NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F061224

Metagenome / Metatranscriptome Family F061224

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F061224
Family Type Metagenome / Metatranscriptome
Number of Sequences 132
Average Sequence Length 43 residues
Representative Sequence YDLAPTILHIYGIEQPAQMRGHVLSEIFENSDNKVAQK
Number of Associated Samples 117
Number of Associated Scaffolds 132

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.76 %
% of genes near scaffold ends (potentially truncated) 96.21 %
% of genes from short scaffolds (< 2000 bps) 92.42 %
Associated GOLD sequencing projects 111
AlphaFold2 3D model prediction Yes
3D model pTM-score0.30

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.970 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(19.697 % of family members)
Environment Ontology (ENVO) Unclassified
(25.758 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(44.697 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 33.33%    β-sheet: 0.00%    Coil/Unstructured: 66.67%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.30
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 132 Family Scaffolds
PF14559TPR_19 49.24
PF13432TPR_16 17.42
PF12867DinB_2 8.33
PF00884Sulfatase 4.55
PF02129Peptidase_S15 2.27
PF00171Aldedh 1.52
PF00106adh_short 0.76
PF13088BNR_2 0.76
PF01261AP_endonuc_2 0.76
PF13181TPR_8 0.76
PF01663Phosphodiest 0.76
PF07676PD40 0.76
PF13358DDE_3 0.76
PF16918PknG_TPR 0.76
PF14686fn3_3 0.76

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 132 Family Scaffolds
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 1.52
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 1.52
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 1.52

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.73 %
UnclassifiedrootN/A2.27 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2199352024|deeps__Contig_128341All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium761Open in IMG/M
3300001593|JGI12635J15846_10386806All Organisms → cellular organisms → Archaea → Euryarchaeota → Thermococci → Thermococcales → Thermococcaceae → Thermococcus → unclassified Thermococcus → Thermococcus sp. 4557848Open in IMG/M
3300002245|JGIcombinedJ26739_101452089All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300004082|Ga0062384_101010442All Organisms → cellular organisms → Bacteria → Proteobacteria595Open in IMG/M
3300004152|Ga0062386_100750574All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium802Open in IMG/M
3300004635|Ga0062388_100496009All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1091Open in IMG/M
3300005434|Ga0070709_10608831All Organisms → cellular organisms → Bacteria842Open in IMG/M
3300005436|Ga0070713_101856606All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300005451|Ga0066681_10961194All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300005542|Ga0070732_10450528All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium778Open in IMG/M
3300005586|Ga0066691_10924386All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300005712|Ga0070764_10079204All Organisms → cellular organisms → Bacteria1727Open in IMG/M
3300005952|Ga0080026_10043847All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1157Open in IMG/M
3300006102|Ga0075015_100759872All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium579Open in IMG/M
3300006172|Ga0075018_10754509All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium530Open in IMG/M
3300006755|Ga0079222_10872741All Organisms → cellular organisms → Bacteria749Open in IMG/M
3300006794|Ga0066658_10051857All Organisms → cellular organisms → Bacteria → Acidobacteria1766Open in IMG/M
