NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F061728

Metagenome / Metatranscriptome Family F061728

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F061728
Family Type Metagenome / Metatranscriptome
Number of Sequences 131
Average Sequence Length 41 residues
Representative Sequence KLVEAIALVLDARDLAQGNVNPQLLAAVLAEDLQAMRRS
Number of Associated Samples 111
Number of Associated Scaffolds 131

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 98.47 %
% of genes from short scaffolds (< 2000 bps) 90.84 %
Associated GOLD sequencing projects 104
AlphaFold2 3D model prediction Yes
3D model pTM-score0.64

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.237 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(23.664 % of family members)
Environment Ontology (ENVO) Unclassified
(51.908 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(57.252 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 46.27%    β-sheet: 0.00%    Coil/Unstructured: 53.73%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.64
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 131 Family Scaffolds
PF01967MoaC 80.92
PF01464SLT 9.92
PF01476LysM 7.63

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 131 Family Scaffolds
COG0315Molybdenum cofactor biosynthesis enzyme MoaCCoenzyme transport and metabolism [H] 80.92


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.24 %
UnclassifiedrootN/A0.76 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000532|CNAas_1007609All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium705Open in IMG/M
3300002558|JGI25385J37094_10026007All Organisms → cellular organisms → Bacteria2079Open in IMG/M
3300002909|JGI25388J43891_1004592All Organisms → cellular organisms → Bacteria2788Open in IMG/M
3300002916|JGI25389J43894_1063455All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium629Open in IMG/M
3300005172|Ga0066683_10094595All Organisms → cellular organisms → Bacteria1808Open in IMG/M
3300005174|Ga0066680_10282155All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1059Open in IMG/M
3300005440|Ga0070705_101818107All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium517Open in IMG/M
3300005447|Ga0066689_10930265All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium537Open in IMG/M
3300005459|Ga0068867_100472794All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1072Open in IMG/M
3300005536|Ga0070697_100989414All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium747Open in IMG/M
3300005552|Ga0066701_10682453All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium618Open in IMG/M
3300005555|Ga0066692_10473400All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium798Open in IMG/M
3300005557|Ga0066704_10638995All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium678Open in IMG/M
3300005559|Ga0066700_10990913All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium553Open in IMG/M
3300005561|Ga0066699_10335972All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1078Open in IMG/M
3300005568|Ga0066703_10447844All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium774Open in IMG/M
3300005574|Ga0066694_10312592All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium748Open in IMG/M
3300005586|Ga0066691_10449566All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium769Open in IMG/M
3300006034|Ga0066656_11105860All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium509Open in IMG/M
3300006791|Ga0066653_10543963All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium587Open in IMG/M
3300006806|Ga0079220_10324482All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium964Open in IMG/M
3300006903|Ga0075426_10086678All Organisms → cellular organisms → Bacteria2240Open in IMG/M
3300006914|Ga0075436_100120240All Organisms → cellular organisms → Bacteria1837Open in IMG/M
3300007076|Ga0075435_100196865All Organisms → cellular organisms → Bacteria1707Open in IMG/M
