NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F061594

Metagenome / Metatranscriptome Family F061594

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F061594
Family Type Metagenome / Metatranscriptome
Number of Sequences 131
Average Sequence Length 44 residues
Representative Sequence RLAGLKAVEPKLQAFYDSLDAKQKKAFDTGGRIGGIFDWWGKK
Number of Associated Samples 98
Number of Associated Scaffolds 131

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 7.63 %
% of genes near scaffold ends (potentially truncated) 80.92 %
% of genes from short scaffolds (< 2000 bps) 83.97 %
Associated GOLD sequencing projects 90
AlphaFold2 3D model prediction Yes
3D model pTM-score0.39

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.947 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(32.061 % of family members)
Environment Ontology (ENVO) Unclassified
(46.565 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(55.725 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 45.07%    β-sheet: 0.00%    Coil/Unstructured: 54.93%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.39
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 131 Family Scaffolds
PF14494DUF4436 6.11
PF04226Transgly_assoc 3.82
PF13396PLDc_N 2.29
PF09361Phasin_2 2.29
PF07813LTXXQ 2.29
PF06826Asp-Al_Ex 2.29
PF05036SPOR 1.53
PF13185GAF_2 1.53
PF13628DUF4142 1.53
PF05532CsbD 1.53
PF01738DLH 1.53
PF00027cNMP_binding 1.53
PF02656DUF202 1.53
PF03401TctC 0.76
PF00072Response_reg 0.76
PF00582Usp 0.76
PF00496SBP_bac_5 0.76
PF04392ABC_sub_bind 0.76
PF09694Gcw_chp 0.76
PF14833NAD_binding_11 0.76
PF13426PAS_9 0.76
PF01734Patatin 0.76
PF04343DUF488 0.76
PF13493DUF4118 0.76
PF01522Polysacc_deac_1 0.76
PF07045DUF1330 0.76
PF02371Transposase_20 0.76
PF02586SRAP 0.76
PF02668TauD 0.76
PF03069FmdA_AmdA 0.76
PF06035Peptidase_C93 0.76
PF00528BPD_transp_1 0.76
PF01594AI-2E_transport 0.76
PF02776TPP_enzyme_N 0.76
PF00239Resolvase 0.76
PF09925DUF2157 0.76
PF04828GFA 0.76
PF02735Ku 0.76
PF07687M20_dimer 0.76
PF07883Cupin_2 0.76
PF07690MFS_1 0.76
PF01425Amidase 0.76
PF17200sCache_2 0.76

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 131 Family Scaffolds
COG3678Periplasmic chaperone Spy, Spy/CpxP familyPosttranslational modification, protein turnover, chaperones [O] 9.16
COG2261Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein familyGeneral function prediction only [R] 3.82
COG2985Uncharacterized membrane protein YbjL, putative transporterGeneral function prediction only [R] 2.29
COG2149Uncharacterized membrane protein YidH, DUF202 familyFunction unknown [S] 1.53
COG3237Uncharacterized conserved protein YjbJ, UPF0337 familyFunction unknown [S] 1.53
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 0.76
COG0628Predicted PurR-regulated permease PerMGeneral function prediction only [R] 0.76
COG0726Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 familyCell wall/membrane/envelope biogenesis [M] 0.76
COG1273Non-homologous end joining protein Ku, dsDNA break repairReplication, recombination and repair [L] 0.76
COG1752Predicted acylesterase/phospholipase RssA, containd patatin domainGeneral function prediction only [R] 0.76
COG1961Site-specific DNA recombinase SpoIVCA/DNA invertase PinEReplication, recombination and repair [L] 0.76
COG2135ssDNA abasic site-binding protein YedK/HMCES, SRAP familyReplication, recombination and repair [L] 0.76
COG2175Taurine dioxygenase, alpha-ketoglutarate-dependentSecondary metabolites biosynthesis, transport and catabolism [Q] 0.76
COG2421Acetamidase/formamidaseEnergy production and conversion [C] 0.76
COG2452Predicted site-specific integrase-resolvaseMobilome: prophages, transposons [X] 0.76
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 0.76
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 0.76
COG3189Uncharacterized conserved protein YeaO, DUF488 familyFunction unknown [S] 0.76
COG3547TransposaseMobilome: prophages, transposons [X] 0.76
COG3621Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotRGeneral function prediction only [R] 0.76
COG3672Predicted transglutaminase-like proteinPosttranslational modification, protein turnover, chaperones [O] 0.76