3300006800|Ga0066660_10993059All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium675Open in IMG/M
3300006852|Ga0075433_11280861All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300006854|Ga0075425_101139806All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium887Open in IMG/M
3300007258|Ga0099793_10114888All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1254Open in IMG/M
3300007258|Ga0099793_10624448All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300009787|Ga0116226_10247043All Organisms → cellular organisms → Bacteria1848Open in IMG/M
3300010048|Ga0126373_10032776All Organisms → cellular organisms → Bacteria4509Open in IMG/M
3300010048|Ga0126373_10333499All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1524Open in IMG/M
3300010159|Ga0099796_10127587All Organisms → cellular organisms → Bacteria983Open in IMG/M
3300010360|Ga0126372_10325546All Organisms → cellular organisms → Bacteria1365Open in IMG/M
3300010375|Ga0105239_10290008All Organisms → cellular organisms → Bacteria1843Open in IMG/M
3300010376|Ga0126381_100783152All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1368Open in IMG/M
3300010376|Ga0126381_100789685All Organisms → cellular organisms → Bacteria → Acidobacteria1363Open in IMG/M
3300010398|Ga0126383_10917039Not Available963Open in IMG/M
3300011270|Ga0137391_10535820All Organisms → cellular organisms → Bacteria988Open in IMG/M
3300011271|Ga0137393_11186483All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300012096|Ga0137389_10682373All Organisms → cellular organisms → Bacteria883Open in IMG/M
3300012096|Ga0137389_11316200All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300012203|Ga0137399_10655336All Organisms → cellular organisms → Bacteria883Open in IMG/M
3300012207|Ga0137381_11411185All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium588Open in IMG/M
3300012357|Ga0137384_10787785All Organisms → cellular organisms → Bacteria769Open in IMG/M
3300012361|Ga0137360_10799095All Organisms → cellular organisms → Bacteria → Acidobacteria812Open in IMG/M
3300012361|Ga0137360_10973233All Organisms → cellular organisms → Bacteria732Open in IMG/M
3300012362|Ga0137361_10277859All Organisms → cellular organisms → Bacteria1530Open in IMG/M
3300012469|Ga0150984_119608518All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300012494|Ga0157341_1027848All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300012918|Ga0137396_11305926All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300012925|Ga0137419_11975130All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300012927|Ga0137416_10683723All Organisms → cellular organisms → Bacteria900Open in IMG/M
3300012927|Ga0137416_11950688All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium538Open in IMG/M
3300012948|Ga0126375_10512806All Organisms → cellular organisms → Bacteria897Open in IMG/M
3300012960|Ga0164301_10114683All Organisms → cellular organisms → Bacteria1578Open in IMG/M
3300013308|Ga0157375_13292451All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium538Open in IMG/M
3300014201|Ga0181537_10743917All Organisms → cellular organisms → Bacteria666Open in IMG/M
3300014495|Ga0182015_10533826All Organisms → cellular organisms → Bacteria748Open in IMG/M
3300014501|Ga0182024_10258990All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2327Open in IMG/M
3300015051|Ga0137414_1168740All Organisms → cellular organisms → Bacteria1434Open in IMG/M
3300015082|Ga0167662_1013692All Organisms → cellular organisms → Bacteria1014Open in IMG/M
3300016294|Ga0182041_10196213All Organisms → cellular organisms → Bacteria1603Open in IMG/M
3300016294|Ga0182041_11772447All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300016357|Ga0182032_10988538All Organisms → cellular organisms → Bacteria718Open in IMG/M