3300009012|Ga0066710_102474861All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium751Open in IMG/M
3300009088|Ga0099830_10823030All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium766Open in IMG/M
3300009090|Ga0099827_10499120All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae1046Open in IMG/M
3300009137|Ga0066709_103074794All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium611Open in IMG/M
3300009156|Ga0111538_10567642All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1439Open in IMG/M
3300009808|Ga0105071_1031311All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium803Open in IMG/M
3300010080|Ga0127448_153001All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium574Open in IMG/M
3300010103|Ga0127500_1010107All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium657Open in IMG/M
3300010116|Ga0127466_1147300All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium577Open in IMG/M
3300010122|Ga0127488_1005939All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium612Open in IMG/M
3300010133|Ga0127459_1149276All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium553Open in IMG/M
3300010301|Ga0134070_10202590All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium728Open in IMG/M
3300010323|Ga0134086_10417767All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium542Open in IMG/M
3300010323|Ga0134086_10488352All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium508Open in IMG/M
3300010326|Ga0134065_10104953All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium943Open in IMG/M
3300010329|Ga0134111_10393240All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium592Open in IMG/M
3300010333|Ga0134080_10063679All Organisms → cellular organisms → Bacteria1469Open in IMG/M
3300010337|Ga0134062_10015053All Organisms → cellular organisms → Bacteria2892Open in IMG/M
3300010403|Ga0134123_10807036Not Available933Open in IMG/M
3300012173|Ga0137327_1004930All Organisms → cellular organisms → Bacteria2384Open in IMG/M
3300012198|Ga0137364_10259846All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae1284Open in IMG/M
3300012199|Ga0137383_10102478All Organisms → cellular organisms → Bacteria2079Open in IMG/M
3300012200|Ga0137382_10532480All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium836Open in IMG/M
3300012200|Ga0137382_11123438All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium561Open in IMG/M
3300012207|Ga0137381_10583767All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium974Open in IMG/M
3300012209|Ga0137379_10168346All Organisms → cellular organisms → Bacteria2103Open in IMG/M
3300012211|Ga0137377_10423453All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae1270Open in IMG/M
3300012212|Ga0150985_104068493All Organisms → cellular organisms → Bacteria1071Open in IMG/M
3300012285|Ga0137370_10130393All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae1440Open in IMG/M
3300012285|Ga0137370_10712564All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium623Open in IMG/M
3300012349|Ga0137387_10212735All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae1390Open in IMG/M
3300012351|Ga0137386_10000173All Organisms → cellular organisms → Bacteria31670Open in IMG/M
3300012351|Ga0137386_10116056All Organisms → cellular organisms → Bacteria1902Open in IMG/M
3300012351|Ga0137386_10124512All Organisms → cellular organisms → Bacteria1835Open in IMG/M
3300012354|Ga0137366_10713116All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium715Open in IMG/M
3300012355|Ga0137369_10520033All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium838Open in IMG/M
3300012361|Ga0137360_11177125All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium663Open in IMG/M
3300012362|Ga0137361_11152094All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium697Open in IMG/M
3300012363|Ga0137390_10575479All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis1096Open in IMG/M