COG3791Uncharacterized conserved proteinFunction unknown [S] 0.76
COG4667Predicted phospholipase, patatin/cPLA2 familyLipid transport and metabolism [I] 0.76
COG5470Uncharacterized conserved protein, DUF1330 familyFunction unknown [S] 0.76

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.95 %
UnclassifiedrootN/A3.05 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000793|AF_2010_repII_A001DRAFT_10003478All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3581Open in IMG/M
3300001305|C688J14111_10005642All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3459Open in IMG/M
3300002245|JGIcombinedJ26739_101105771All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans680Open in IMG/M
3300004463|Ga0063356_104880170All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium576Open in IMG/M
3300005353|Ga0070669_101535170All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium579Open in IMG/M
3300005466|Ga0070685_10025003All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae3286Open in IMG/M
3300005536|Ga0070697_101633815All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium576Open in IMG/M
3300005614|Ga0068856_102400494Not Available535Open in IMG/M
3300005764|Ga0066903_100028382All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH106244Open in IMG/M
3300005764|Ga0066903_104987636All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium704Open in IMG/M
3300005843|Ga0068860_101526717All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium690Open in IMG/M
3300005921|Ga0070766_10757951All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans659Open in IMG/M
3300006032|Ga0066696_10161798All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1404Open in IMG/M
3300006059|Ga0075017_100767427All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium744Open in IMG/M
3300006059|Ga0075017_101412428All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300006086|Ga0075019_10408577All Organisms → cellular organisms → Bacteria832Open in IMG/M
3300006893|Ga0073928_10078918All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2825Open in IMG/M
3300006954|Ga0079219_10455693All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium875Open in IMG/M
3300009176|Ga0105242_10375581All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1320Open in IMG/M
3300009545|Ga0105237_11832346All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium614Open in IMG/M
3300010162|Ga0131853_10986679All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium651Open in IMG/M
3300010358|Ga0126370_10245513All Organisms → cellular organisms → Bacteria → Proteobacteria1385Open in IMG/M
3300010358|Ga0126370_11213894All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae702Open in IMG/M
3300010376|Ga0126381_100110166All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae3538Open in IMG/M
3300010376|Ga0126381_104032540All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium571Open in IMG/M
3300010379|Ga0136449_104368045All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium522Open in IMG/M
3300010398|Ga0126383_10676440All Organisms → cellular organisms → Bacteria → Proteobacteria1109Open in IMG/M
3300012154|Ga0153953_1058922All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium708Open in IMG/M
3300012181|Ga0153922_1068308All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales793Open in IMG/M
3300012202|Ga0137363_10853658All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 1(2017)773Open in IMG/M
3300012948|Ga0126375_11563312All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium566Open in IMG/M
3300012971|Ga0126369_11554300All Organisms → cellular organisms → Bacteria → Proteobacteria751Open in IMG/M
3300012971|Ga0126369_12911185All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium560Open in IMG/M
3300013296|Ga0157374_10547330All Organisms → cellular organisms → Bacteria1165Open in IMG/M
3300015372|Ga0132256_103226592All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium548Open in IMG/M