3300016387|Ga0182040_10276532All Organisms → cellular organisms → Bacteria1273Open in IMG/M
3300017930|Ga0187825_10226598All Organisms → cellular organisms → Bacteria679Open in IMG/M
3300018060|Ga0187765_10501764All Organisms → cellular organisms → Bacteria768Open in IMG/M
3300018482|Ga0066669_10572739All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium986Open in IMG/M
3300019789|Ga0137408_1231985All Organisms → cellular organisms → Bacteria2529Open in IMG/M
3300019879|Ga0193723_1128767All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium696Open in IMG/M
3300020010|Ga0193749_1050084All Organisms → cellular organisms → Bacteria801Open in IMG/M
3300020140|Ga0179590_1066306All Organisms → cellular organisms → Bacteria947Open in IMG/M
3300020140|Ga0179590_1118128All Organisms → cellular organisms → Bacteria719Open in IMG/M
3300020579|Ga0210407_10777566All Organisms → cellular organisms → Bacteria739Open in IMG/M
3300020580|Ga0210403_11465688All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300020581|Ga0210399_10255308All Organisms → cellular organisms → Bacteria1462Open in IMG/M
3300020581|Ga0210399_11189129All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium606Open in IMG/M
3300020582|Ga0210395_11065998All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300020583|Ga0210401_10820489All Organisms → cellular organisms → Bacteria790Open in IMG/M
3300021180|Ga0210396_10114723All Organisms → cellular organisms → Bacteria2432Open in IMG/M
3300021405|Ga0210387_10345626All Organisms → cellular organisms → Bacteria1314Open in IMG/M
3300021405|Ga0210387_10553692All Organisms → cellular organisms → Bacteria1023Open in IMG/M
3300021420|Ga0210394_10841525All Organisms → cellular organisms → Bacteria800Open in IMG/M
3300021432|Ga0210384_10844031All Organisms → cellular organisms → Bacteria815Open in IMG/M
3300021433|Ga0210391_10740517All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium769Open in IMG/M
3300021475|Ga0210392_10272500All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1206Open in IMG/M
3300021478|Ga0210402_11358646All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium638Open in IMG/M
3300021560|Ga0126371_10454096All Organisms → cellular organisms → Bacteria1427Open in IMG/M
3300022532|Ga0242655_10052349All Organisms → cellular organisms → Bacteria1010Open in IMG/M
3300024288|Ga0179589_10367193All Organisms → cellular organisms → Bacteria → Acidobacteria656Open in IMG/M
3300025544|Ga0208078_1080021All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium672Open in IMG/M
3300025612|Ga0208691_1160879All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium506Open in IMG/M
3300025900|Ga0207710_10507143All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium626Open in IMG/M
3300025906|Ga0207699_10910076All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300025907|Ga0207645_11189383All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300025915|Ga0207693_11312604All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300025922|Ga0207646_11500699All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300026088|Ga0207641_11459134All Organisms → cellular organisms → Bacteria685Open in IMG/M
3300026326|Ga0209801_1222131All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium739Open in IMG/M
3300026329|Ga0209375_1249366All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300026557|Ga0179587_11195295All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300027562|Ga0209735_1081376All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium703Open in IMG/M
3300027576|Ga0209003_1089236All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium577Open in IMG/M