3300012382|Ga0134038_1263601All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium517Open in IMG/M
3300012386|Ga0134046_1124940All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae1266Open in IMG/M
3300012395|Ga0134044_1312802All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium528Open in IMG/M
3300012402|Ga0134059_1024753All Organisms → cellular organisms → Bacteria1592Open in IMG/M
3300012407|Ga0134050_1220737All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium769Open in IMG/M
3300012410|Ga0134060_1425120All Organisms → cellular organisms → Bacteria1711Open in IMG/M
3300012683|Ga0137398_11192672All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium520Open in IMG/M
3300012918|Ga0137396_10010478All Organisms → cellular organisms → Bacteria5657Open in IMG/M
3300012925|Ga0137419_11205798All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium634Open in IMG/M
3300012972|Ga0134077_10502250All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium537Open in IMG/M
3300012976|Ga0134076_10333301All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium664Open in IMG/M
3300014154|Ga0134075_10072259All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae1441Open in IMG/M
3300015264|Ga0137403_10880688All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium746Open in IMG/M
3300015359|Ga0134085_10038535All Organisms → cellular organisms → Bacteria1885Open in IMG/M
3300015359|Ga0134085_10173988All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium920Open in IMG/M
3300017654|Ga0134069_1174138All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium726Open in IMG/M
3300017657|Ga0134074_1365460All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium534Open in IMG/M
3300017659|Ga0134083_10397561All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium601Open in IMG/M
3300017659|Ga0134083_10563419All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium517Open in IMG/M
3300017927|Ga0187824_10144439All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium786Open in IMG/M
3300018071|Ga0184618_10274941All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium715Open in IMG/M
3300018482|Ga0066669_11042115All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium738Open in IMG/M
3300018482|Ga0066669_11537718All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium605Open in IMG/M
3300019233|Ga0184645_1144731All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium608Open in IMG/M
3300019249|Ga0184648_1028546All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium596Open in IMG/M
3300019249|Ga0184648_1070410All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae1465Open in IMG/M
3300019249|Ga0184648_1410972All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium636Open in IMG/M
3300020170|Ga0179594_10121293All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium953Open in IMG/M
3300022724|Ga0242665_10023898All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis1438Open in IMG/M
3300025312|Ga0209321_10492583All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium554Open in IMG/M
3300025910|Ga0207684_10166291All Organisms → cellular organisms → Bacteria1901Open in IMG/M
3300025910|Ga0207684_10999017All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium700Open in IMG/M
3300026015|Ga0208286_1015250All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium601Open in IMG/M
3300026296|Ga0209235_1176982All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium791Open in IMG/M
3300026296|Ga0209235_1179479All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium780Open in IMG/M
3300026313|Ga0209761_1188276All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium926Open in IMG/M
3300026314|Ga0209268_1147653All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium578Open in IMG/M
3300026323|Ga0209472_1257985All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium556Open in IMG/M
3300026325|Ga0209152_10222469All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium706Open in IMG/M
