Basic Information | |
---|---|
Family ID | F061728 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 131 |
Average Sequence Length | 41 residues |
Representative Sequence | KLVEAIALVLDARDLAQGNVNPQLLAAVLAEDLQAMRRS |
Number of Associated Samples | 111 |
Number of Associated Scaffolds | 131 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 98.47 % |
% of genes from short scaffolds (< 2000 bps) | 90.84 % |
Associated GOLD sequencing projects | 104 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.64 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (99.237 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (23.664 % of family members) |
Environment Ontology (ENVO) | Unclassified (51.908 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.252 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.27% β-sheet: 0.00% Coil/Unstructured: 53.73% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.64 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 131 Family Scaffolds |
---|---|---|
PF01967 | MoaC | 80.92 |
PF01464 | SLT | 9.92 |
PF01476 | LysM | 7.63 |
COG ID | Name | Functional Category | % Frequency in 131 Family Scaffolds |
---|---|---|---|
COG0315 | Molybdenum cofactor biosynthesis enzyme MoaC | Coenzyme transport and metabolism [H] | 80.92 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 99.24 % |
Unclassified | root | N/A | 0.76 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000532|CNAas_1007609 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 705 | Open in IMG/M |
3300002558|JGI25385J37094_10026007 | All Organisms → cellular organisms → Bacteria | 2079 | Open in IMG/M |
3300002909|JGI25388J43891_1004592 | All Organisms → cellular organisms → Bacteria | 2788 | Open in IMG/M |
3300002916|JGI25389J43894_1063455 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 629 | Open in IMG/M |
3300005172|Ga0066683_10094595 | All Organisms → cellular organisms → Bacteria | 1808 | Open in IMG/M |
3300005174|Ga0066680_10282155 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1059 | Open in IMG/M |
3300005440|Ga0070705_101818107 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 517 | Open in IMG/M |
3300005447|Ga0066689_10930265 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 537 | Open in IMG/M |
3300005459|Ga0068867_100472794 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1072 | Open in IMG/M |
3300005536|Ga0070697_100989414 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 747 | Open in IMG/M |
3300005552|Ga0066701_10682453 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 618 | Open in IMG/M |
3300005555|Ga0066692_10473400 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 798 | Open in IMG/M |
3300005557|Ga0066704_10638995 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 678 | Open in IMG/M |
3300005559|Ga0066700_10990913 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 553 | Open in IMG/M |
3300005561|Ga0066699_10335972 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1078 | Open in IMG/M |
3300005568|Ga0066703_10447844 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 774 | Open in IMG/M |
3300005574|Ga0066694_10312592 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 748 | Open in IMG/M |
3300005586|Ga0066691_10449566 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 769 | Open in IMG/M |
3300006034|Ga0066656_11105860 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 509 | Open in IMG/M |
3300006791|Ga0066653_10543963 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 587 | Open in IMG/M |
3300006806|Ga0079220_10324482 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 964 | Open in IMG/M |
3300006903|Ga0075426_10086678 | All Organisms → cellular organisms → Bacteria | 2240 | Open in IMG/M |
3300006914|Ga0075436_100120240 | All Organisms → cellular organisms → Bacteria | 1837 | Open in IMG/M |