3300027587|Ga0209220_1055215All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1059Open in IMG/M
3300027676|Ga0209333_1026740All Organisms → cellular organisms → Bacteria1621Open in IMG/M
3300027894|Ga0209068_10847959All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300027903|Ga0209488_10093635All Organisms → cellular organisms → Bacteria2247Open in IMG/M
3300027908|Ga0209006_10340085All Organisms → cellular organisms → Bacteria1273Open in IMG/M
3300028138|Ga0247684_1064917All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300028536|Ga0137415_10578788All Organisms → cellular organisms → Bacteria933Open in IMG/M
3300028536|Ga0137415_10870834All Organisms → cellular organisms → Bacteria711Open in IMG/M
3300029943|Ga0311340_11274521All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300030054|Ga0302182_10504816All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300030058|Ga0302179_10377453All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300030503|Ga0311370_10389545All Organisms → cellular organisms → Bacteria1757Open in IMG/M
3300031234|Ga0302325_10021356All Organisms → cellular organisms → Bacteria13557Open in IMG/M
3300031236|Ga0302324_100381127All Organisms → cellular organisms → Bacteria2114Open in IMG/M
3300031525|Ga0302326_13030938Not Available572Open in IMG/M
3300031546|Ga0318538_10520412Not Available645Open in IMG/M
3300031640|Ga0318555_10693011All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300031668|Ga0318542_10558226All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300031708|Ga0310686_119020185All Organisms → cellular organisms → Bacteria1096Open in IMG/M
3300031719|Ga0306917_10854073All Organisms → cellular organisms → Bacteria713Open in IMG/M
3300031720|Ga0307469_10232480All Organisms → cellular organisms → Bacteria1468Open in IMG/M
3300031720|Ga0307469_11886695All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300031771|Ga0318546_10414158All Organisms → cellular organisms → Bacteria942Open in IMG/M
3300031793|Ga0318548_10562364All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300031823|Ga0307478_11177550All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300031823|Ga0307478_11465242All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium565Open in IMG/M
3300031912|Ga0306921_10931852All Organisms → cellular organisms → Bacteria984Open in IMG/M
3300031962|Ga0307479_10010702All Organisms → cellular organisms → Bacteria8532Open in IMG/M
3300031962|Ga0307479_10128617All Organisms → cellular organisms → Bacteria2476Open in IMG/M
3300031962|Ga0307479_11076157All Organisms → cellular organisms → Bacteria771Open in IMG/M
3300032160|Ga0311301_10694708All Organisms → cellular organisms → Bacteria1432Open in IMG/M
3300032174|Ga0307470_10083321All Organisms → cellular organisms → Bacteria1773Open in IMG/M
3300032180|Ga0307471_103491578All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium556Open in IMG/M
3300032892|Ga0335081_10012971All Organisms → cellular organisms → Bacteria13485Open in IMG/M
3300033158|Ga0335077_11351707All Organisms → cellular organisms → Bacteria689Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil19.70%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil15.91%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil6.82%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil6.06%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil5.30%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa5.30%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.55%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.55%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.03%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.27%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