQHFGWIAGPPPLLAPGMQ*
Ga0070701_102029902	3300005438	Corn, Switchgrass And Miscanthus Rhizosphere	MSKKSKRIAMILVGVAMALLAVAQHFGWIAGPPPLLAPGIR*
Ga0070662_1004111012	3300005457	Corn Rhizosphere	MSKKSKRIAMLLVGVVIAILAVAQHFGWIAGPPPLLAPGIQ*
Ga0073909_102697063	3300005526	Surface Soil	MSKKSKRIAMILVVVVMTFLAVAQHFGWIAGPPPLLAPGVQ*
Ga0070697_1009898412	3300005536	Corn, Switchgrass And Miscanthus Rhizosphere	KREQKGGKVMSKKSKRIAMFLAGVVMALLTVAQHFGWIAGPPPLLAPGIQ*
Ga0070672_1015995602	3300005543	Miscanthus Rhizosphere	MSKKSKRIAMILVVAVMAFLAVAQHFGWIAGPPPLLAPGVQ*
Ga0068857_1023802852	3300005577	Corn Rhizosphere	MSKRSTRIAMILVVVVMAFLAVAQHFGWIAGPPPLLAPGIQ*
Ga0068859_1002538584	3300005617	Switchgrass Rhizosphere	SKRSKRIALILVGVAMVLLAVAQHFGWIAGPPPLLAPGIQ*
Ga0068859_1012743282	3300005617	Switchgrass Rhizosphere	MSKRSKRIALILVGTAMALLAVAQHLGWIAGPPPLLAPG
Ga0068861_1000680632	3300005719	Switchgrass Rhizosphere	MSKRSKRIALILLGTAMALLAVAQHLGWIAGPPPLLAPGIQ*
Ga0068861_1018236541	3300005719	Switchgrass Rhizosphere	TERREMMSKKSKRIAMILVVVVMALLAVAQHFGWIAGPPPLLAPGVQ*
Ga0066903_1001067384	3300005764	Tropical Forest Soil	MSKKSKRIAMIVLGVVLVLLAVAQHFGWIAGPPPLLAPGIQ*
Ga0066903_1008171831	3300005764	Tropical Forest Soil	MSKKSRRIALILVGVVMAVLAVAQHFGWIAGPPPLLAPGIQ*
Ga0066903_1016524621	3300005764	Tropical Forest Soil	MSKRSTRIALILVGVAMALLAVAQHFGWIAGPPPLLAP
Ga0066903_1051875822	3300005764	Tropical Forest Soil	ERREVMSKKSKRIAFVLFGVAMAILAVAQHFGWIAGPPPLLAPGIQ*
Ga0066903_1086628161	3300005764	Tropical Forest Soil	TRIALILVGVAMALLAVAQHFGWIAGPPPLLAPGIQ*
Ga0068863_1004880741	3300005841	Switchgrass Rhizosphere	SKRIAMILVVVVMTFLAVAQHFGWIAGPPPLLAPGVQ*
Ga0068860_1016478342	3300005843	Switchgrass Rhizosphere	TERREAMSKRSKRVALVVVGVAMALLAVAQHFGWIAGPPPLLALGIQ*
Ga0066652_1007917481	3300006046	Soil	TERREAMSKRSKRIALILVGVAMALLAVAQHFGWIAGPPPLLAPGIQ*
Ga0097621_1002413362	3300006237	Miscanthus Rhizosphere	MSKKSKRIALILVGVAMTVLAVAQHFGWIAGPPPLLAPGIQ*
Ga0075431_1009037251	3300006847	Populus Rhizosphere	MSKKSKRIAMILVVVVMAFLAVAQHFGWIAGPPPLLAPGVQ*
Ga0075433_111667722	3300006852	Populus Rhizosphere	MMSKRSTRIAMILVVVVMAFLAVAQHFGWIAGPPPLLAPGIQ*
Ga0075425_1010361651	3300006854	Populus Rhizosphere	RREMMSKKSKRIAMILVVVVMAFLAVAQHFGWIAGPPPLLAPGIQ*
Ga0075434_1004317421	3300006871	Populus Rhizosphere	VSKREQKAGEAMSKKSKWIAMILIGVVLALMAVARHFGWIAGPAPLLAPGIR*
Ga0068865_1007767102	3300006881	Miscanthus Rhizosphere	SKRIALILLGTAMALLAVAQHLGWIAGPPPLLAPGIQ*