3300007076|Ga0075435_100196865 | All Organisms → cellular organisms → Bacteria | 1707 | Open in IMG/M |
3300009012|Ga0066710_102474861 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 751 | Open in IMG/M |
3300009088|Ga0099830_10823030 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 766 | Open in IMG/M |
3300009090|Ga0099827_10499120 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1046 | Open in IMG/M |
3300009137|Ga0066709_103074794 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 611 | Open in IMG/M |
3300009156|Ga0111538_10567642 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1439 | Open in IMG/M |
3300009808|Ga0105071_1031311 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 803 | Open in IMG/M |
3300010080|Ga0127448_153001 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 574 | Open in IMG/M |
3300010103|Ga0127500_1010107 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 657 | Open in IMG/M |
3300010116|Ga0127466_1147300 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 577 | Open in IMG/M |
3300010122|Ga0127488_1005939 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 612 | Open in IMG/M |
3300010133|Ga0127459_1149276 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 553 | Open in IMG/M |
3300010301|Ga0134070_10202590 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 728 | Open in IMG/M |
3300010323|Ga0134086_10417767 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 542 | Open in IMG/M |
3300010323|Ga0134086_10488352 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 508 | Open in IMG/M |
3300010326|Ga0134065_10104953 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 943 | Open in IMG/M |
3300010329|Ga0134111_10393240 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 592 | Open in IMG/M |
3300010333|Ga0134080_10063679 | All Organisms → cellular organisms → Bacteria | 1469 | Open in IMG/M |
3300010337|Ga0134062_10015053 | All Organisms → cellular organisms → Bacteria | 2892 | Open in IMG/M |
3300010403|Ga0134123_10807036 | Not Available | 933 | Open in IMG/M |
3300012173|Ga0137327_1004930 | All Organisms → cellular organisms → Bacteria | 2384 | Open in IMG/M |
3300012198|Ga0137364_10259846 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1284 | Open in IMG/M |
3300012199|Ga0137383_10102478 | All Organisms → cellular organisms → Bacteria | 2079 | Open in IMG/M |
3300012200|Ga0137382_10532480 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 836 | Open in IMG/M |
3300012200|Ga0137382_11123438 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 561 | Open in IMG/M |
3300012207|Ga0137381_10583767 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 974 | Open in IMG/M |
3300012209|Ga0137379_10168346 | All Organisms → cellular organisms → Bacteria | 2103 | Open in IMG/M |
3300012211|Ga0137377_10423453 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1270 | Open in IMG/M |
3300012212|Ga0150985_104068493 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
3300012285|Ga0137370_10130393 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1440 | Open in IMG/M |
3300012285|Ga0137370_10712564 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 623 | Open in IMG/M |
3300012349|Ga0137387_10212735 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1390 | Open in IMG/M |
3300012351|Ga0137386_10000173 | All Organisms → cellular organisms → Bacteria | 31670 | Open in IMG/M |
3300012351|Ga0137386_10116056 | All Organisms → cellular organisms → Bacteria | 1902 | Open in IMG/M |
3300012351|Ga0137386_10124512 | All Organisms → cellular organisms → Bacteria | 1835 | Open in IMG/M |
3300012354|Ga0137366_10713116 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 715 | Open in IMG/M |
3300012355|Ga0137369_10520033 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 838 | Open in IMG/M |