.27%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.52%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.52%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.76%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.76%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.76%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.76%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.76%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.76%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.76%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.76%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.76%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.76%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.76%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.76%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.76%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.76%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.76%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.76%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.76%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.76%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.76%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.76%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.76%
Host-AssociatedHost-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated0.76%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2199352024Bare-fallow DEEP SOILEnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005952Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300009787Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fa - Sphagnum fallax MGHost-AssociatedOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010159Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012494Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610Host-AssociatedOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015051Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015082Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11c, vegetated hydrological feature)EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300017930Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5EnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019789Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300019879Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2EnvironmentalOpen in IMG/M
3300020010Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s2EnvironmentalOpen in IMG/M
3300020140Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022532Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300025544Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 deep-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025612Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)EnvironmentalOpen in IMG/M
3300026329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027562Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027576Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027587Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027676Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300028138Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030054Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1EnvironmentalOpen in IMG/M
3300030058Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1EnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
deeps_023277002199352024SoilEASVYDLTPTILHLYGIEQPKQMHGHVLTEIFQTSTDKVAQK
JGI12635J15846_1038680613300001593Forest SoilTFFAMGPNIKHDLRLMGLEASVYDITPTILSLYGIEQPKQMHGHVLTQIFEGSGNVVAQK
JGIcombinedJ26739_10145208923300002245Forest SoilLGVIVYDVTPTLLRIYGIEKPKQMRGRVLSQTFENADSKVAAKQ*