Ga0105250_103800042	3300009092	Switchgrass Rhizosphere	ETERLGMISKKSKGIAMILIVVVMAFLAVAQHFGWIAGPPPLLAPGVQ*
Ga0075418_104437522	3300009100	Populus Rhizosphere	MMSKKSKRIAMILVVVVMAFLAVAQHFGWIAGPPPL
Ga0075418_107922171	3300009100	Populus Rhizosphere	ERREMMSKKSKRIAMILVVVVMAFLAVAQHFGWIAGPPPLLAPGVQ*
Ga0075418_114560071	3300009100	Populus Rhizosphere	MSKKAKRMALIFVGVAMALLAVAQHFGWIAGPPPLLAP
Ga0105243_118181411	3300009148	Miscanthus Rhizosphere	AMSKKSTRIAMILVGVVMALVAVAQHFGWIAGPPPLLAPGIQ*
Ga0105243_123166491	3300009148	Miscanthus Rhizosphere	MMSKRSTRIAMILVVVVMAFLAVAQHFRWIAGPPPLLAPGIQ*
Ga0105243_127962941	3300009148	Miscanthus Rhizosphere	VAEGVCAETERLGMISKKSKGIAMILIVVVMAFLAVAQHFGWIAGPPP
Ga0111538_104799363	3300009156	Populus Rhizosphere	MSKRSKRIAALILVGGAMALLAVAQHFGWIAGPPPLFAPGIQ*
Ga0075423_103539831	3300009162	Populus Rhizosphere	RIAMILVVVVMAFLAVAQHFGWIAGPPPLLAPGIQ*
Ga0075423_126186571	3300009162	Populus Rhizosphere	EMMSKKSKRIAMILVVVVMAFLAVAQHFGWIAGPPPLLAPGVQ*
Ga0105242_121238012	3300009176	Miscanthus Rhizosphere	MSRKSKRIAMILFGVVLALLAVAQHFGWIAGPPPVLAPGIR*
Ga0105248_103289372	3300009177	Switchgrass Rhizosphere	MSKKSKRIALILVGVGMAVLAVAQHFGWIAGPPPLLAPGIQ*
Ga0105248_116969451	3300009177	Switchgrass Rhizosphere	MSKRSKRIAVFLVGLAMALLAVAQHFGWIAGPPPLLAPGIQ*
Ga0126377_100022995	3300010362	Tropical Forest Soil	MSKRSARIALILVGIVMALLAVVQHFGWIAGPPPLLAPGIQ*
Ga0134128_104464242	3300010373	Terrestrial Soil	MSKRSTRIAMILVVVVMAFLAVAQHFGWIAGPPPLLAPGIN*
Ga0134124_115697653	3300010397	Terrestrial Soil	MSRKSKRIAMILVGVVMALLAVAQHFGWIAGPPPLLAPGIR
Ga0134121_100839082	3300010401	Terrestrial Soil	MSKKSKRIAMIVLGVVMALLALAQHFGWIAGPPPVLAPGIH*
Ga0134123_114120882	3300010403	Terrestrial Soil	MSNTSKRIALILLGTAMALLAVAQHLGWIAGPPPLLAPGIQ*
Ga0137393_101160844	3300011271	Vadose Zone Soil	MSKRSKRIALILVGLAMALLAVAQHFGWIAGPPPLLAPGIQ*
Ga0150985_1196290862	3300012212	Avena Fatua Rhizosphere	MSKKSKQIVMALVLVMMALLAIAQHFGWIAAPPPLLAPGIQ*
Ga0137366_100169254	3300012354	Vadose Zone Soil	MSKRSKRIALILVGIAMALLAVAQHFGWIAGPPPLLAPEIQ*
Ga0137375_106489933	3300012360	Vadose Zone Soil	MSKKSKRIAVILVGVVMALLAVAQHFGWIAGVPPLLAPGLQ*
Ga0150984_1029884202	3300012469	Avena Fatua Rhizosphere	ARARGRCLRGNRRRAVRSDKSKRIAMIILVGMAFMAVAQHFGWIAGPPPLLAPGQ*
Ga0150984_1224344771	3300012469	Avena Fatua Rhizosphere	DVMSKKSKQIVMALVQVMMALLAIAQHFGWIAAPPPLLAPGIQ*
Ga0157316_10823612	3300012510	Arabidopsis Rhizosphere	RGDTRVMEAESREMMSKKSKRIAMILVVVVMAFLAVAQHFGWIAGPPPLLAPGVH*