3300012361|Ga0137360_11177125 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 663 | Open in IMG/M |
3300012362|Ga0137361_11152094 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 697 | Open in IMG/M |
3300012363|Ga0137390_10575479 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1096 | Open in IMG/M |
3300012382|Ga0134038_1263601 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 517 | Open in IMG/M |
3300012386|Ga0134046_1124940 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1266 | Open in IMG/M |
3300012395|Ga0134044_1312802 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 528 | Open in IMG/M |
3300012402|Ga0134059_1024753 | All Organisms → cellular organisms → Bacteria | 1592 | Open in IMG/M |
3300012407|Ga0134050_1220737 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 769 | Open in IMG/M |
3300012410|Ga0134060_1425120 | All Organisms → cellular organisms → Bacteria | 1711 | Open in IMG/M |
3300012683|Ga0137398_11192672 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 520 | Open in IMG/M |
3300012918|Ga0137396_10010478 | All Organisms → cellular organisms → Bacteria | 5657 | Open in IMG/M |
3300012925|Ga0137419_11205798 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 634 | Open in IMG/M |
3300012972|Ga0134077_10502250 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 537 | Open in IMG/M |
3300012976|Ga0134076_10333301 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 664 | Open in IMG/M |
3300014154|Ga0134075_10072259 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1441 | Open in IMG/M |
3300015264|Ga0137403_10880688 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 746 | Open in IMG/M |
3300015359|Ga0134085_10038535 | All Organisms → cellular organisms → Bacteria | 1885 | Open in IMG/M |
3300015359|Ga0134085_10173988 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 920 | Open in IMG/M |
3300017654|Ga0134069_1174138 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 726 | Open in IMG/M |
3300017657|Ga0134074_1365460 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 534 | Open in IMG/M |
3300017659|Ga0134083_10397561 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 601 | Open in IMG/M |
3300017659|Ga0134083_10563419 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 517 | Open in IMG/M |
3300017927|Ga0187824_10144439 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 786 | Open in IMG/M |
3300018071|Ga0184618_10274941 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 715 | Open in IMG/M |
3300018482|Ga0066669_11042115 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 738 | Open in IMG/M |
3300018482|Ga0066669_11537718 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 605 | Open in IMG/M |
3300019233|Ga0184645_1144731 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 608 | Open in IMG/M |
3300019249|Ga0184648_1028546 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 596 | Open in IMG/M |
3300019249|Ga0184648_1070410 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1465 | Open in IMG/M |
3300019249|Ga0184648_1410972 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 636 | Open in IMG/M |
3300020170|Ga0179594_10121293 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 953 | Open in IMG/M |
3300022724|Ga0242665_10023898 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1438 | Open in IMG/M |
3300025312|Ga0209321_10492583 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 554 | Open in IMG/M |
3300025910|Ga0207684_10166291 | All Organisms → cellular organisms → Bacteria | 1901 | Open in IMG/M |
3300025910|Ga0207684_10999017 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 700 | Open in IMG/M |
3300026015|Ga0208286_1015250 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 601 | Open in IMG/M |
3300026296|Ga0209235_1176982 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 791 | Open in IMG/M |