Ga0062384_10101044223300004082Bog Forest SoilPGIKHDLRLMGFEVSVYDIAPTILHLYGIEQPAQMRGRVVSAIFESPGGTVAQK*
Ga0062386_10075057413300004152Bog Forest SoilAASVYDIAPTVLHIYGIEQPAQMRGHVLTNIFVSADKKQASNH*
Ga0062388_10049600923300004635Bog Forest SoilFEVSVYDIAPTILHLYGIEQPVQMRGHVLSEIFESSRGTVAQK*
Ga0070709_1060883123300005434Corn, Switchgrass And Miscanthus RhizosphereASVYDIAPTLLHIYGIEQPKQMRGRVLTEVFAAPENNKVAAKN*
Ga0070713_10185660623300005436Corn, Switchgrass And Miscanthus RhizosphereYDIAPTLLHIYGIEQPKQMRGRVLTEVFAAPENNKVAAKN*
Ga0066681_1096119423300005451SoilMGFEASVYDVAPTILHLYGIEQPKQMRGHVLSEIFETSRDRVAQK*
Ga0070732_1045052813300005542Surface SoilPTILHIYGIEQPAQMRGHVLTEIFERSDNKVAQK*
Ga0066691_1092438613300005586SoilDVAPTLLHLYGIEQPKQMRGRILTEIFENSDNKVAVKK*
Ga0070764_1007920413300005712SoilAASVYDIAPTILHIYGIEQPKQMRGHVLRDIFVEPERKAGQQ*
Ga0080026_1004384723300005952Permafrost SoilKHDLRLMGFQASVYDIAPTILHIYGIEQPAQMRGHVLTEIFEGSPSKVAQK*
Ga0075015_10075987223300006102WatershedsDIAPTILHIYGIEQPAQMRGHVLSTIFENSEGTVAQK*
Ga0075018_1075450923300006172WatershedsLRLMGFEASVYDLAPTILHLYGIEQSKQMRGHVLSEIFENPDDKLVQK*
Ga0079222_1087274133300006755Agricultural SoilMSVFDIAPTILHLYGISAPAQMKRRVLTEIFAGSGAS
Ga0066658_1005185713300006794SoilVAPTILHVYGIEQPKQMRGHVLSEIFENAENKVALQK*
Ga0066660_1099305913300006800SoilIAPTVLHIYGIEPPKQMRGHVLSEIFESSENKVALQK*
Ga0075433_1128086113300006852Populus RhizosphereIKRDFRVMGLAASVYDIAPTILSIYGIDQPKQMHGHALSEIFEKRETKAAAGN*
Ga0075425_10113980623300006854Populus RhizosphereLRLMGFEASVYDIAPTILRIYQVDPPKQMRGHVLEEIFETKQGKPSQN*
Ga0099793_1011488823300007258Vadose Zone SoilMGFEASVYDIAPTILHIYGVEPPKQMRGHVLDEIFGTPGDQAAQR*
Ga0099793_1062444813300007258Vadose Zone SoilTLLHIYGIEQPKQMRGRVLTEIFESSDNKVAAEK*
Ga0116226_1024704323300009787Host-AssociatedPTILHLYGIQQPSQMHGHVLTQIFETSEKNLAQK*
Ga0126373_1003277613300010048Tropical Forest SoilTVLHIYGIEQPKQMRGRVLTEIFEQSDPKSAAKQ*
Ga0126373_1033349933300010048Tropical Forest SoilGFEASVYDITPTILHLYGIEQPKQMRGHVLTEIFQNSGEKVAQK*
Ga0099796_1012758713300010159Vadose Zone SoilDIAPTLLHIYGIEQPKQMRGRVLTEVFEGAENKVAASK*
Ga0126372_1032554623300010360Tropical Forest SoilVYDLAPTILHLYGIDPAKQMRGRVLNEIFENSDGKVAQK*
Ga0105239_1029000813300010375Corn RhizosphereVYDIAPTILHIYGINVPGQMRGHFLSDIFEREETRAAN*
Ga0126381_10078315213300010376Tropical Forest SoilSVFDIAPTILHLYGIEQPAQMEGHVLTEIFENSDNRVARK*
Ga0126381_10078968513300010376Tropical Forest SoilAPTILHIYGIEQPAQMEGHVLTEIFENSDNKVALQK*
Ga0126383_1091703923300010398Tropical Forest SoilEASVYDIAPTILSIYGIQPPQQMRGRVLVEIFENPPSNAAAQ*
Ga0137391_1053582013300011270Vadose Zone SoilLRLMGFEASVYDIAPTILSLYGIAEPTQMHGHVLTQIFEGSANNVAQK*
Ga0137393_1118648323300011271Vadose Zone SoilYDVAPTLLHIYGIEQPKQMRGRVLTEIFESSDNKVAAKK*
Ga0137389_1068237313300012096Vadose Zone SoilSVYDVAPTLLHLYGIEQPKQMRGRILTEIFENSDNKVAVKK*
Ga0137389_1131620013300012096Vadose Zone SoilKHDLRLRGFEATVYDVAPTILHVYGIAQPKQMHGHVLSEIFENAENKVALQK*
Ga0137399_1065533613300012203Vadose Zone SoilKHDLRLMGLAASVYDVAPTLLYLYGIEQPKQMRGRVLTEIFESSDNKVAVKK*
Ga0137381_1141118513300012207Vadose Zone SoilIKHDLRLMGFEATVYDIAPTILHLYGIEQPKQMRGHVLSVIFENSPNKVAQK*
Ga0137384_1078778523300012357Vadose Zone SoilRLMGLGASVYDVAPTLLYIYGIEQPKQMRGRVLTEIFDGSENKVAMQK*
Ga0137360_1079909513300012361Vadose Zone SoilKHGLRLMGFEVSVYDIAPTILHIYGIEQPLQMRGHVVSDIFENSDKAIAQK*
Ga0137360_1097323323300012361Vadose Zone SoilAPTLLHIYGIEQPKQMRGRVLTEVFEGAENKVAASK*
Ga0137361_1027785923300012362Vadose Zone SoilLRLMGFEATVYDVAPTILHLYGIEQPKQMRGHVLSVIFENSPNKVAQE*
Ga0150984_11960851823300012469Avena Fatua RhizosphereMGFEASVYDVAPTILHLYGIDQPKQMRGRVLTEIFDNAGSTTAVQN*
Ga0157341_102784823300012494Arabidopsis RhizosphereYDLAPTILHLYGIDPSKQMRGRVLSEIFEKFDGKVAQKE*
Ga0137396_1130592613300012918Vadose Zone SoilLMGFEASVYDIAPTILHIYGVEPPKQMRGHVLDEIFGTPGDQAAQR*
Ga0137419_1197513023300012925Vadose Zone SoilYDIAPTILHIYRVEPPKQMRGHVLDGIFETPGNKVAQK*