3300016270|Ga0182036_10203124All Organisms → cellular organisms → Bacteria1454Open in IMG/M
3300016294|Ga0182041_11665734All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium590Open in IMG/M
3300016319|Ga0182033_10083692All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2293Open in IMG/M
3300016319|Ga0182033_10967096All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium756Open in IMG/M
3300016319|Ga0182033_11749127All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium564Open in IMG/M
3300016341|Ga0182035_10237890All Organisms → cellular organisms → Bacteria1463Open in IMG/M
3300016341|Ga0182035_10251950All Organisms → cellular organisms → Bacteria1426Open in IMG/M
3300016371|Ga0182034_10144170All Organisms → cellular organisms → Bacteria → Proteobacteria1780Open in IMG/M
3300016387|Ga0182040_10563483All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria918Open in IMG/M
3300016387|Ga0182040_10840631All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria758Open in IMG/M
3300016387|Ga0182040_11182199All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300016387|Ga0182040_11198433All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium639Open in IMG/M
3300016404|Ga0182037_10133231All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1847Open in IMG/M
3300016404|Ga0182037_10270120All Organisms → cellular organisms → Bacteria → Proteobacteria1354Open in IMG/M
3300016404|Ga0182037_11770644All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium551Open in IMG/M
3300016422|Ga0182039_10728275All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium876Open in IMG/M
3300016445|Ga0182038_12148633All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium506Open in IMG/M
3300017970|Ga0187783_10774888All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium692Open in IMG/M
3300018060|Ga0187765_10569437All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium727Open in IMG/M
3300020579|Ga0210407_10855716Not Available699Open in IMG/M
3300020581|Ga0210399_10072098All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2798Open in IMG/M
3300020598|Ga0180218_1116614All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rivibacter → Rivibacter subsaxonicus519Open in IMG/M
3300021168|Ga0210406_10461929All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1009Open in IMG/M
3300021168|Ga0210406_11339292All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans514Open in IMG/M
3300021168|Ga0210406_11387463Not Available502Open in IMG/M
3300021171|Ga0210405_10378561All Organisms → cellular organisms → Bacteria → Proteobacteria1115Open in IMG/M
3300021171|Ga0210405_10512941All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans939Open in IMG/M
3300021180|Ga0210396_10214979All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1714Open in IMG/M
3300021477|Ga0210398_10469701All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans1025Open in IMG/M
3300022557|Ga0212123_10082668Not Available2702Open in IMG/M
3300022717|Ga0242661_1015782All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1160Open in IMG/M
3300022724|Ga0242665_10034482All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1265Open in IMG/M
3300022731|Ga0224563_1020953All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium579Open in IMG/M
3300025922|Ga0207646_11360876All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium618Open in IMG/M
3300025942|Ga0207689_11523584All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium558Open in IMG/M
3300026358|Ga0257166_1005592All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 1(2017)1436Open in IMG/M
3300026497|Ga0257164_1008001All Organisms → cellular organisms → Bacteria1285Open in IMG/M
3300026817|Ga0207775_112778All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium643Open in IMG/M
3300026862|Ga0207724_1004086All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1436Open in IMG/M
3300027696|Ga0208696_1171068All Organisms → cellular organisms → Bacteria697Open in IMG/M
3300030494|Ga0310037_10013371All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3980Open in IMG/M