3300026296|Ga0209235_1179479 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 780 | Open in IMG/M |
3300026313|Ga0209761_1188276 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 926 | Open in IMG/M |
3300026314|Ga0209268_1147653 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 578 | Open in IMG/M |
3300026323|Ga0209472_1257985 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 556 | Open in IMG/M |
3300026325|Ga0209152_10222469 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 706 | Open in IMG/M |
3300026325|Ga0209152_10323846 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 582 | Open in IMG/M |
3300026327|Ga0209266_1227514 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 626 | Open in IMG/M |
3300026327|Ga0209266_1291704 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 513 | Open in IMG/M |
3300026331|Ga0209267_1074398 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1479 | Open in IMG/M |
3300026331|Ga0209267_1097097 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1257 | Open in IMG/M |
3300026332|Ga0209803_1039990 | All Organisms → cellular organisms → Bacteria | 2142 | Open in IMG/M |
3300026332|Ga0209803_1190666 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 765 | Open in IMG/M |
3300026343|Ga0209159_1176271 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 768 | Open in IMG/M |
3300026524|Ga0209690_1051766 | All Organisms → cellular organisms → Bacteria | 1834 | Open in IMG/M |
3300026529|Ga0209806_1082709 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1414 | Open in IMG/M |
3300026530|Ga0209807_1182751 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 763 | Open in IMG/M |
3300026536|Ga0209058_1075837 | All Organisms → cellular organisms → Bacteria | 1784 | Open in IMG/M |
3300026536|Ga0209058_1344357 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 516 | Open in IMG/M |
3300026537|Ga0209157_1251478 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 695 | Open in IMG/M |
3300027748|Ga0209689_1314758 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 603 | Open in IMG/M |
3300027765|Ga0209073_10108159 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 989 | Open in IMG/M |
3300027775|Ga0209177_10054970 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1141 | Open in IMG/M |
3300027775|Ga0209177_10401615 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 549 | Open in IMG/M |
3300027909|Ga0209382_11338329 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 723 | Open in IMG/M |
3300028711|Ga0307293_10223645 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 599 | Open in IMG/M |
3300031424|Ga0308179_1035250 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 607 | Open in IMG/M |
3300031720|Ga0307469_10040335 | All Organisms → cellular organisms → Bacteria | 2828 | Open in IMG/M |
3300031720|Ga0307469_11160039 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 728 | Open in IMG/M |
3300031753|Ga0307477_10568262 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 766 | Open in IMG/M |
3300031820|Ga0307473_10468435 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 843 | Open in IMG/M |
3300031962|Ga0307479_11260867 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 701 | Open in IMG/M |
3300032180|Ga0307471_100054229 | All Organisms → cellular organisms → Bacteria | 3333 | Open in IMG/M |
3300034164|Ga0364940_0148551 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 675 | Open in IMG/M |
3300034164|Ga0364940_0206996 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 575 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 23.66% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 20.61% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 19.08% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 7.63% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.58% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.82% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 3.05% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.05% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.05% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.53% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.53% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.76% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.76% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.76% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.76% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.76% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.76% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.76% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.76% |
Quercus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere | 0.76% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.76% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.76% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Host-Associated | Open in IMG/M |
3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
3300002909 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm | Environmental | Open in IMG/M |
3300002916 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009808 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50 | Environmental | Open in IMG/M |
3300010080 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010103 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010116 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010122 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010133 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300012173 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT517_2 | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012382 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012386 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012395 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012402 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012407 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012410 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019233 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019249 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300025312 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 4 - CSP-I_5_4 | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026015 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_401 (SPAdes) | Environmental | Open in IMG/M |
3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
3300031424 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_150 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300034164 | Sediment microbial communities from East River floodplain, Colorado, United States - 14_s17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
CNAas_10076093 | 3300000532 | Quercus Rhizosphere | AMALVMDARDLAQGNVNPQLLAAVLAQGLREVRRS* |
JGI25385J37094_100260071 | 3300002558 | Grasslands Soil | KRGPAARPKVVEAIARVLEARDLAQGNVNPQLLAAVLADELGGEPA* |
JGI25388J43891_10045924 | 3300002909 | Grasslands Soil | RSGEETGRVVRAIAQVLEARTLAQGNLNPQLVAAVLGSDLGTAG* |
JGI25389J43894_10634552 | 3300002916 | Grasslands Soil | GKVVAAIARVLEARGLAQGNVNPQLVAAVLADDLGGEPA* |
Ga0066683_100945951 | 3300005172 | Soil | ETAQVVQAIAHTFAARELAQGNVNPQLVAAVLADQLAELG* |
Ga0066680_102821551 | 3300005174 | Soil | NGADLDKVVEAIARVLDARRLAQGNVNPQLIAAVLADDLAEHA* |
Ga0070705_1018181071 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | GKLVEAIALVMDARDMAQGNVNPQLLAAVLAEDLQRMRLS* |
Ga0066689_109302652 | 3300005447 | Soil | KLVEAIALVLDARDLAQGNVNPQLLAAVLAEDLQAMRRS* |
Ga0068867_1004727943 | 3300005459 | Miscanthus Rhizosphere | GGDTEKLVEAIALVMDARDLAQGNVNPQLLAAVLADDLRGIRRS* |
Ga0070697_1009894142 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | SEAQRGGETGKLVEAIALVMDARDMAQGNVNPQLLAAVLAEDLQRMRLS* |
Ga0066701_106824531 | 3300005552 | Soil | GKVVEAIARVLEARDLAQGNVNPQLLAAVLADELGGEPA* |
Ga0066692_104734003 | 3300005555 | Soil | VVEAIARVLDARELAQGNVNPQLLAAVLADQLAELA* |
Ga0066704_106389951 | 3300005557 | Soil | TGGEAGKVVEAIARVLEARDLAQGNVNPQLLAAVLADELGGEPA* |
Ga0066700_109909132 | 3300005559 | Soil | GGETEKVVEAIARVFEARDLAQGNVNPQLLAAVLADELGGEPA* |
Ga0066699_103359723 | 3300005561 | Soil | VEAIALVMDARDVAQGNVNPQLLAAVLGEDLHRLQGS* |
Ga0066703_104478441 | 3300005568 | Soil | AKRGGDTDKLVEAIALVMDARDVAQGNVNPQLLATVLAEDLHGTQRS* |
Ga0066694_103125922 | 3300005574 | Soil | RTGKDTGAVVAAISRVLDARGMAQGNVNPQLLAAVLADEMWSNG* |
Ga0066691_104495661 | 3300005586 | Soil | GEAGKVVEAIARVLEARDLAQGNVNPQLLAAVLADELAEPA* |
Ga0066656_111058601 | 3300006034 | Soil | GGETEKVVEAIARVLEARDLAQGNVNPQLLAAVLADELAEPA* |
Ga0066653_105439632 | 3300006791 | Soil | AEAKRGGDTEKLVEAISRVMDARDMAQGNVNPQLLAAVLAEAL* |
Ga0079220_103244821 | 3300006806 | Agricultural Soil | GDTAKLIEAIARTLDAREMAQGNVNPQLLAAVLADDLAVVP* |
Ga0075426_100866784 | 3300006903 | Populus Rhizosphere | AAIARVLAARDAAQGNVNPQLLTAVLADDLAAAR* |
Ga0075436_1001202401 | 3300006914 | Populus Rhizosphere | ETGKVVAAIARVLEARGLAQGNVNPQLVSAVLAADLRATRGAPA* |
Ga0075435_1001968654 | 3300007076 | Populus Rhizosphere | KLVEAIALVLDARDLAQGNVNPQLLAAVLAEDLQARRAS* |
Ga0066710_1024748613 | 3300009012 | Grasslands Soil | KTGGETHKLVQAIARVMDARELAQGNVNPQLVMAVLAEDLAGAEST |
Ga0099830_108230302 | 3300009088 | Vadose Zone Soil | GETEKVVEAIARVLEARDLAQGNVNPQLLAAVLADELAEPA* |
Ga0099827_104991203 | 3300009090 | Vadose Zone Soil | PVVAAIARVLDARELAQGNVNPQLVAAVLAEDLGAGS* |
Ga0066709_1030747941 | 3300009137 | Grasslands Soil | DSGKVVSAIARVLEARELAQGNVNPQLVAAVLGEDLGSPP* |
Ga0111538_105676421 | 3300009156 | Populus Rhizosphere | EVKRGGDTQKLVEAMALVMDARDLAQGNVNPQLLAAVLAGDLREVRRS* |
Ga0105071_10313111 | 3300009808 | Groundwater Sand | KLVEAIARVAAARTAAQGNVNPQLLAAVLADELASDGGDG* |
Ga0127448_1530012 | 3300010080 | Grasslands Soil | VEAIALVLDARDLAQGNVNPQLLAAVLGEDLPGSRAAS* |
Ga0127500_10101072 | 3300010103 | Grasslands Soil | VVSAIARVLDARELTQGNVNPQLVAAVLGEDLGSPR* |
Ga0127466_11473002 | 3300010116 | Grasslands Soil | VEAIARTLDARELAQGNVNPQLVAAVLADQLAELK* |
Ga0127488_10059392 | 3300010122 | Grasslands Soil | AKRGGDTGKLVEAIALVMDARDSAQGNVNPQLLAAVLAEDLQAMRRS* |
Ga0127459_11492761 | 3300010133 | Grasslands Soil | KVVAAIARVLETRTLAQGNVNPQLLAAVLADDLGGEPA* |
Ga0134070_102025901 | 3300010301 | Grasslands Soil | DTARAVEAIAHTLDARELAQGNVNPQLVTAVLADELAELK* |
Ga0134086_104177672 | 3300010323 | Grasslands Soil | VEAIALVLGARDLAQGNVNPQLLAAVLAEDLQAMRRS* |
Ga0134086_104883521 | 3300010323 | Grasslands Soil | GDTEKLVEAIALVLDARDLAQGNVNPQLLAAVLAEDLQASRTS* |
Ga0134065_101049533 | 3300010326 | Grasslands Soil | AIALVLGARDLAQGNVNPQLLAAVLAEDLQAMRRS* |
Ga0134111_103932402 | 3300010329 | Grasslands Soil | RGGDTEKLVEAIALVMDARDLAQGNVNPQLLAAVLAEDLQVTRQS* |
Ga0134080_100636794 | 3300010333 | Grasslands Soil | TEKLVEAISLVMDARDMAQGNVNPQLLAAVLAEAL* |
Ga0134062_100150534 | 3300010337 | Grasslands Soil | VEAIALVLDARDLAQGNVNPQLLAAVLAGDLQAMRTS* |
Ga0134123_108070363 | 3300010403 | Terrestrial Soil | EAIARVTEARVAAQGNVNPQLLAAVLADELAPDGGEG* |
Ga0137327_10049304 | 3300012173 | Soil | VEAIALVMDARDLAQGNVNPQLLAAVLADDLRGVRRA* |
Ga0137364_102598463 | 3300012198 | Vadose Zone Soil | EAIALVLGARDLAQGNVNPQLLAAVLAEDLQAMRRS* |
Ga0137383_101024781 | 3300012199 | Vadose Zone Soil | DKVVEAIARVLDARRLAQGNVNPQLIAAVLADDLAEHA* |
Ga0137382_105324801 | 3300012200 | Vadose Zone Soil | EAIAMVLDARDLAQGNVNPQLLAAVLAEDLQGTRRS* |
Ga0137382_111234381 | 3300012200 | Vadose Zone Soil | SGGDTEKLVEAIARVMDARELAQGNVNPQLLAAVLAEDLRGMP* |
Ga0137381_105837673 | 3300012207 | Vadose Zone Soil | DTDKLVEAIALVLDARDLAQGNVNPQLLATVLAEDLQATRRS* |
Ga0137379_101683461 | 3300012209 | Vadose Zone Soil | DTEKVVEAIAQVLEARGLAQGNVNPQLVAAVLAGDLAAKEPV* |
Ga0137377_104234531 | 3300012211 | Vadose Zone Soil | RVVEAIARTLDARELAQGNVNPQLVAAVLADQLAELK* |
Ga0150985_1040684931 | 3300012212 | Avena Fatua Rhizosphere | DTEKLVEAIALVMDTRDLAQGNVNPQLLAAVLAEDLRAPQA* |
Ga0137370_101303933 | 3300012285 | Vadose Zone Soil | TARVVEAIARTLDARQLAQGNVNPQLVAAVLADRLAELK* |
Ga0137370_107125641 | 3300012285 | Vadose Zone Soil | KRGGDTDKLVEAIALVLDARDLAQGNVNPQLLAAVLAEDLQGTRRS* |
Ga0137387_102127353 | 3300012349 | Vadose Zone Soil | GTQAVVAAISRVLDARAMAQGNVNPQLLAAVLAEDMWSRG* |
Ga0137386_1000017338 | 3300012351 | Vadose Zone Soil | VEAIARVLEARGAAQGNVNPQLVAAVLAEDLAERQ* |
Ga0137386_101160564 | 3300012351 | Vadose Zone Soil | GETDKLVEAIALVMDARDVAQGNVNPQLLAAVLAEDLHGLEAL* |
Ga0137386_101245121 | 3300012351 | Vadose Zone Soil | RRGGDTEKLVEAIACVLDARDLAQGNVNPQLLAAVLAEDLQGIRGS* |
Ga0137366_107131162 | 3300012354 | Vadose Zone Soil | QARTGGETEKLVEAIARVFEARNLAQGNVNPQLLAAVLADELAEPA* |
Ga0137369_105200331 | 3300012355 | Vadose Zone Soil | GETEKVVAAIARVLEARGLAQGNVNPQLVAAVLADDLAESA* |
Ga0137360_111771251 | 3300012361 | Vadose Zone Soil | QARAGGETEKVVEAIARVLEARGLAQGNVNPQLVGAVLADDLAEPA* |
Ga0137361_111520941 | 3300012362 | Vadose Zone Soil | KLVEAIALVLDARDLAQGNVNPQLLAAVLAEDLQMTRRS* |
Ga0137390_105754791 | 3300012363 | Vadose Zone Soil | DTEKLVEAIALVLDARDLAQGNVNPQLLAAVLAEDLQETRRS* |
Ga0134038_12636012 | 3300012382 | Grasslands Soil | ARAVEAIAHTLEARELAQGNVNPQLVTAVLADELAELK* |
Ga0134046_11249403 | 3300012386 | Grasslands Soil | GGETGKLVEAIALVLDARDLAQGNVNPQLLAAVLAEDLQAMRAS* |
Ga0134044_13128022 | 3300012395 | Grasslands Soil | AKVVEAIASVLEARELAQGNVNPQLVAAVLADQLAGLR* |
Ga0134059_10247531 | 3300012402 | Grasslands Soil | EKVVEAIAQVLEARGLAQGNVNPQLVGAVLAEDLAGEAP* |
Ga0134050_12207371 | 3300012407 | Grasslands Soil | AKRGGDTDKLVEAIAMVLDARDLAQGNVNPQLLAAVLAEDLQGTRRS* |
Ga0134060_14251204 | 3300012410 | Grasslands Soil | TAKVVEAIASVLEARELAQGNVNPQLVAAVLADQLAGLR* |
Ga0137398_111926721 | 3300012683 | Vadose Zone Soil | RETRAVVTAMARVLETRELAQGNVNPQLLAAVLVEDLWSGA* |
Ga0137396_1001047811 | 3300012918 | Vadose Zone Soil | ARAGGETAKVVEAIACTLAARGLAQGNVNPQLVAAVLADQLAEPR* |
Ga0137419_112057982 | 3300012925 | Vadose Zone Soil | ETEKVVEAIAQVLEARGLAQGNVNPQLVAAVLADDLAEPA* |
Ga0134077_105022501 | 3300012972 | Grasslands Soil | TTRVVEAIARTLGARELAQGNVNPQLVAAVLADQLAELK* |
Ga0134076_103333012 | 3300012976 | Grasslands Soil | EAIARTLGARELAQGNVNPQLVAAVLADQLAELK* |
Ga0134075_100722593 | 3300014154 | Grasslands Soil | RAGGDTARAVEAIAHTLDARELAQGNVNPQLVTAVLADELAELK* |
Ga0137403_108806881 | 3300015264 | Vadose Zone Soil | MVEAIALVLDARDLAQGNVNPQLLAAVLAEDLQAMRRS* |
Ga0134085_100385354 | 3300015359 | Grasslands Soil | VEAIALVLDARELAQGNVNPQLLAAVLADQLAELA* |
Ga0134085_101739881 | 3300015359 | Grasslands Soil | GGDTGKLVEAIALVMDARDSAQGNVNPQLLAAVLAEDLQAMRRS* |
Ga0134069_11741381 | 3300017654 | Grasslands Soil | SEAKRGGDTEKLVEAIALVLDARDLAQGNVNPQLLAAVLAEAL |
Ga0134074_13654601 | 3300017657 | Grasslands Soil | GDIGKLVEAIALVLDARDLAQGNVNPQLLAAVLAEDLQAMRRS |
Ga0134083_103975612 | 3300017659 | Grasslands Soil | EKVVEAIARVLEARDLAQGNVNPQLLAAVLADELAEPA |
Ga0134083_105634191 | 3300017659 | Grasslands Soil | KLVEAIAQVLEARDLAQGNVNPQLIAAVLAEDLAGGESE |
Ga0187824_101444391 | 3300017927 | Freshwater Sediment | RVVGAISRVLDAREAAQGNVNPQLLTAVLAEDLWSTR |
Ga0184618_102749412 | 3300018071 | Groundwater Sediment | EARTGGATQKLVEAIARVMDARELAQGNVNPQLVAAVLAEDLAGGGA |
Ga0066669_110421151 | 3300018482 | Grasslands Soil | GGESEKLVAAIARVLEVRGLAQGNVNPQLVAAVLADDLTEPA |
Ga0066669_115377182 | 3300018482 | Grasslands Soil | RTGGEAGKVVEAIARVLEARDLAQGNVNPQLLAAVLADELGGEPA |
Ga0184645_11447312 | 3300019233 | Groundwater Sediment | VKTGGETQKLVEAMARVMDARELAQGNVNPQLVTAVLAEDLAGAQSA |
Ga0184648_10285462 | 3300019249 | Groundwater Sediment | RGGDTEKLVEAIALVMDARDLAQGNVNPQLLAAVLADDLQATRRS |
Ga0184648_10704101 | 3300019249 | Groundwater Sediment | GGETQKLVEAIARVMDARELAQGNVNPQLVTAVLAEDLAGAESA |
Ga0184648_14109722 | 3300019249 | Groundwater Sediment | GDTEKLVEAIALVLDARELAQGNVNPQLLAAVLAEDLQVRRRS |
Ga0179594_101212931 | 3300020170 | Vadose Zone Soil | AKTGGETQKLVQAIARVMDARELAQGNVNPQLVMAVLAEDLAAESP |
Ga0242665_100238983 | 3300022724 | Soil | GVVAAIAQVLAARDAAQGNVNPQLLTAVLVDDLAAAR |
Ga0209321_104925831 | 3300025312 | Soil | QKLIEAIAHVLDARELAQGNVNPQLVTAVLAENLGGRS |
Ga0207684_101662914 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | QRGGETGKLVEAIALVMDARDMAQGNVNPQLLAAVLAEDLQRMRLS |
Ga0207684_109990171 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | TDKVVEAIARVLDARRLAQGNVNPQLIAAVLADDLAEQA |
Ga0208286_10152502 | 3300026015 | Rice Paddy Soil | VPTEKLVAAIALVLEARQQAQGNVNPQLLAAVLADDLAAEGVA |
Ga0209235_11769823 | 3300026296 | Grasslands Soil | QARTGGEAGKVVEAIARVLEARDLAQGNVNPQLLAAVLADELAEPA |
Ga0209235_11794791 | 3300026296 | Grasslands Soil | QARTGGEAGKVVEAIARVLEARDLAQGNVNPQLLAAVLADELGGEPA |
Ga0209761_11882763 | 3300026313 | Grasslands Soil | TSAVVAAISRVLDARGMAQGNVNPQLLAAVLADEMWSNG |
Ga0209268_11476532 | 3300026314 | Soil | EAIARVLEARGLAQGNVNPQLVAAVLADDLGGEPA |
Ga0209472_12579851 | 3300026323 | Soil | ERLRAEAKRGGDTEKLVEAMSRVMDARDMAQGNVNPQLLAAVLAEAL |
Ga0209152_102224691 | 3300026325 | Soil | GEAGKVVEAIARVLEARDVAQGNVNPQLLAAVLADELGGEPA |
Ga0209152_103238462 | 3300026325 | Soil | KRGGDMDKLVEAIALVLNARDLAQGNVNPQILAAVLAEDLQATRRS |
Ga0209266_12275142 | 3300026327 | Soil | GQTEKLVEAIARVLEARGLAQGNVNPQLVAAVLADELGGEPA |
Ga0209266_12917041 | 3300026327 | Soil | GQARSGGETEKVVAAISQVLAARSLAQGNVNPQLVAAVLADDLAERA |
Ga0209267_10743981 | 3300026331 | Soil | NGADLDKVVEAIARVLDARRLAQGNVNPQLIAAVLADDLAEHA |
Ga0209267_10970971 | 3300026331 | Soil | VGEDSGKVVSAIARVLEARELAQGNVNPQLVAAVLGEDLGSPP |
Ga0209803_10399901 | 3300026332 | Soil | GETGKVVEAIARVLDARELAQGNVNPQLLAAVLADQLAELA |
Ga0209803_11906661 | 3300026332 | Soil | ARVGKDSGKVVSAIARVLEARELAQGNVNPQLVAAVLGEDLGSPP |
Ga0209159_11762711 | 3300026343 | Soil | GKLVEAIALVLAARDLAQGNVNPQLLAAVLAEDLQAMRRS |
Ga0209690_10517664 | 3300026524 | Soil | GKVVEAIARVLEARDLAQGNVNPQLLAAVLADELGGEPA |
Ga0209806_10827093 | 3300026529 | Soil | DSGKVVSAIARVLEARELAQGNVNPQLVAAVLGEDLGSPP |
Ga0209807_11827513 | 3300026530 | Soil | GKVVAAIARVLEARGLAQGNVNPQLVAAVLADDLGGEPA |
Ga0209058_10758371 | 3300026536 | Soil | AIALVMDARDVAQGNVNPQLLAAVLAEDLHGTQRS |
Ga0209058_13443572 | 3300026536 | Soil | DTGKLVEAIALVMDARDSAQGNVNPQLLAAVLAEDLQAMRRS |
Ga0209157_12514782 | 3300026537 | Soil | GGETTRVVEAIARTLDARELAQGNVNPQLVAAVLADQLAELK |
Ga0209689_13147582 | 3300027748 | Soil | VVEAIARVLEARDLAQGNVNPQLLAAVLADELGGEPA |
Ga0209073_101081591 | 3300027765 | Agricultural Soil | GDTAKLIEAIARTLDAREMAQGNVNPQLLAAVLADDLAVVP |
Ga0209177_100549701 | 3300027775 | Agricultural Soil | RETGKVVAAIARVLEARGLAQGNVNPQLVSAVLAADLRATSGAPA |
Ga0209177_104016151 | 3300027775 | Agricultural Soil | GGVVAAIARVLAARDAAQGNVNPQLLTAALADDLAAAR |
Ga0209382_113383291 | 3300027909 | Populus Rhizosphere | KAGAETQKLVAAIARVMDARELAQGNVNPQLVTAVLAEDLAGVEP |
Ga0307293_102236451 | 3300028711 | Soil | RKVVEAIARVMDARELAQGNVNPQLIAAVLAEDLAGRS |
Ga0308179_10352501 | 3300031424 | Soil | VIAAIAQVLGARSLAQGNVNPQLVAAVLAGELAETGGERA |
Ga0307469_100403351 | 3300031720 | Hardwood Forest Soil | TGKVVAAIARVLEARGLAQGNVNPQLVSAVLAADLRATSGAPA |
Ga0307469_111600391 | 3300031720 | Hardwood Forest Soil | EKVVEAIARVLEARGLAQGNVNPQLVAAVLADDLAEPA |
Ga0307477_105682623 | 3300031753 | Hardwood Forest Soil | GADTAEVVAAISRVLEARDAAQGNVNPQLLAAVLAEDLWSA |
Ga0307473_104684353 | 3300031820 | Hardwood Forest Soil | TGGETEKVVEAIARVLEARDLAQGNVNPQLLAAVLADDLAERA |
Ga0307479_112608671 | 3300031962 | Hardwood Forest Soil | LIEALAQVLEARQMAQGNVNPQLLTAVLSEDLAEAG |
Ga0307471_1000542295 | 3300032180 | Hardwood Forest Soil | VTAIARVLDARGLAQGNVNPQLLAAVLAGDLAGGETA |
Ga0364940_0148551_2_145 | 3300034164 | Sediment | AKTGGETQKLVEAIARVMDARELAQGNVNPQLVTAVLAEDLAGAESA |
Ga0364940_0206996_1_135 | 3300034164 | Sediment | GGETEKLVEAIALVMDARDLAQGNVNPQLLAAVLADDLQATRRS |
⦗Top⦘ |