Ga0137416_1068372313300012927Vadose Zone SoilLRLMGFEATVYDVAPTILHVYGIEQPKQMRGHVLSEIFENAENKVALQK*
Ga0137416_1195068813300012927Vadose Zone SoilPTILHIYLVEPPKQMRGHVLDEIFETPGNKVAQK*
Ga0126375_1051280623300012948Tropical Forest SoilYDIAPTILHIYGIEQPKQMHGHLLSEIFEKRETKAAAGN*
Ga0164301_1011468313300012960SoilVFDIAPTILRIYGIEQPKQMQGHVLTEVFESGARRAAGGGGK*
Ga0157375_1329245113300013308Miscanthus RhizosphereASVYDIAPTLLRIYQVDPPKQLRGHVLEEIFATKEGKPTRN*
Ga0181537_1074391713300014201BogMGPNIKHDLRLMGFEASVYDITPTILYLYGIQQPPQMHGHVLTQIFEGSANTVAQK*
Ga0182015_1053382623300014495PalsaMGFAASVYDIAPTILHLYGIEQPPQMRGHVLSDIFVNAGKTVAER*
Ga0182024_1025899013300014501PermafrostRLMGLDASVYDIAPTILSLYGIEQPKQMHGHVLTQIFEGSGNVVAQK*
Ga0137414_116874023300015051Vadose Zone SoilMGFEASVYDIAPTILRIYQVDPPKQMRGHVLDEIFEPKQSKSTLN*
Ga0167662_101369213300015082Glacier Forefield SoilDITPTILHIYGIEQPKQMRGRVLTEIFEGGGNKTVSTSSK*
Ga0182041_1019621313300016294SoilDVAPTVLHIYGIEQPKQMRGRVLTEIFEKADNKVAAKQ
Ga0182041_1177244713300016294SoilMGLAASVYDIAPTILHIYGLEQPLQMRGRVLTEIFAHAENKVAAQK
Ga0182032_1098853823300016357SoilLMGFEASVYDITPTILHIYGIEQPKQMRGHVLSEIFESASDKVAMQK
Ga0182040_1027653223300016387SoilYDVAPTVLYIYGIEQPKQMRGRVLTEIFEKSDNKVTAKQ
Ga0187825_1022659813300017930Freshwater SedimentSVYDLAPTILHLYGIDPSKQMRGRVLSEIFENSDGKVAQK
Ga0187765_1050176413300018060Tropical PeatlandYDITPTILHLYGIEQPKQMRGHVLTAIFESSENKVAQK
Ga0066669_1057273913300018482Grasslands SoilSVYDVAPTILHIYGIAQPEQMHGHVLSEIFEAGDSKVAKK
Ga0137408_123198513300019789Vadose Zone SoilMGLAASVYDVAPTLLHIYGIEQPKQMRGRILTEIFEGSGTKVAAKQ
Ga0193723_112876713300019879SoilHDLRLMGFEASVYDVAPTILHLYGIQQPTQMRGHVLSEIFENSPNKVAQK
Ga0193749_105008413300020010SoilPGIKHNSRLMGFEASVYDITPTILHIYGIEQPKQMRWRALTEIFDNSQNKALSGSSK
Ga0179590_106630623300020140Vadose Zone SoilRLMGFEASVYDLAPTILRIYQVDPPKQMRGHVLEEIFETKEGKPSRN
Ga0179590_111812823300020140Vadose Zone SoilPTILHIYGVEKPKQMRGRVLTEIFENPDNKVATKQ
Ga0210407_1077756613300020579SoilVYDVAPTLLHIYGLEQPKQMRGRILTEIFENADNKVAAKQ
Ga0210403_1146568813300020580SoilDITPTILHLYGIEQPKQMRGHVLTEIFENSPEKVAQK
Ga0210399_1025530813300020581SoilQRLMGFQASVYDIAPTILHLYGIEQPKQMRGHVLSEIFEASTDRVAMQK
Ga0210399_1118912923300020581SoilLAPTILHLYGIEQPKQMRGHVLSEIFENPDDKLVQK
Ga0210395_1106599813300020582SoilSVYDVAPTIFHIYGIEQPKQMRGHVLTQIFEDSDKKVALKQ
Ga0210401_1082048913300020583SoilLMGLDASVYDIAPTVLHIYGIAQPPQMHGRILDEIFLSSENKTAQR
Ga0210396_1011472313300021180SoilTILHIYGIEQPKQMRGRVLTEIFDNSQNKALSGSSK
Ga0210387_1034562613300021405SoilLMGFEASVYDITPTILHLYGIEQPKQMRGHVLTELFENSSANVAEK
Ga0210387_1055369233300021405SoilMGFEASVYDIAPTILHVYGIDPPKQMRGHVLSEIFEASTDKVAMQK
Ga0210394_1084152513300021420SoilDLRLMGLGASVYDVAPTLLYIYGIEQPKQMRGRILTEIFENANNKVAAKQ
Ga0210384_1084403123300021432SoilLAPTLLHLYGIEQSKQMRGHVLTEIFENSSDRVAQK
Ga0210391_1074051723300021433SoilTPTILHIYGIEQPSQMRGHVLTEIFEASDNKVAQN
Ga0210392_1027250013300021475SoilVYDLAPTLLHLYGIEQSKQMRGHVLTEIFENSSDRVAQK
Ga0210402_1135864623300021478SoilDLAPTILHLYGIEQSKQMRGHVLSEIFENPDDKLVQK
Ga0126371_1045409613300021560Tropical Forest SoilIAPTILHIYGIEQPKQMRGRVLTEIFDASESKVALQK
Ga0242655_1005234913300022532SoilDITPTILHLYGIEQPKQMRGHVLTEIFETSPNKVAQK
Ga0179589_1036719313300024288Vadose Zone SoilASVYDIAPTILSLYGIAEPTQMHGHVLTQIFEGSANNVAQK
Ga0208078_108002113300025544Arctic Peat SoilYDITPTILHIYGIEQPKQMRGRVLTEIFENNQNKALSGSSR
Ga0208691_116087913300025612PeatlandVYDIAPTILHIYGIDQPAQMHGHVLTEIFENSDKVVAQK
Ga0207710_1050714313300025900Switchgrass RhizosphereGPGIKHGLRLMGFEASVYDIAPTILRIYQVDPPKQMRGHVLEEIFATKEGKPTRN
Ga0207699_1091007623300025906Corn, Switchgrass And Miscanthus RhizosphereVSVYDVAPTILHLYGIEPTKQMHGHVLTQIFENADAKVAQK
Ga0207645_1118938313300025907Miscanthus RhizosphereASVYDIAPTILHIYGINVPGQMRGHFLSDIFEREETRAAN