3300026325|Ga0209152_10323846All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium582Open in IMG/M
3300026327|Ga0209266_1227514All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium626Open in IMG/M
3300026327|Ga0209266_1291704All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium513Open in IMG/M
3300026331|Ga0209267_1074398All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis1479Open in IMG/M
3300026331|Ga0209267_1097097All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis1257Open in IMG/M
3300026332|Ga0209803_1039990All Organisms → cellular organisms → Bacteria2142Open in IMG/M
3300026332|Ga0209803_1190666All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium765Open in IMG/M
3300026343|Ga0209159_1176271All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium768Open in IMG/M
3300026524|Ga0209690_1051766All Organisms → cellular organisms → Bacteria1834Open in IMG/M
3300026529|Ga0209806_1082709All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae1414Open in IMG/M
3300026530|Ga0209807_1182751All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium763Open in IMG/M
3300026536|Ga0209058_1075837All Organisms → cellular organisms → Bacteria1784Open in IMG/M
3300026536|Ga0209058_1344357All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium516Open in IMG/M
3300026537|Ga0209157_1251478All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium695Open in IMG/M
3300027748|Ga0209689_1314758All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium603Open in IMG/M
3300027765|Ga0209073_10108159All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium989Open in IMG/M
3300027775|Ga0209177_10054970All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis1141Open in IMG/M
3300027775|Ga0209177_10401615All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium549Open in IMG/M
3300027909|Ga0209382_11338329All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium723Open in IMG/M
3300028711|Ga0307293_10223645All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium599Open in IMG/M
3300031424|Ga0308179_1035250All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium607Open in IMG/M
3300031720|Ga0307469_10040335All Organisms → cellular organisms → Bacteria2828Open in IMG/M
3300031720|Ga0307469_11160039All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium728Open in IMG/M
3300031753|Ga0307477_10568262All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium766Open in IMG/M
3300031820|Ga0307473_10468435All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium843Open in IMG/M
3300031962|Ga0307479_11260867All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium701Open in IMG/M
3300032180|Ga0307471_100054229All Organisms → cellular organisms → Bacteria3333Open in IMG/M
3300034164|Ga0364940_0148551All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium675Open in IMG/M
3300034164|Ga0364940_0206996All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium575Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil23.66%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil20.61%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil19.08%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil7.63%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil4.58%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.82%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment3.05%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil3.05%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.05%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.53%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment1.53%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.76%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.76%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.76%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.76%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.76%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.76%
Quercus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere0.76%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.76%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.76%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000532Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_AssembledHost-AssociatedOpen in IMG/M
3300002558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cmEnvironmentalOpen in IMG/M
3300002909Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cmEnvironmentalOpen in IMG/M
3300002916Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cmEnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005574Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143EnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009808Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50EnvironmentalOpen in IMG/M
3300010080Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_0_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010103Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010116Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_24_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010122Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_4_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010133Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_8_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015EnvironmentalOpen in IMG/M
3300010323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300012173Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT517_2EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012382Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_4_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012386Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012395Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012402Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012407Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012410Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012972Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300014154Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300017654Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300017657Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015EnvironmentalOpen in IMG/M
3300017659Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300017927Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019233Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019249Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300022724Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025312Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 4 - CSP-I_5_4EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026015Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_401 (SPAdes)EnvironmentalOpen in IMG/M
3300026296Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026313Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026314Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes)EnvironmentalOpen in IMG/M
3300026323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes)EnvironmentalOpen in IMG/M
3300026325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)EnvironmentalOpen in IMG/M
3300026327Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes)EnvironmentalOpen in IMG/M
3300026331Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes)EnvironmentalOpen in IMG/M
3300026332Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes)EnvironmentalOpen in IMG/M
3300026343Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes)EnvironmentalOpen in IMG/M
3300026524Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes)EnvironmentalOpen in IMG/M
3300026529Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes)EnvironmentalOpen in IMG/M
3300026530Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes)EnvironmentalOpen in IMG/M
3300026536Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes)EnvironmentalOpen in IMG/M
3300026537Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes)EnvironmentalOpen in IMG/M
3300027748Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028711Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150EnvironmentalOpen in IMG/M
3300031424Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_150 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300034164Sediment microbial communities from East River floodplain, Colorado, United States - 14_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
CNAas_100760933300000532Quercus RhizosphereAMALVMDARDLAQGNVNPQLLAAVLAQGLREVRRS*
JGI25385J37094_1002600713300002558Grasslands SoilKRGPAARPKVVEAIARVLEARDLAQGNVNPQLLAAVLADELGGEPA*
JGI25388J43891_100459243300002909Grasslands SoilRSGEETGRVVRAIAQVLEARTLAQGNLNPQLVAAVLGSDLGTAG*
JGI25389J43894_106345523300002916Grasslands SoilGKVVAAIARVLEARGLAQGNVNPQLVAAVLADDLGGEPA*
Ga0066683_1009459513300005172SoilETAQVVQAIAHTFAARELAQGNVNPQLVAAVLADQLAELG*
Ga0066680_1028215513300005174SoilNGADLDKVVEAIARVLDARRLAQGNVNPQLIAAVLADDLAEHA*
Ga0070705_10181810713300005440Corn, Switchgrass And Miscanthus RhizosphereGKLVEAIALVMDARDMAQGNVNPQLLAAVLAEDLQRMRLS*
Ga0066689_1093026523300005447SoilKLVEAIALVLDARDLAQGNVNPQLLAAVLAEDLQAMRRS*
Ga0068867_10047279433300005459Miscanthus RhizosphereGGDTEKLVEAIALVMDARDLAQGNVNPQLLAAVLADDLRGIRRS*
Ga0070697_10098941423300005536Corn, Switchgrass And Miscanthus RhizosphereSEAQRGGETGKLVEAIALVMDARDMAQGNVNPQLLAAVLAEDLQRMRLS*
Ga0066701_1068245313300005552SoilGKVVEAIARVLEARDLAQGNVNPQLLAAVLADELGGEPA*
Ga0066692_1047340033300005555SoilVVEAIARVLDARELAQGNVNPQLLAAVLADQLAELA*
Ga0066704_1063899513300005557SoilTGGEAGKVVEAIARVLEARDLAQGNVNPQLLAAVLADELGGEPA*
Ga0066700_1099091323300005559SoilGGETEKVVEAIARVFEARDLAQGNVNPQLLAAVLADELGGEPA*
Ga0066699_1033597233300005561SoilVEAIALVMDARDVAQGNVNPQLLAAVLGEDLHRLQGS*
Ga0066703_1044784413300005568SoilAKRGGDTDKLVEAIALVMDARDVAQGNVNPQLLATVLAEDLHGTQRS*
Ga0066694_1031259223300005574SoilRTGKDTGAVVAAISRVLDARGMAQGNVNPQLLAAVLADEMWSNG*
Ga0066691_1044956613300005586SoilGEAGKVVEAIARVLEARDLAQGNVNPQLLAAVLADELAEPA*
Ga0066656_1110586013300006034SoilGGETEKVVEAIARVLEARDLAQGNVNPQLLAAVLADELAEPA*
Ga0066653_1054396323300006791SoilAEAKRGGDTEKLVEAISRVMDARDMAQGNVNPQLLAAVLAEAL*
Ga0079220_1032448213300006806Agricultural SoilGDTAKLIEAIARTLDAREMAQGNVNPQLLAAVLADDLAVVP*
Ga0075426_1008667843300006903Populus RhizosphereAAIARVLAARDAAQGNVNPQLLTAVLADDLAAAR*
Ga0075436_10012024013300006914Populus RhizosphereETGKVVAAIARVLEARGLAQGNVNPQLVSAVLAADLRATRGAPA*
Ga0075435_10019686543300007076Populus RhizosphereKLVEAIALVLDARDLAQGNVNPQLLAAVLAEDLQARRAS*
Ga0066710_10247486133300009012Grasslands SoilKTGGETHKLVQAIARVMDARELAQGNVNPQLVMAVLAEDLAGAEST
Ga0099830_1082303023300009088Vadose Zone SoilGETEKVVEAIARVLEARDLAQGNVNPQLLAAVLADELAEPA*
Ga0099827_1049912033300009090Vadose Zone SoilPVVAAIARVLDARELAQGNVNPQLVAAVLAEDLGAGS*
Ga0066709_10307479413300009137Grasslands SoilDSGKVVSAIARVLEARELAQGNVNPQLVAAVLGEDLGSPP*
Ga0111538_1056764213300009156Populus RhizosphereEVKRGGDTQKLVEAMALVMDARDLAQGNVNPQLLAAVLAGDLREVRRS*
Ga0105071_103131113300009808Groundwater SandKLVEAIARVAAARTAAQGNVNPQLLAAVLADELASDGGDG*
Ga0127448_15300123300010080Grasslands SoilVEAIALVLDARDLAQGNVNPQLLAAVLGEDLPGSRAAS*
Ga0127500_101010723300010103Grasslands SoilVVSAIARVLDARELTQGNVNPQLVAAVLGEDLGSPR*
Ga0127466_114730023300010116Grasslands SoilVEAIARTLDARELAQGNVNPQLVAAVLADQLAELK*
Ga0127488_100593923300010122Grasslands SoilAKRGGDTGKLVEAIALVMDARDSAQGNVNPQLLAAVLAEDLQAMRRS*
Ga0127459_114927613300010133Grasslands SoilKVVAAIARVLETRTLAQGNVNPQLLAAVLADDLGGEPA*
Ga0134070_1020259013300010301Grasslands SoilDTARAVEAIAHTLDARELAQGNVNPQLVTAVLADELAELK*
Ga0134086_1041776723300010323Grasslands SoilVEAIALVLGARDLAQGNVNPQLLAAVLAEDLQAMRRS*
Ga0134086_1048835213300010323Grasslands SoilGDTEKLVEAIALVLDARDLAQGNVNPQLLAAVLAEDLQASRTS*
Ga0134065_1010495333300010326Grasslands SoilAIALVLGARDLAQGNVNPQLLAAVLAEDLQAMRRS*
Ga0134111_1039324023300010329Grasslands SoilRGGDTEKLVEAIALVMDARDLAQGNVNPQLLAAVLAEDLQVTRQS*
Ga0134080_1006367943300010333Grasslands SoilTEKLVEAISLVMDARDMAQGNVNPQLLAAVLAEAL*
Ga0134062_1001505343300010337Grasslands SoilVEAIALVLDARDLAQGNVNPQLLAAVLAGDLQAMRTS*
Ga0134123_1080703633300010403Terrestrial SoilEAIARVTEARVAAQGNVNPQLLAAVLADELAPDGGEG*
Ga0137327_100493043300012173SoilVEAIALVMDARDLAQGNVNPQLLAAVLADDLRGVRRA*
Ga0137364_1025984633300012198Vadose Zone SoilEAIALVLGARDLAQGNVNPQLLAAVLAEDLQAMRRS*
Ga0137383_1010247813300012199Vadose Zone SoilDKVVEAIARVLDARRLAQGNVNPQLIAAVLADDLAEHA*
Ga0137382_1053248013300012200Vadose Zone SoilEAIAMVLDARDLAQGNVNPQLLAAVLAEDLQGTRRS*
Ga0137382_1112343813300012200Vadose Zone SoilSGGDTEKLVEAIARVMDARELAQGNVNPQLLAAVLAEDLRGMP*
Ga0137381_1058376733300012207Vadose Zone SoilDTDKLVEAIALVLDARDLAQGNVNPQLLATVLAEDLQATRRS*
Ga0137379_1016834613300012209Vadose Zone SoilDTEKVVEAIAQVLEARGLAQGNVNPQLVAAVLAGDLAAKEPV*
Ga0137377_1042345313300012211Vadose Zone SoilRVVEAIARTLDARELAQGNVNPQLVAAVLADQLAELK*
Ga0150985_10406849313300012212Avena Fatua RhizosphereDTEKLVEAIALVMDTRDLAQGNVNPQLLAAVLAEDLRAPQA*
Ga0137370_1013039333300012285Vadose Zone SoilTARVVEAIARTLDARQLAQGNVNPQLVAAVLADRLAELK*
Ga0137370_1071256413300012285Vadose Zone SoilKRGGDTDKLVEAIALVLDARDLAQGNVNPQLLAAVLAEDLQGTRRS*
Ga0137387_1021273533300012349Vadose Zone SoilGTQAVVAAISRVLDARAMAQGNVNPQLLAAVLAEDMWSRG*
Ga0137386_10000173383300012351Vadose Zone SoilVEAIARVLEARGAAQGNVNPQLVAAVLAEDLAERQ*
Ga0137386_1011605643300012351Vadose Zone SoilGETDKLVEAIALVMDARDVAQGNVNPQLLAAVLAEDLHGLEAL*
Ga0137386_1012451213300012351Vadose Zone SoilRRGGDTEKLVEAIACVLDARDLAQGNVNPQLLAAVLAEDLQGIRGS*
Ga0137366_1071311623300012354Vadose Zone SoilQARTGGETEKLVEAIARVFEARNLAQGNVNPQLLAAVLADELAEPA*
Ga0137369_1052003313300012355Vadose Zone SoilGETEKVVAAIARVLEARGLAQGNVNPQLVAAVLADDLAESA*
Ga0137360_1117712513300012361Vadose Zone SoilQARAGGETEKVVEAIARVLEARGLAQGNVNPQLVGAVLADDLAEPA*
Ga0137361_1115209413300012362Vadose Zone SoilKLVEAIALVLDARDLAQGNVNPQLLAAVLAEDLQMTRRS*
Ga0137390_1057547913300012363Vadose Zone SoilDTEKLVEAIALVLDARDLAQGNVNPQLLAAVLAEDLQETRRS*
Ga0134038_126360123300012382Grasslands SoilARAVEAIAHTLEARELAQGNVNPQLVTAVLADELAELK*
Ga0134046_112494033300012386Grasslands SoilGGETGKLVEAIALVLDARDLAQGNVNPQLLAAVLAEDLQAMRAS*
Ga0134044_131280223300012395Grasslands SoilAKVVEAIASVLEARELAQGNVNPQLVAAVLADQLAGLR*
Ga0134059_102475313300012402Grasslands SoilEKVVEAIAQVLEARGLAQGNVNPQLVGAVLAEDLAGEAP*
Ga0134050_122073713300012407Grasslands SoilAKRGGDTDKLVEAIAMVLDARDLAQGNVNPQLLAAVLAEDLQGTRRS*
Ga0134060_142512043300012410Grasslands SoilTAKVVEAIASVLEARELAQGNVNPQLVAAVLADQLAGLR*
Ga0137398_1119267213300012683Vadose Zone SoilRETRAVVTAMARVLETRELAQGNVNPQLLAAVLVEDLWSGA*
Ga0137396_10010478113300012918Vadose Zone SoilARAGGETAKVVEAIACTLAARGLAQGNVNPQLVAAVLADQLAEPR*
Ga0137419_1120579823300012925Vadose Zone SoilETEKVVEAIAQVLEARGLAQGNVNPQLVAAVLADDLAEPA*
Ga0134077_1050225013300012972Grasslands SoilTTRVVEAIARTLGARELAQGNVNPQLVAAVLADQLAELK*
Ga0134076_1033330123300012976Grasslands SoilEAIARTLGARELAQGNVNPQLVAAVLADQLAELK*
Ga0134075_1007225933300014154Grasslands SoilRAGGDTARAVEAIAHTLDARELAQGNVNPQLVTAVLADELAELK*
Ga0137403_1088068813300015264Vadose Zone SoilMVEAIALVLDARDLAQGNVNPQLLAAVLAEDLQAMRRS*
Ga0134085_1003853543300015359Grasslands SoilVEAIALVLDARELAQGNVNPQLLAAVLADQLAELA*
Ga0134085_1017398813300015359Grasslands SoilGGDTGKLVEAIALVMDARDSAQGNVNPQLLAAVLAEDLQAMRRS*
Ga0134069_117413813300017654Grasslands SoilSEAKRGGDTEKLVEAIALVLDARDLAQGNVNPQLLAAVLAEAL
Ga0134074_136546013300017657Grasslands SoilGDIGKLVEAIALVLDARDLAQGNVNPQLLAAVLAEDLQAMRRS
Ga0134083_1039756123300017659Grasslands SoilEKVVEAIARVLEARDLAQGNVNPQLLAAVLADELAEPA
Ga0134083_1056341913300017659Grasslands SoilKLVEAIAQVLEARDLAQGNVNPQLIAAVLAEDLAGGESE
Ga0187824_1014443913300017927Freshwater SedimentRVVGAISRVLDAREAAQGNVNPQLLTAVLAEDLWSTR
Ga0184618_1027494123300018071Groundwater SedimentEARTGGATQKLVEAIARVMDARELAQGNVNPQLVAAVLAEDLAGGGA
Ga0066669_1104211513300018482Grasslands SoilGGESEKLVAAIARVLEVRGLAQGNVNPQLVAAVLADDLTEPA
Ga0066669_1153771823300018482Grasslands SoilRTGGEAGKVVEAIARVLEARDLAQGNVNPQLLAAVLADELGGEPA
Ga0184645_114473123300019233Groundwater SedimentVKTGGETQKLVEAMARVMDARELAQGNVNPQLVTAVLAEDLAGAQSA
Ga0184648_102854623300019249Groundwater SedimentRGGDTEKLVEAIALVMDARDLAQGNVNPQLLAAVLADDLQATRRS
Ga0184648_107041013300019249Groundwater SedimentGGETQKLVEAIARVMDARELAQGNVNPQLVTAVLAEDLAGAESA
Ga0184648_141097223300019249Groundwater SedimentGDTEKLVEAIALVLDARELAQGNVNPQLLAAVLAEDLQVRRRS
Ga0179594_1012129313300020170Vadose Zone SoilAKTGGETQKLVQAIARVMDARELAQGNVNPQLVMAVLAEDLAAESP
Ga0242665_1002389833300022724SoilGVVAAIAQVLAARDAAQGNVNPQLLTAVLVDDLAAAR
Ga0209321_1049258313300025312SoilQKLIEAIAHVLDARELAQGNVNPQLVTAVLAENLGGRS
Ga0207684_1016629143300025910Corn, Switchgrass And Miscanthus RhizosphereQRGGETGKLVEAIALVMDARDMAQGNVNPQLLAAVLAEDLQRMRLS
Ga0207684_1099901713300025910Corn, Switchgrass And Miscanthus RhizosphereTDKVVEAIARVLDARRLAQGNVNPQLIAAVLADDLAEQA
Ga0208286_101525023300026015Rice Paddy SoilVPTEKLVAAIALVLEARQQAQGNVNPQLLAAVLADDLAAEGVA
Ga0209235_117698233300026296Grasslands SoilQARTGGEAGKVVEAIARVLEARDLAQGNVNPQLLAAVLADELAEPA
Ga0209235_117947913300026296Grasslands SoilQARTGGEAGKVVEAIARVLEARDLAQGNVNPQLLAAVLADELGGEPA
Ga0209761_118827633300026313Grasslands SoilTSAVVAAISRVLDARGMAQGNVNPQLLAAVLADEMWSNG
Ga0209268_114765323300026314SoilEAIARVLEARGLAQGNVNPQLVAAVLADDLGGEPA
Ga0209472_125798513300026323SoilERLRAEAKRGGDTEKLVEAMSRVMDARDMAQGNVNPQLLAAVLAEAL
Ga0209152_1022246913300026325SoilGEAGKVVEAIARVLEARDVAQGNVNPQLLAAVLADELGGEPA
Ga0209152_1032384623300026325SoilKRGGDMDKLVEAIALVLNARDLAQGNVNPQILAAVLAEDLQATRRS
Ga0209266_122751423300026327SoilGQTEKLVEAIARVLEARGLAQGNVNPQLVAAVLADELGGEPA
Ga0209266_129170413300026327SoilGQARSGGETEKVVAAISQVLAARSLAQGNVNPQLVAAVLADDLAERA
Ga0209267_107439813300026331SoilNGADLDKVVEAIARVLDARRLAQGNVNPQLIAAVLADDLAEHA
Ga0209267_109709713300026331SoilVGEDSGKVVSAIARVLEARELAQGNVNPQLVAAVLGEDLGSPP
Ga0209803_103999013300026332SoilGETGKVVEAIARVLDARELAQGNVNPQLLAAVLADQLAELA
Ga0209803_119066613300026332SoilARVGKDSGKVVSAIARVLEARELAQGNVNPQLVAAVLGEDLGSPP
Ga0209159_117627113300026343SoilGKLVEAIALVLAARDLAQGNVNPQLLAAVLAEDLQAMRRS
Ga0209690_105176643300026524SoilGKVVEAIARVLEARDLAQGNVNPQLLAAVLADELGGEPA
Ga0209806_108270933300026529SoilDSGKVVSAIARVLEARELAQGNVNPQLVAAVLGEDLGSPP
Ga0209807_118275133300026530SoilGKVVAAIARVLEARGLAQGNVNPQLVAAVLADDLGGEPA
Ga0209058_107583713300026536SoilAIALVMDARDVAQGNVNPQLLAAVLAEDLHGTQRS
Ga0209058_134435723300026536SoilDTGKLVEAIALVMDARDSAQGNVNPQLLAAVLAEDLQAMRRS
Ga0209157_125147823300026537SoilGGETTRVVEAIARTLDARELAQGNVNPQLVAAVLADQLAELK
Ga0209689_131475823300027748SoilVVEAIARVLEARDLAQGNVNPQLLAAVLADELGGEPA
Ga0209073_1010815913300027765Agricultural SoilGDTAKLIEAIARTLDAREMAQGNVNPQLLAAVLADDLAVVP
Ga0209177_1005497013300027775Agricultural SoilRETGKVVAAIARVLEARGLAQGNVNPQLVSAVLAADLRATSGAPA
Ga0209177_1040161513300027775Agricultural SoilGGVVAAIARVLAARDAAQGNVNPQLLTAALADDLAAAR
Ga0209382_1133832913300027909Populus RhizosphereKAGAETQKLVAAIARVMDARELAQGNVNPQLVTAVLAEDLAGVEP
Ga0307293_1022364513300028711SoilRKVVEAIARVMDARELAQGNVNPQLIAAVLAEDLAGRS
Ga0308179_103525013300031424SoilVIAAIAQVLGARSLAQGNVNPQLVAAVLAGELAETGGERA
Ga0307469_1004033513300031720Hardwood Forest SoilTGKVVAAIARVLEARGLAQGNVNPQLVSAVLAADLRATSGAPA
Ga0307469_1116003913300031720Hardwood Forest SoilEKVVEAIARVLEARGLAQGNVNPQLVAAVLADDLAEPA
Ga0307477_1056826233300031753Hardwood Forest SoilGADTAEVVAAISRVLEARDAAQGNVNPQLLAAVLAEDLWSA
Ga0307473_1046843533300031820Hardwood Forest SoilTGGETEKVVEAIARVLEARDLAQGNVNPQLLAAVLADDLAERA
Ga0307479_1126086713300031962Hardwood Forest SoilLIEALAQVLEARQMAQGNVNPQLLTAVLSEDLAEAG
Ga0307471_10005422953300032180Hardwood Forest SoilVTAIARVLDARGLAQGNVNPQLLAAVLAGDLAGGETA
Ga0364940_0148551_2_1453300034164SedimentAKTGGETQKLVEAIARVMDARELAQGNVNPQLVTAVLAEDLAGAESA
Ga0364940_0206996_1_1353300034164SedimentGGETEKLVEAIALVMDARDLAQGNVNPQLLAAVLADDLQATRRS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.