Ga0137397_103957221	3300012685	Vadose Zone Soil	TERREAMSKRSKRIALILVGIAMALLAVAQHLGWIAGPPPLLAPGIQ*
Ga0157288_103224232	3300012901	Soil	MNKKSQRIALVALGVFIALAAAQHFGWIDGPPPLLAPGIH*
Ga0164299_103933522	3300012958	Soil	LCLGISEGVDAETERRERMSKKSKRIAMILVVVVMTFLAVAQHFGWIAGPPPLLAPGVQ*
Ga0126369_124517451	3300012971	Tropical Forest Soil	MSKRSTRIALILVGVAMALLAVAQHFGWIAGPPPLLA
Ga0163162_123732751	3300013306	Switchgrass Rhizosphere	MSKKSKRIAMIVVGVVMALLAVAQHFGWIAGPPPLLAPGIH*
Ga0157375_108734482	3300013308	Miscanthus Rhizosphere	AEGVCAETERLGMISKKSKGIAMILIVVVMAFLAVAQHFGWIAGPPPLLAPGVQ*
Ga0137409_102219232	3300015245	Vadose Zone Soil	MSKESKRIAMILVGVVMALLAVAQHFGWIAGPPPLLAPGIQ*
Ga0132258_1003114114	3300015371	Arabidopsis Rhizosphere	MSKNSKRIGMILFVLVMAFLAVAQHFGWIAGPPPLLAPGVQ*
Ga0132258_101242862	3300015371	Arabidopsis Rhizosphere	MSRPSRRVTLVVVGLLIALVAIARYLGWLADAPPLLAPGIR*
Ga0132258_113284981	3300015371	Arabidopsis Rhizosphere	RIALILVGVAMALLAVAQHFGWIAGPPPLLAPGIQ*
Ga0132256_1013341412	3300015372	Arabidopsis Rhizosphere	MEAESREMMSKKSKRIAMILVVVVMAFLAVAQHFGWIAGPPPLLAPGVQ*
Ga0132257_10000363112	3300015373	Arabidopsis Rhizosphere	IAMILIVVVMVFLALAQHFGWIAGPPPLLAPGVH*
Ga0132257_1015922092	3300015373	Arabidopsis Rhizosphere	SKRIALIFVGVAMVVLAVAQHFGWIAGPPPLLAPGIQ*
Ga0132257_1018225031	3300015373	Arabidopsis Rhizosphere	REMMSKKSKRIAMILVVVVMALLAVAQHFGWIAGPPPLLAPGVQ*
Ga0132255_1004851435	3300015374	Arabidopsis Rhizosphere	MSKNSKRIGMILFVLVMAFLAAAQHFGWIAGPPPLLAPGVQ*
Ga0132255_1006923191	3300015374	Arabidopsis Rhizosphere	RIALILVGVAMALLAVAQHFGWIAGPPPLLAPGVQ*
Ga0190274_120157331	3300018476	Soil	MSKKSKQIAMILVVVVIAFLAVAQHFGWIAGPPPLLAPGVE
Ga0190274_127116472	3300018476	Soil	MNKQSRRIALVALGLFVAFMAVAQHFGWIAGPPPLLAPGIH
Ga0066669_121602422	3300018482	Grasslands Soil	VNKTQRVVLILVGIAMVLLAVAQYFGWIAGPPPLLAPGVQ
Ga0222622_100040208	3300022756	Groundwater Sediment	MMSNKSKRIAMILVVVVIAFLAVAQHFGWIAGPPPLLAPGVQ
Ga0207697_100715212	3300025315	Corn, Switchgrass And Miscanthus Rhizosphere	MSKRSKRIALILVGVAMALLAVAQHFGWIAGPPPLLAPGMQ
Ga0207656_106708281	3300025321	Corn Rhizosphere	MISKKSKGIAMILIVVVMAFLAVAQHFGWIAGPPPLLAPGVQ
Ga0207682_100541833	3300025893	Miscanthus Rhizosphere	MSTKSKRIAMILVGVVMALLAVAQHFGWIAGPPPLLAPGIQ
Ga0207688_104362712	3300025901	Corn, Switchgrass And Miscanthus Rhizosphere	VAEGVCAETERLEMISKKSKGIAMILIVVVMAFLAVAQHFGWIAGPPPLLAPGVQ
Ga0207643_107503932	3300025908	Miscanthus Rhizosphere	REVMSTKSKRIAMILVGVVMALLAVAQHFGWIAGPPPLLAPGIQ