Ga0207693_1131260423300025915Corn, Switchgrass And Miscanthus RhizosphereSVYDIAPTVLYIYGIDQPKQMRGHGLKAIFDGSQENAAQLSSPQ
Ga0207646_1150069923300025922Corn, Switchgrass And Miscanthus RhizosphereYDVAPTILHVYGIAQPKQMRGHVLSEIFENAENKVALQK
Ga0207641_1145913423300026088Switchgrass RhizosphereIAPTILHIYGIAQPPQMHGRVLTEIFEGNNGNVAEK
Ga0209801_122213113300026326SoilLRLMGFEASVYDIAPTILHIYGIGQPKQMRGHVLTEIFESSENKVASDR
Ga0209375_124936613300026329SoilPTILHLYGIEQPKQMHGHVLTEIFENPDNKVALQK
Ga0179587_1119529513300026557Vadose Zone SoilSVYDVTPTILHIYGIDQPKQMRGRVLTEIFEKTDNKVAAKQ
Ga0209735_108137623300027562Forest SoilFEASVYDIAPTILHIYRVEPPKQMRGHVLDEIFETPENKIAKE
Ga0209003_108923623300027576Forest SoilGFEASVYDIAPTILHIYGIGQPEQMRGHVLSEIFESSENKVALQK
Ga0209220_105521513300027587Forest SoilDLAPTILHIYGIEQPAQMRGHVLSEIFENSDNKVAQK
Ga0209333_102674023300027676Forest SoilAASVYDIAPTVLHLYGIEQPPQMRGHVLSDIFVNAGKTVAER
Ga0209068_1084795923300027894WatershedsVWDIAPTILHIYGIEQPKQMRGRVITEIFEAGGAKVAQK
Ga0209488_1009363513300027903Vadose Zone SoilDLRLMGFEASVYDLAPTILHIYGIEQPVQMRGHVLSEIFENSDKAIAKK
Ga0209006_1034008513300027908Forest SoilTILHIYGIEQPKQMRGRVLTEIFDTNQSKALSGSSK
Ga0247684_106491723300028138SoilDVTPTILHLYGIQQPKQMRGRVLTEIFETSTGTTAAKGGK
Ga0137415_1057878813300028536Vadose Zone SoilLRLMGFEATVYDVAPTILHVYGIEQPKQMRGHVLSEIFENAENKVALQK
Ga0137415_1087083413300028536Vadose Zone SoilASVYDVAPTLLYLYGIEQPKQMRGRVLTEIFESSDNKVAVKK
Ga0311340_1127452113300029943PalsaFAMGPNIKHDLRLMGFEASVYDITPTILSLYGIEQPKQMHGHVLTQIFEGSGNVVAQK
Ga0302182_1050481623300030054PalsaASVYDITPTILHIYGIEQTTQMRGHVLTEIFEKTPAAD
Ga0302179_1037745313300030058PalsaMGPNIKHDLRLMGLEASVYDLAPTILSLYGIAEPAQMHGHVLSQIFVGSGDAVASK
Ga0311370_1038954513300030503PalsaGPNIKHDLRLMGFEASVYDITPTILSLYGIEQPKQMHGHVLTQIFEGSGNVVAQK
Ga0302325_1002135613300031234PalsaVYDITPTILHIYGIEQTTQMRGHVLTEIFEKTPAAD
Ga0302324_10038112723300031236PalsaGLRLMGFEASVYDIAPTILHLYGIAQPPQMRGHVLSDIFDDAEKAVAQK
Ga0302326_1303093813300031525PalsaTILSLYGIEQPKQMHGHVLTQIFAGSGDVVAQKQLP
Ga0318538_1052041213300031546SoilVYDIAPTILRIFGIEQPMQMHGHALSEIFEKRETKATAGN
Ga0318555_1069301123300031640SoilYDIAPTILRIYGIEQPKQMHGHALSEIFEKRETKATAGN
Ga0318542_1055822623300031668SoilMGLAASVYDIAPTILRIYGIEQPKQMHGHALSEIFEKRETKATAGN
Ga0310686_11902018523300031708SoilPGTFFAMGPNIKHDLRLMGFEASVYDLAPTILSLYGIDQPKQMHGHVLTQIFEGSANTLAQK
Ga0306917_1085407333300031719SoilMGFEASVYDITPTILHIYGIEQPKQMRGHVLSEIFESASDKVAMQK
Ga0307469_1023248023300031720Hardwood Forest SoilRLMGLAASVYDVAPTLLHIYGVEQPKQMRGRVLTEIFESPGTKVVAKD
Ga0307469_1188669523300031720Hardwood Forest SoilIAPTLLHIYGIEQPKQMRGRVLSEVFTGTENKVAANQ
Ga0318546_1041415823300031771SoilYDIAPTILHIYGIEQPKQMRGRVLTEIFDTSESKVALQK
Ga0318548_1056236423300031793SoilIKRDFRVMGLAASVYDIAPTILRIYGIEQPKQMHGHALSEIFEKRETKATAGN
Ga0307478_1117755013300031823Hardwood Forest SoilFDASVYDIAPTLLRIYGIEQPKQMRGRILAEVFEAHDSKVAAKN
Ga0307478_1146524223300031823Hardwood Forest SoilSVYDIAPTILHLYGIEQPAQMRGHVLSAIFENSEGTVAQK
Ga0306921_1093185213300031912SoilGFEVSVYDVAPTLLHIYGIEEPKQMHGRVLTEIFEGSESKVSARN
Ga0307479_1001070253300031962Hardwood Forest SoilMGFEASVYDIAPTILHIYRVEPPKQMRGHVLDEIFETPGDKAAQR
Ga0307479_1012861733300031962Hardwood Forest SoilLMGFEASVYDIAPTILRIYGIEQPAPMRGHVLSEIFENSDKAIAQK
Ga0307479_1107615723300031962Hardwood Forest SoilKHGLRLMGFEASVYDLAPTVLHIYGVEQPKQMRGRVLSEIFEGAEGKVAQK
Ga0311301_1069470823300032160Peatlands SoilEVSVYDIAPTILHIYGIEQPAHMHGHVLTEIFDGSDSKVAQK
Ga0307470_1008332123300032174Hardwood Forest SoilMGFEASVYDIAPTILHRYGIEQPKQTGGHFLEQLFESANGAVATKTE
Ga0307471_10349157813300032180Hardwood Forest SoilYDLAPTILHIYGIEQPAQMRGHVLSEIFENSDNKVAQK
Ga0335081_10012971123300032892SoilYDIAPTILHLYGIDPPKQMRGHVLTAIFDNSENKVAQK
Ga0335077_1135170723300033158SoilASVYDIAPTILHIYGIEQPKQMHGHVLSAIFESPENKVAQK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.