3300031231|Ga0170824_114545984All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2034Open in IMG/M
3300031231|Ga0170824_116579592All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1430Open in IMG/M
3300031446|Ga0170820_11909747All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium520Open in IMG/M
3300031545|Ga0318541_10395736All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium772Open in IMG/M
3300031546|Ga0318538_10495100All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium662Open in IMG/M
3300031561|Ga0318528_10717143All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales535Open in IMG/M
3300031564|Ga0318573_10481558All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium668Open in IMG/M
3300031573|Ga0310915_10039400All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3002Open in IMG/M
3300031573|Ga0310915_10569597All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium803Open in IMG/M
3300031573|Ga0310915_10794482All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium666Open in IMG/M
3300031668|Ga0318542_10595348All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium577Open in IMG/M
3300031679|Ga0318561_10317231All Organisms → cellular organisms → Bacteria853Open in IMG/M
3300031680|Ga0318574_10649863All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium618Open in IMG/M
3300031724|Ga0318500_10743647All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium501Open in IMG/M
3300031771|Ga0318546_10007426All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales5602Open in IMG/M
3300031771|Ga0318546_11289061All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium513Open in IMG/M
3300031781|Ga0318547_10224720All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1127Open in IMG/M
3300031793|Ga0318548_10028936All Organisms → cellular organisms → Bacteria → Proteobacteria2416Open in IMG/M
3300031796|Ga0318576_10424519All Organisms → cellular organisms → Bacteria628Open in IMG/M
3300031819|Ga0318568_10117236All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD00691607Open in IMG/M
3300031823|Ga0307478_10758505All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Roseiarcaceae → Roseiarcus → Roseiarcus fermentans813Open in IMG/M
3300031833|Ga0310917_10994011All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300031879|Ga0306919_10041831All Organisms → cellular organisms → Bacteria2977Open in IMG/M
3300031880|Ga0318544_10368574All Organisms → cellular organisms → Bacteria → Proteobacteria558Open in IMG/M
3300031890|Ga0306925_11084980All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium810Open in IMG/M
3300031890|Ga0306925_11806819All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium585Open in IMG/M
3300031897|Ga0318520_10355396All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium890Open in IMG/M
3300031910|Ga0306923_10242824All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2060Open in IMG/M
3300031910|Ga0306923_10507852All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1363Open in IMG/M
3300031910|Ga0306923_11302855All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium770Open in IMG/M
3300031910|Ga0306923_11567614All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium686Open in IMG/M
3300031912|Ga0306921_10148651All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2741Open in IMG/M
3300031912|Ga0306921_11098828All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium891Open in IMG/M
3300031912|Ga0306921_11556200All Organisms → cellular organisms → Bacteria → Proteobacteria720Open in IMG/M
3300031942|Ga0310916_11027195All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria687Open in IMG/M
3300031945|Ga0310913_10150947All Organisms → cellular organisms → Bacteria1606Open in IMG/M
3300031945|Ga0310913_10382496All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales998Open in IMG/M
3300031945|Ga0310913_10737591All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium696Open in IMG/M
3300031947|Ga0310909_11126460All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium637Open in IMG/M
3300032001|Ga0306922_10364346All Organisms → cellular organisms → Bacteria1550Open in IMG/M
3300032001|Ga0306922_11756623All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium612Open in IMG/M
3300032039|Ga0318559_10377795All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium660Open in IMG/M
3300032059|Ga0318533_11235903All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300032066|Ga0318514_10498053All Organisms → cellular organisms → Bacteria → Proteobacteria648Open in IMG/M
3300032076|Ga0306924_10390756All Organisms → cellular organisms → Bacteria1593Open in IMG/M
3300032076|Ga0306924_11424448All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium icense738Open in IMG/M
3300032076|Ga0306924_11576411All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium693Open in IMG/M
3300032094|Ga0318540_10534071All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium566Open in IMG/M
3300032119|Ga0316051_1015549All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium666Open in IMG/M
3300032160|Ga0311301_10180694All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3688Open in IMG/M
3300032160|Ga0311301_11691192All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium762Open in IMG/M
3300032898|Ga0335072_10225027All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2189Open in IMG/M
3300032955|Ga0335076_10155852All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2198Open in IMG/M
3300033805|Ga0314864_0002683All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3203Open in IMG/M
3300033805|Ga0314864_0094663All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria724Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil32.06%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil24.43%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil6.11%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.82%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil3.05%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.05%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.29%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.29%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring1.53%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.53%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland1.53%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.53%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.53%
Attine Ant Fungus GardensHost-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens1.53%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.76%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.76%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.76%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.76%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.76%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.76%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.76%
Termite GutHost-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut0.76%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.76%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.76%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.76%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.76%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.76%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.76%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.76%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.76%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.76%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000793Forest soil microbial communities from Amazon forest - 2010 replicate II A001EnvironmentalOpen in IMG/M
3300001305Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300010162Labiotermes labralis P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P1 (version 2)Host-AssociatedOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300012154Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ037 MetaGHost-AssociatedOpen in IMG/M
3300012181Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ006 MetaGHost-AssociatedOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020598Enriched backyard soil microbial communities from Emeryville, California, USA - eDNA 3rd pass 37_C Kraft BY (version 2)EnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300022717Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022724Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022731Soil microbial communities from Bohemian Forest, Czech Republic ? CSU4EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026358Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-14-BEnvironmentalOpen in IMG/M
3300026497Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-BEnvironmentalOpen in IMG/M
3300026817Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 17 (SPAdes)EnvironmentalOpen in IMG/M
3300026862Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 31 (SPAdes)EnvironmentalOpen in IMG/M
3300027696Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300030494Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032119Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSE5 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033805Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
AF_2010_repII_A001DRAFT_1000347873300000793Forest SoilPKLGAFYDTLDARQKRAFDNGGRIGGIFNWWGKR*
C688J14111_1000564233300001305SoilMAYAEKIAETRLARLKAIGPKLQAFYDSLDAKQKKAFDTGGRVGGLFAWFGKT*
JGIcombinedJ26739_10110577123300002245Forest SoilMKAIEPKLQAFYASLDDKQKHAIDAGSRVGGLFGWLNR*
Ga0063356_10488017013300004463Arabidopsis Thaliana RhizosphereMAEAKLAGLKAVEPKLQVFYDSLDEKQKKAFDTGGRIGGIFDWWRKK*
Ga0070669_10153517023300005353Switchgrass RhizosphereAEAKLAGLKAVEPKLQVFHDSLDEKQKKAFDNGGRIGGIFDWWRKK*
Ga0070685_1002500353300005466Switchgrass RhizosphereGTGLKAVGPKRQPFCDSPDANQKKAFDTGGRVGGMFDRLGNK*
Ga0070697_10163381523300005536Corn, Switchgrass And Miscanthus RhizosphereMAFAEKMAEIRVAGLKAIEPKLQAFYDTLDARQKRAFDAGGRIGGIFNWWGKT*
Ga0068856_10240049413300005614Corn RhizosphereETRLAGLKAVEPKLQAFYDSLDAKQKKAFDTGGRIGGIFDWWGKK*
Ga0066903_10002838283300005764Tropical Forest SoilLKEVEPKLQAFYDSLDAKQKKAFDTGGRIGGIFDWWGKK*
Ga0066903_10498763623300005764Tropical Forest SoilMKTVDPKLQAFYDSLDAKQKTAFDSGGRVGGIFSWLGKQ*
Ga0068860_10152671713300005843Switchgrass RhizosphereLKAVEPKLKAFYDSLDEKQKKAFDTGGRIGGIFDWWGKK*
Ga0070766_1075795113300005921SoilQLDGMKAIEPKLQAFYASLDDKQKHAIDGGSRVGGLFGWLNR*
Ga0066696_1016179813300006032SoilEPKLQAFYDTLDARQKRAFDTGGRIGGIFNWWGKR*
Ga0075017_10076742713300006059WatershedsLAGLKAVEPKLQAFYDSLDEKQKRAFDTGGRIGGIFDWWRKK*
Ga0075017_10141242813300006059WatershedsMVFAEKMAEIRLAGLKAIEPKLQAFYDTLDARQKRAFDTGRRNGGIFSWWGKT*
Ga0075019_1040857723300006086WatershedsMAETKLAGLKAVEPKLQAFYDSLDAKQKKAFDTGGRIGGIFDWWRKK*
Ga0073928_1007891863300006893Iron-Sulfur Acid SpringRAEWRAETKLAGLKAVEPKLQAFYDSLDAKQKEAFDTGGRIGGIFDWWGKK*
Ga0079219_1045569323300006954Agricultural SoilMAFAEKMAEIRVAGLKAIEPKLQAFYDTLDARQKRAFDTGGRIGGIFNWWGKT*
Ga0105242_1037558133300009176Miscanthus RhizosphereTPACARGTGLKAVGPKRQPFCDSPDANQKKAFDTGGRVGGMFDRLGNK*
Ga0105237_1183234623300009545Corn RhizosphereKAVGPKRQPFCDSPDANQKKAFDTGGRVGGMFDRLGSK*
Ga0131853_1098667913300010162Termite GutLKAVNPKLQAFYDGLDATQKKAFDTGGRVGGIFGWLRNK*
Ga0126370_1024551333300010358Tropical Forest SoilAERMAEVRLAGLKAIEPKLEAFYNTLDARQKRAFDTGGRIGGIFNWWGKR*
Ga0126370_1121389413300010358Tropical Forest SoilSLKAVEPKLQAFYDSLDAKQKKAFDTGGRIGGIFDWLGKK*
Ga0126381_10011016613300010376Tropical Forest SoilGLKAVEPKLQAFYDTLDASQKRAFDTGGRIGGIFNWWGKR*
Ga0126381_10403254013300010376Tropical Forest SoilGRMAFAEKIAETRLAGLKAVNPKLQAFYDGLDATQKKAFDTGGRVGGIFGWLRNK*
Ga0136449_10436804523300010379Peatlands SoilLKAVEPKLQAFYDSLDAKQKKAFDTGGRIGGIFDWWRKK*
Ga0126383_1067644033300010398Tropical Forest SoilAFAERMADVRLAGLKAIEPKLQAFYDTLDAQQKRAFNTGGRVGGIFNWWGKR*
Ga0153953_105892213300012154Attine Ant Fungus GardensLDGMKAIEPKLQAFYASLDDKQKHAFDTGGRVGGLFSWLGR*
Ga0153922_106830813300012181Attine Ant Fungus GardensTIEPKFQAFYDSLDAKQKKAFDTGGRVGGIFDWWGKK*
Ga0137363_1085365813300012202Vadose Zone SoilKLAGLKATEPKLKAFYDSLDVKQKKAFDTGGRIGGIFDWWGKK*
Ga0126375_1156331213300012948Tropical Forest SoilLASLKDVAPKLHAFYDSLDARQKKAFDTGGRVGGIFDWWGKK*
Ga0126369_1155430023300012971Tropical Forest SoilKAVEPKLQAFYDSLDAKQKKAFDTGGRIGGIFDWWGKK*
Ga0126369_1291118523300012971Tropical Forest SoilVPKLQAFYDSLDAKQKKAFDTGGRIGGIFDWWGKK*
Ga0157374_1054733013300013296Miscanthus RhizosphereGLKAVGPKRQPFCDSPDANQKKAFDTGGRVGGMFDRLGNK*
Ga0132256_10322659213300015372Arabidopsis RhizosphereMPGRAAFAERMAEVRLAGLKAIEPKLQAFYDTLDAQQKRAFNTGGRVGGIFNLVGQEIMVPRRL*
Ga0182036_1020312413300016270SoilKTAEIRLASLKAVEPRLQAFYDGLDEKQKKAFDTGGRVGGIFDWLGKK
Ga0182041_1166573413300016294SoilAEKMAEIRLAGLKAIEPKLQAFYETLDARQKRAFNTGGRVGGIFNWWGKR
Ga0182033_1008369213300016319SoilKAVEPKLQAFYDSLDAKQKNAFDTGGRIGGIFDWWGKK
Ga0182033_1096709613300016319SoilMAFAEKVAETRHAGLKAVNPKLQAFYDGLDAKQKRAFDTGGRVGGIFDWLRSK
Ga0182033_1174912723300016319SoilRLKAVEPKLQAFYDNLDAKQKKAFDTGGRIGGIFDWWSKK
Ga0182035_1023789033300016341SoilMAFAEKTAEISLASLKAVEPKLQAFYDGLDEKQKKAFDTGGRVGGIFDWLGKK
Ga0182035_1025195013300016341SoilEKTAETKVASLKAVEPKLQAFYDSLDEKQKKAFDTGGRVGGIFDWLRNK
Ga0182034_1014417023300016371SoilMAFAEKMAEIRLAGLKAIEPKLQAFYDTLDSRQKRAFDTGGRIGGIFNWWGKT
Ga0182040_1056348313300016387SoilRKDGAGLKAVEPKLQAFYDNLDAKQKKAFDTGGRIGGIFDWWSKK
Ga0182040_1084063113300016387SoilEPKLQAFYDSLDAKQKKAFDTGGRIGGIFDWWRKK
Ga0182040_1118219933300016387SoilSTGRLAFSEKMTQARLDGLKAIEPKPQAFYDGLDDKQKKAFDTGGRVGGFFDWWK
Ga0182040_1119843313300016387SoilKANCTTHLSTTPGRMAFAVKTAEISLASLKAVEPRLQAFYDGLDEKQKKAFDTGGRVGGIFDWLGKK
Ga0182037_1013323113300016404SoilRLAGLKAVEPKLQAFYDSLDAKQKKAFDTGGRIGGIFDWWGKKQ
Ga0182037_1027012033300016404SoilAEVRLAGLKAIEPKLEAFYNTLDARQKRAFDTGGRIGGIFNWWGKR
Ga0182037_1177064413300016404SoilMAETRLAGLKEVEPKLQAFYDTLDAKQKKAFDTGGRIGGIFDWWAKK
Ga0182039_1072827523300016422SoilETRLAGIKAVDPKLQAFYDSLDAKQKTAFDTGGRVGGMFDWWGKQ
Ga0182038_1214863313300016445SoilRLAGLKAVEPKLQAFYDRLDAKQKRAFDTGGRIGGIFDWWRKK
Ga0187783_1077488813300017970Tropical PeatlandAVEPKLQAFYDSLDAKQRKAFDTGGRIGGMFDWWGKK
Ga0187765_1056943713300018060Tropical PeatlandEPKLQAFYDSLDAKQKKAFDTGGRIGGMFDWLRRTLLR
Ga0210407_1085571623300020579SoilAGLKAVEPKLQAFYDSLDAKQKKAFDTGGRIGGIFDWWGKK
Ga0210399_1007209823300020581SoilMAEIRLAGLKAIEPKLEAFYDTLDARQKRAFDTGGRIGGIFN
Ga0180218_111661423300020598SoilVGPKLQAFYDSLDARQKRAFDTGGRVGGIFDWWGKK
Ga0210406_1046192913300021168SoilFAEKMAEIRLAGLKAIEPKLEAFYDTLDARQKRAFDTGGRIGGIFNWWGKT
Ga0210406_1133929223300021168SoilDGMKAIEPKLQAFYASLDDKQKHAIDAGSRVGGLFGWLNR
Ga0210406_1138746313300021168SoilEPKLQAFYDSLDAKQKKAFDTGGRIGGIFDWWGKK
Ga0210405_1037856123300021171SoilTKLAGLKAVEPKLQAFYDSLDAKQKKAFDTGGRIGGIFDWWRKK
Ga0210405_1051294123300021171SoilGMKAIEPKLQAFYASLDDKQKHAIDAGSRVGGLFGWLNR
Ga0210396_1021497913300021180SoilMKAIEPKLQAFYASLDDKQKHAIDAGSRVGGLFGWLNR
Ga0210398_1046970123300021477SoilLAFSEKVTQAQLDGMKAIEPKLQAFYASLDDKQKHAIDGGSRVGGLFGWLNR
Ga0212123_1008266813300022557Iron-Sulfur Acid SpringAETRLAGLKAVEPKLQAFYDGLDAKQKKAFDTGGRIGGIFDWWGKK
Ga0242661_101578213300022717SoilAVEPRLQAFYDSLDAEQKKAFDTGGRIGGIFDWWGKK
Ga0242665_1003448213300022724SoilEPRLQAFYDSLDAEQKKAFDTGGRIGGIFDWWGKK
Ga0224563_102095323300022731SoilLKAVEPKLQAFYDSLDAKQKKAFDTGGRIGGIFDWWSKK
Ga0207646_1136087613300025922Corn, Switchgrass And Miscanthus RhizosphereMNSPQMMQLTMAETRLAGLKVAEPKLQAFYDGLDAKQKKAFDTGGRIGGIFDWWGKQ
Ga0207689_1152358423300025942Miscanthus RhizosphereMAFAAKMAETRLAGLKVAEPKLQAFYDGLDAKQKKAFDTGGRIGGIFDWWGRK
Ga0257166_100559223300026358SoilMAFAAKMAETKLAGLKATEPKLKAFYDSLDVKQKKAFDTGGRIGGIFDWWGKK
Ga0257164_100800113300026497SoilKATEPKLKAFYDSLDAKQKKAFDTGGRIGGIFDWWGKK
Ga0207775_11277823300026817Tropical Forest SoilEPKLQAFYDSLDAKQKKAFDMGGRIGGIFDWWGKK
Ga0207724_100408613300026862Tropical Forest SoilAGLKEVEPKLQAFYDSLDAKQKKAFDTGGRIGGIFDWWGKK
Ga0208696_117106823300027696Peatlands SoilGLKAVEPKLQAFYDSLDAKQKKAFDSGGRIGGIFDWWRER
Ga0310037_1001337113300030494Peatlands SoilMAETRLAGLKAVEPKLQAFYDSLDAKQKKAFDTGGRIGGIFDWWRKK
Ga0170824_11454598423300031231Forest SoilMAETKLAGLKAVEPKLQAFYDSLDAKQKKAFDTGGRIGGIFDWWSKK
Ga0170824_11657959223300031231Forest SoilMVFAEKMAEIRLAGLKAIEPKLQAFYDTLDARQKRAFDTGGHIGGIFNWWGKT
Ga0170820_1190974713300031446Forest SoilFAEKVAEIRLAGLKAIEPKLQAFYDTLDARQKRAFDTGRRNGGIFSWWGKT
Ga0318541_1039573623300031545SoilKEVEPKLQAFYDSLDAKQKKAFDTGGRIGGIFDWWGKK
Ga0318538_1049510013300031546SoilGLKAVEPKLQAFYDSLDAKQKKAFDTGGRIGGIFDWWGKK
Ga0318528_1071714313300031561SoilVEPKLQAFYDSLDAKQKKAFDTGGRIGGIFDWWGKK
Ga0318573_1048155823300031564SoilRMAEIRLAGLKAIEPKLEAFYDTLDARQKRAFDTGGRIGGIFNWWGKR
Ga0310915_1003940013300031573SoilMAFAEKMAEIRLAGLKAIEPKLQAFYDTLDARQKRAFDTGGRIGGIFNWWGKT
Ga0310915_1056959723300031573SoilAAFAEKMAEIRLAGLKAIEPKLQAFYDTLDARQKRAFNTGGRVGGIFNWWGKR
Ga0310915_1079448223300031573SoilEMTAETKLASLKAVEPKLQAFYDSLDEKQKKAFDTGGRVGGIFDWLRNK
Ga0318542_1059534823300031668SoilQAAFAEKMAEIRLAGLKAIEPKLQAFYETLDARQKRAFNTGGRVGGIFNWWGKR
Ga0318561_1031723113300031679SoilETRLARLKEVEPKLQAFYESLDAKQKKAFDTGGRIGGIFDWWGKK
Ga0318574_1064986313300031680SoilMPGRMAFAEKKAEIRLAGLKAIEPKLQAFYDTLDARQKRAFDTGGRIGGIFNWWGKR
Ga0318500_1074364723300031724SoilLKAVEPKLQAFYDTLDAKQKKAFDTGGRIGGMFDWLRRTLLR
Ga0318546_1000742613300031771SoilAERMAEIRLAGLKAIEPKLEAFYDTLDARQKRAFDTGGRIGGIFNWWGKR
Ga0318546_1128906123300031771SoilLKAVEPKLQAFYDSLDAKQKKAFDTGGRIGGIFDWWGKK
Ga0318547_1022472013300031781SoilRLAGLKAVEPKLQAFYDSLDAKQKKAFDTGGRIGGIFDWWGKK
Ga0318548_1002893623300031793SoilMAFAEKMAEIRLAGLKAIEPKLQAFYDTMDARQKRAFDTGGRIGGIFNWWGKT
Ga0318576_1042451913300031796SoilLAGLKAVEPKLQAFYDGLDPKQKKAFDTGGRIGGIFDWWKK
Ga0318568_1011723613300031819SoilGLKEVEPKLQAFYDSLDAKQKKAFDTGGRIGGIFDWWGKK
Ga0307478_1075850513300031823Hardwood Forest SoilMKAIEPKLQAFYASLDDTQKHAIDAGSRVGGLFGWLNR
Ga0310917_1099401123300031833SoilFYDSLDAKQKRAFDTGGRIGGIFYWWGKKSRAATSP
Ga0306919_1004183113300031879SoilEPKLQAFYESLDAKQKKAFDTGGRIGGIFDWWGKK
Ga0318544_1036857413300031880SoilLKAIEPKLQAFYDTLDARQKRAFDTGGRIGGIFNWWGKT
Ga0306925_1108498023300031890SoilMAFAEKTAEIRLASLKAVEPRLQAFYDGLDEKQKKAFDTGGRVGGIFDWLGKK
Ga0306925_1180681913300031890SoilMAFAEMTAETKLASLKAVEPKLQAFYDSLDEKQKKAFDTGGRVGGIFDWLRNK
Ga0318520_1035539623300031897SoilIRLAGLKAIEPKLQAFYDSLDAKQKKAFDTGGRIGGIFDWWGKK
Ga0306923_1024282413300031910SoilMAFAEKMAEIRLAGLQAIEPKLQAFYDTLDARQKRAFDTGGRIGGIFNWWGKT
Ga0306923_1050785213300031910SoilTRLAGMKAVDPKLQAFYDSLDAKQKTAFDTGGRVGGMFDWWRKQ
Ga0306923_1130285533300031910SoilKAIEPKLQAFYDTLDARQKRAFDTGGRIGGIFNWWGKR
Ga0306923_1156761433300031910SoilFAEKTTDIRLAGLKAVEPKLQAFYDSLDAKQKKAFDTGGRIGGIFDWWGKK
Ga0306921_1014865153300031912SoilMAFAEMTAETKLASLKAVEPKLQAFYDNLDEKQKKAFDTGGRVGGIFDWLRNK
Ga0306921_1109882823300031912SoilKAVDPKLQAFYDSLDAKQKTAFDTGGRVGGMFDWWGKQ
Ga0306921_1155620023300031912SoilIEPKLQAFYDTLDARQKRAFDTGGRIGGIFNWWGKT
Ga0310916_1102719513300031942SoilVEPKLQAFYNTLDAKQKKAFDTGGRIGGIFDWWAKK
Ga0310913_1015094713300031945SoilKLASRKAVEPKLQAFYDSLDEKQKKAFDTGGRVGGIFDWLRNK
Ga0310913_1038249623300031945SoilMAEIRLAGLKAVEPKLQAFYDGLDPKQKKAFDTGGRIGGIFDWWKK
Ga0310913_1073759113300031945SoilLKLMRRAEWRSPKRWRRLKAVEPKLQAFYDNLDAKQKKAFDTGGRIGGIFDWWSKK
Ga0310909_1112646033300031947SoilEKVAEIRLAGVKAIEPKLQAFYDTLDARQKKAFDTGWRIGGIFNWGAKRDKRADRY
Ga0306922_1036434633300032001SoilRPGLPALKAVEPKLQAFYDSLDVKQKKAFDTGGRIGGIFDWWRKK
Ga0306922_1175662313300032001SoilEIRLAGLKAIEPKLQAFYDTLDARQKRAFDTGGRIGGIFNWWGKR
Ga0318559_1037779523300032039SoilRLKEVEPKLQAFYESLDAKQKKAFDTGGRIGGIFDWWGKK
Ga0318533_1123590313300032059SoilTRLAGLKAVEPKLQAFYDSLDAKQKNAFDTGGRVGGIFDWWNKK
Ga0318514_1049805313300032066SoilGLKAIEPKLQAFYDTLDARQKRAFDTGGRIGGIFNWWGKT
Ga0306924_1039075623300032076SoilAVEPKLQAFYDSLDAKQKKAFDTGGRIGGIFDWWGKK
Ga0306924_1142444833300032076SoilGLKAVEPKLQVFYSNLDAKQKKAFDTGGRIGGIFDWWGKK
Ga0306924_1157641113300032076SoilTPGRMAFAEKKAEIRLAGLKAIEPKLQAFYDTLDARQKRAFDTGGRIGGIFNWWGKR
Ga0318540_1053407123300032094SoilLSTMPGQAAFAEKMAEIRLAGLKAIEPKLQAFYDTLDARQKRAFNTGGRVGGIFNWWGKR
Ga0316051_101554923300032119SoilAVEPKLQAFYDSLDAKQKKAFDTGGRIGGIFDWWSKK
Ga0311301_1018069413300032160Peatlands SoilAGLKAVEPKLQAFYDSLDAKQKKAFDTGGRIGGIFDWWRKK
Ga0311301_1169119223300032160Peatlands SoilAVEPKLQAFYDSLDAKQKKAFDSGGRIGGIFDWWRER
Ga0335072_1022502713300032898SoilQLDGLKAIEPKLQAFYDTLDDKQKKAFDSGGRVGGLFGWLSR
Ga0335076_1015585213300032955SoilMQAQLDGMKAIEPKLQAFYDTLDDKQKKAFDTGGRVGGLFGWLGR
Ga0314864_0002683_1375_15153300033805PeatlandLASEARLDGLKAIEPKLQAFYASLDDKQKKAFDTGGRVGGFFDWFK
Ga0314864_0094663_556_6993300033805PeatlandMAFAEKMKEARLDGMRTIELYTSLDDKQKKAFDTGGRVGGFFDWFCK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.