Ga0207681_103149632	3300025923	Switchgrass Rhizosphere	MSTKSKRIAMILVGVVMALLAVARHFGWIAGPPPLLAPGIQ
Ga0207650_100526064	3300025925	Switchgrass Rhizosphere	MSKKSRRIAMILVGIVMALLAVAQHFGWIAGPPPLLAPGIQ
Ga0207659_104730472	3300025926	Miscanthus Rhizosphere	VAEGVCAETERLGMISKKSKGIAMILIVVVMAFLAVAQHFGWIAGPPPLLAPGVQ
Ga0207659_116462231	3300025926	Miscanthus Rhizosphere	MSKKSKRIAMILVVVVMAFLAVAQHFGWIAGPPPLL
Ga0207686_112197792	3300025934	Miscanthus Rhizosphere	AETERLEMISKKSKGIAMILIVVVMAFLAVAQHFGWIAGPPPLLAPGVQ
Ga0207670_102351233	3300025936	Switchgrass Rhizosphere	KKSKRIAMILVGVVIALLAVAQHFGWITGPPPLLAPGTQ
Ga0207712_107502402	3300025961	Switchgrass Rhizosphere	KSKRIAMILAGVVMALLAVAQHFGWIAGPPPLLAPGIQ
Ga0207712_121461152	3300025961	Switchgrass Rhizosphere	KRSKRIALILLGTAMALLAVAQHLGWIAGPPPLLAPGIQ
Ga0207708_109357881	3300026075	Corn, Switchgrass And Miscanthus Rhizosphere	EGLDVMSKKSKRIAMILVGVAMALLAIAQHFGWIAGPPPLLAPGIQ
Ga0209488_110293291	3300027903	Vadose Zone Soil	MSKRSKRIALILVGVAIALLAVAQHFGWIAGPPPLLAPGIQ
Ga0207428_104140312	3300027907	Populus Rhizosphere	MMSKKSKRIAMILVVVVMAFLAVAQHFGWIAGPPPLLAPGVQ
Ga0268266_113502531	3300028379	Switchgrass Rhizosphere	GFRPETERWEVMSKKSKRIALILVGVAIALLAIGQRFGWIAGPPPLLAPGIQ
Ga0268265_117957871	3300028380	Switchgrass Rhizosphere	MSKKSKRIAMILAGVVMALLAVAQHFGWIAGPPPLLAPGIQ
Ga0310888_100039071	3300031538	Soil	MSKKSKRIAMILVVVVMAFLAVAQHFGWIAGPPPLLAPGV
Ga0307468_1004215713	3300031740	Hardwood Forest Soil	MSKRSKRIALILVGIAMALLAVAQLVGWIAGPPPLLAPGIQ
Ga0307468_1011094172	3300031740	Hardwood Forest Soil	MSKKSKRIAMILVGVVMALLAVAQHFGWIAGPPPLLAPGIQ
Ga0306925_117794952	3300031890	Soil	MSKRSKRIALILVGVVMALLAVAHHFGWIAGPPPLLAP
Ga0310884_100424631	3300031944	Soil	MSKKSKRIAMILVVVVMAFLAVAQHFGWIAGPPPLLAPGVH
Ga0307409_1019247531	3300031995	Rhizosphere	SGNRRREMMSKNSKRIAMILVVVVIAFLAVAQHFGWIAGPPPLLAPGVQ
Ga0310906_105897061	3300032013	Soil	MGKKSTRIAMILILVVMALLAVAQHFGWIAGPPPLLAP
Ga0310889_103316331	3300032179	Soil	GVQVGNRQGRKVMSKKSKRIAMILVGVVIALLAVAQHFGWITGPPPLLAPGTQ
Ga0306920_1004189971	3300032261	Soil	MSKRSKRIALILVGVVMALLAVAHHFGWIAGPPPLLAPGIR
Ga0315287_1001280212	3300032397	Sediment	MSRPSWRVALVVVGVMMALVAIAQHLGWLAGPPPLLAPGIR
Ga0310810_114932252	3300033412	Soil	KAREMSKKSKRIAMILVVVVMAVLAVAQHFGWIAGPPPLLAPGVQ
Ga0310811_101257437	3300033475	Soil	MSKKSKRIAMILVVVVMAVLAVAQHFGWIAGPPPLLAPGVQ

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F061001

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences