Basic Information | |
---|---|
Family ID | F062054 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 131 |
Average Sequence Length | 43 residues |
Representative Sequence | MQGMLSGGLLTAAFAAVAGFALIVLVRLFRISRPGGGKARTGD |
Number of Associated Samples | 90 |
Number of Associated Scaffolds | 131 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 50.38 % |
% of genes near scaffold ends (potentially truncated) | 28.24 % |
% of genes from short scaffolds (< 2000 bps) | 84.73 % |
Associated GOLD sequencing projects | 82 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.49 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (54.962 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (33.588 % of family members) |
Environment Ontology (ENVO) | Unclassified (40.458 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.489 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.66% β-sheet: 0.00% Coil/Unstructured: 56.34% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 131 Family Scaffolds |
---|---|---|
PF08768 | THAP4_heme-bd | 54.96 |
PF02635 | DrsE | 15.27 |
PF07685 | GATase_3 | 6.87 |
PF00392 | GntR | 3.05 |
PF01571 | GCV_T | 2.29 |
PF01475 | FUR | 2.29 |
PF08353 | MurT_C | 1.53 |
PF13586 | DDE_Tnp_1_2 | 0.76 |
PF00582 | Usp | 0.76 |
PF01828 | Peptidase_A4 | 0.76 |
PF02728 | Cu_amine_oxidN3 | 0.76 |
PF04978 | DUF664 | 0.76 |
PF01553 | Acyltransferase | 0.76 |
COG ID | Name | Functional Category | % Frequency in 131 Family Scaffolds |
---|---|---|---|
COG0735 | Fe2+ or Zn2+ uptake regulation protein Fur/Zur | Inorganic ion transport and metabolism [P] | 2.29 |
COG0769 | UDP-N-acetylmuramyl tripeptide synthase | Cell wall/membrane/envelope biogenesis [M] | 1.53 |
COG3733 | Cu2+-containing amine oxidase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.76 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 54.96 % |
All Organisms | root | All Organisms | 45.04 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000956|JGI10216J12902_105554042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1430 | Open in IMG/M |
3300004633|Ga0066395_10028196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 2314 | Open in IMG/M |
3300004633|Ga0066395_10250990 | Not Available | 949 | Open in IMG/M |
3300005332|Ga0066388_100218366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2535 | Open in IMG/M |
3300005332|Ga0066388_100356326 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2109 | Open in IMG/M |
3300005332|Ga0066388_100970064 | Not Available | 1418 | Open in IMG/M |
3300005332|Ga0066388_101303240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1252 | Open in IMG/M |
3300005332|Ga0066388_101449678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1197 | Open in IMG/M |
3300005332|Ga0066388_105471634 | Not Available | 643 | Open in IMG/M |
3300005363|Ga0008090_10071678 | Not Available | 757 | Open in IMG/M |
3300005363|Ga0008090_15854244 | Not Available | 686 | Open in IMG/M |
3300005435|Ga0070714_100454667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1217 | Open in IMG/M |
3300005467|Ga0070706_100007445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 10263 | Open in IMG/M |
3300005471|Ga0070698_100042493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 4663 | Open in IMG/M |
3300005713|Ga0066905_100898562 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 775 | Open in IMG/M |
3300005764|Ga0066903_100426584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 2199 | Open in IMG/M |
3300005764|Ga0066903_100530151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 2009 | Open in IMG/M |
3300005764|Ga0066903_101046372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1498 | Open in IMG/M |
3300005764|Ga0066903_101676434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 1209 | Open in IMG/M |
3300005764|Ga0066903_105092967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea coxensis | 696 | Open in IMG/M |
3300005764|Ga0066903_106817435 | Not Available | 593 | Open in IMG/M |
3300006028|Ga0070717_11249029 | Not Available | 676 | Open in IMG/M |
3300006175|Ga0070712_100252999 | Not Available | 1409 | Open in IMG/M |
3300006176|Ga0070765_100609303 | Not Available | 1030 | Open in IMG/M |
3300006804|Ga0079221_10155730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1201 | Open in IMG/M |
3300006806|Ga0079220_10130265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1356 | Open in IMG/M |
3300006854|Ga0075425_100889449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1018 | Open in IMG/M |
3300006854|Ga0075425_102358087 | Not Available | 591 | Open in IMG/M |
3300006871|Ga0075434_100006506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 10714 | Open in IMG/M |
3300006904|Ga0075424_101951260 | Not Available | 620 | Open in IMG/M |
3300006954|Ga0079219_10554162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea coxensis | 825 | Open in IMG/M |
3300009089|Ga0099828_10096234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2553 | Open in IMG/M |
3300010043|Ga0126380_10000078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 22667 | Open in IMG/M |
3300010043|Ga0126380_10348194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1077 | Open in IMG/M |
3300010046|Ga0126384_10281598 | Not Available | 1359 | Open in IMG/M |
3300010046|Ga0126384_11177327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 706 | Open in IMG/M |
3300010047|Ga0126382_10197846 | Not Available | 1427 | Open in IMG/M |
3300010048|Ga0126373_11090643 | Not Available | 864 | Open in IMG/M |
3300010048|Ga0126373_11457748 | Not Available | 750 | Open in IMG/M |
3300010048|Ga0126373_13170473 | Not Available | 512 | Open in IMG/M |
3300010154|Ga0127503_10901747 | Not Available | 823 | Open in IMG/M |
3300010358|Ga0126370_10254290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1365 | Open in IMG/M |
3300010360|Ga0126372_11839349 | Not Available | 649 | Open in IMG/M |
3300010361|Ga0126378_10265297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1814 | Open in IMG/M |
3300010361|Ga0126378_10442983 | Not Available | 1413 | Open in IMG/M |
3300010361|Ga0126378_10638162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1178 | Open in IMG/M |
3300010361|Ga0126378_12675772 | Not Available | 570 | Open in IMG/M |
3300010366|Ga0126379_10250065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1745 | Open in IMG/M |
3300010366|Ga0126379_12233264 | Not Available | 648 | Open in IMG/M |
3300010379|Ga0136449_103536683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio harveyi group → Vibrio parahaemolyticus | 594 | Open in IMG/M |
3300010398|Ga0126383_12150456 | Not Available | 645 | Open in IMG/M |
3300010398|Ga0126383_13239123 | Not Available | 532 | Open in IMG/M |
3300010880|Ga0126350_11643661 | Not Available | 633 | Open in IMG/M |
3300012199|Ga0137383_10375153 | Not Available | 1042 | Open in IMG/M |
3300012211|Ga0137377_11358711 | Not Available | 640 | Open in IMG/M |
3300012211|Ga0137377_11902010 | Not Available | 512 | Open in IMG/M |
3300012948|Ga0126375_10413279 | Not Available | 979 | Open in IMG/M |
3300012971|Ga0126369_10280563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1656 | Open in IMG/M |
3300012971|Ga0126369_10874630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 983 | Open in IMG/M |
3300012971|Ga0126369_11888864 | Not Available | 686 | Open in IMG/M |
3300012971|Ga0126369_11918555 | Not Available | 681 | Open in IMG/M |
3300012971|Ga0126369_13634824 | Not Available | 505 | Open in IMG/M |
3300015371|Ga0132258_11033818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2076 | Open in IMG/M |
3300016404|Ga0182037_10107475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2022 | Open in IMG/M |
3300016404|Ga0182037_10147279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1769 | Open in IMG/M |
3300016422|Ga0182039_10634540 | Not Available | 937 | Open in IMG/M |
3300021086|Ga0179596_10569486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio harveyi group → Vibrio parahaemolyticus | 575 | Open in IMG/M |
3300021407|Ga0210383_10144522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2019 | Open in IMG/M |
3300021432|Ga0210384_10344154 | Not Available | 1343 | Open in IMG/M |
3300021559|Ga0210409_10639072 | Not Available | 934 | Open in IMG/M |
3300021560|Ga0126371_10254834 | Not Available | 1870 | Open in IMG/M |
3300021560|Ga0126371_10919295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 1018 | Open in IMG/M |
3300021560|Ga0126371_11139282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea wenchangensis | 918 | Open in IMG/M |
3300021560|Ga0126371_11610694 | Not Available | 775 | Open in IMG/M |
3300021560|Ga0126371_11784115 | Not Available | 737 | Open in IMG/M |
3300021560|Ga0126371_12250672 | Not Available | 658 | Open in IMG/M |
3300025910|Ga0207684_10027494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4847 | Open in IMG/M |
3300025915|Ga0207693_11442410 | Not Available | 510 | Open in IMG/M |
3300026498|Ga0257156_1010392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1770 | Open in IMG/M |
3300026551|Ga0209648_10126124 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2057 | Open in IMG/M |
3300027725|Ga0209178_1030157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1705 | Open in IMG/M |
3300027765|Ga0209073_10483554 | Not Available | 520 | Open in IMG/M |
3300027787|Ga0209074_10292556 | Not Available | 648 | Open in IMG/M |
3300027857|Ga0209166_10005569 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 8571 | Open in IMG/M |
3300027874|Ga0209465_10388361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio harveyi group → Vibrio parahaemolyticus | 699 | Open in IMG/M |
3300028906|Ga0308309_10970717 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 737 | Open in IMG/M |
3300031543|Ga0318516_10023512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → Microbispora rosea | 3181 | Open in IMG/M |
3300031543|Ga0318516_10047110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2336 | Open in IMG/M |
3300031543|Ga0318516_10097944 | Not Available | 1655 | Open in IMG/M |
3300031543|Ga0318516_10162211 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1285 | Open in IMG/M |
3300031544|Ga0318534_10162169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1291 | Open in IMG/M |
3300031546|Ga0318538_10397568 | Not Available | 745 | Open in IMG/M |
3300031546|Ga0318538_10603661 | Not Available | 595 | Open in IMG/M |
3300031546|Ga0318538_10686297 | Not Available | 555 | Open in IMG/M |
3300031549|Ga0318571_10325881 | Not Available | 584 | Open in IMG/M |
3300031561|Ga0318528_10682585 | Not Available | 550 | Open in IMG/M |
3300031564|Ga0318573_10362528 | Not Available | 778 | Open in IMG/M |
3300031681|Ga0318572_10977582 | Not Available | 503 | Open in IMG/M |
3300031719|Ga0306917_11337831 | Not Available | 554 | Open in IMG/M |
3300031724|Ga0318500_10524913 | Not Available | 596 | Open in IMG/M |
3300031747|Ga0318502_11029826 | Not Available | 502 | Open in IMG/M |
3300031763|Ga0318537_10182001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 783 | Open in IMG/M |
3300031765|Ga0318554_10464106 | Not Available | 717 | Open in IMG/M |
3300031769|Ga0318526_10034374 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1866 | Open in IMG/M |
3300031769|Ga0318526_10123236 | Not Available | 1046 | Open in IMG/M |
3300031769|Ga0318526_10366121 | Not Available | 589 | Open in IMG/M |
3300031770|Ga0318521_10411121 | Not Available | 807 | Open in IMG/M |
3300031771|Ga0318546_10910437 | Not Available | 619 | Open in IMG/M |
3300031782|Ga0318552_10037737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2247 | Open in IMG/M |
3300031792|Ga0318529_10054068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1737 | Open in IMG/M |
3300031793|Ga0318548_10548148 | Not Available | 564 | Open in IMG/M |
3300031797|Ga0318550_10334454 | Not Available | 734 | Open in IMG/M |
3300031799|Ga0318565_10211311 | Not Available | 943 | Open in IMG/M |
3300031805|Ga0318497_10244409 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 995 | Open in IMG/M |
3300031846|Ga0318512_10282791 | Not Available | 822 | Open in IMG/M |
3300031879|Ga0306919_10141909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1743 | Open in IMG/M |
3300031896|Ga0318551_10334209 | Not Available | 856 | Open in IMG/M |
3300031897|Ga0318520_10323064 | Not Available | 933 | Open in IMG/M |
3300031912|Ga0306921_11931989 | Not Available | 631 | Open in IMG/M |
3300031945|Ga0310913_10118155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1808 | Open in IMG/M |
3300031945|Ga0310913_10399950 | Not Available | 974 | Open in IMG/M |
3300031981|Ga0318531_10500687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 550 | Open in IMG/M |
3300032001|Ga0306922_11209072 | Not Available | 769 | Open in IMG/M |
3300032008|Ga0318562_10202054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1151 | Open in IMG/M |
3300032043|Ga0318556_10398091 | Not Available | 720 | Open in IMG/M |
3300032044|Ga0318558_10278692 | Not Available | 825 | Open in IMG/M |
3300032052|Ga0318506_10209463 | Not Available | 861 | Open in IMG/M |
3300032060|Ga0318505_10132246 | Not Available | 1148 | Open in IMG/M |
3300032063|Ga0318504_10243592 | Not Available | 845 | Open in IMG/M |
3300032065|Ga0318513_10022511 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2650 | Open in IMG/M |
3300032076|Ga0306924_11276012 | Not Available | 790 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 33.59% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 22.90% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 12.21% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.11% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.58% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.58% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.82% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.05% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.53% |
Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 1.53% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.76% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.76% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.76% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.76% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.76% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.76% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.76% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.76% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI10216J12902_1055540423 | 3300000956 | Soil | MQGMLSGGLLTASFAAVAGLALVVLVRLFWISRPGGRKARTGD* |
Ga0066395_100281962 | 3300004633 | Tropical Forest Soil | MQGMLSGGLLAAAFAAVAGFALVVLVRLFWISRPGGRRARTGD* |
Ga0066395_102509902 | 3300004633 | Tropical Forest Soil | MQGMLSGGLLTAAFVAVAGFALVVLVRLSRISRPGGGKTRTGD* |
Ga0066388_1002183662 | 3300005332 | Tropical Forest Soil | MQGMLSGVLLTAAFGAVAGFALVVLVRLFRISRPGGRKARTGD* |
Ga0066388_1003563263 | 3300005332 | Tropical Forest Soil | MQGMLSGGLLTAAFVAVAGFALIVLARLSRISRPGGGKTRTGD* |
Ga0066388_1009700641 | 3300005332 | Tropical Forest Soil | MQGMLSGGLLTAAFAAGAGFALVVLVRLFRIGRPGGRKARTGG* |
Ga0066388_1013032402 | 3300005332 | Tropical Forest Soil | MQGMLSGGLLTAAFAAVAGFALVVLVRLLWISRPGDRKARAGG* |
Ga0066388_1014496782 | 3300005332 | Tropical Forest Soil | MQGMLSGGLLTAAFAAVAGLALVVLARLVRISRPGGRKARTGG* |
Ga0066388_1054716341 | 3300005332 | Tropical Forest Soil | MQGMLSGALLVAAFAAVAGSGLVVLVRLFRISRPGGRKARTGA* |
Ga0008090_100716782 | 3300005363 | Tropical Rainforest Soil | MQGMLSGGLLTAAFAAVAGFALVVLVRLFWISRRGDRKARTGG* |
Ga0008090_158542442 | 3300005363 | Tropical Rainforest Soil | MQGMLSGGLLTAAFVAAAGFALIVLGRLFRISRPGGGKARTGD* |
Ga0070714_1004546673 | 3300005435 | Agricultural Soil | MQGMLSGGLLTAGFAAVAGFALVVLVRLLRISRPGGRKARTGD* |
Ga0070706_1000074457 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MLSGGLLTAAFAAVAGFALIVLVRLFRISRPGGGKARAGG* |
Ga0070698_1000424935 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MQGMLSGGLLTAAFAAVAGFALIVLVRLFRISRPGGGKARAGG* |
Ga0066905_1008985622 | 3300005713 | Tropical Forest Soil | MLGMLSGGLLTAAFAAVAGLALVVLARLIRISRPGGRKARTGG* |
Ga0066903_1004265841 | 3300005764 | Tropical Forest Soil | MQGMLGGGLLAAAFAAVAGFALVVLVRLFRISRPGGRKARAGD* |
Ga0066903_1005301512 | 3300005764 | Tropical Forest Soil | MQGMLSGGLLTAAFAAVAGFALVVLVRLFWISRPGGRKARTGG* |
Ga0066903_1010463722 | 3300005764 | Tropical Forest Soil | MQGMLSGGLLTAAFAAVAGFALIVLVRLFRISRPGGGKARTDG* |
Ga0066903_1016764342 | 3300005764 | Tropical Forest Soil | MQGMLSGGLLTAAFVAVAGFALIALVRLFRIGRPGGGQARTGD* |
Ga0066903_1050929672 | 3300005764 | Tropical Forest Soil | MQGMLSGGLLTAAFAAVAGLALVMLVRLFWISRPGDRKARAGD* |
Ga0066903_1068174352 | 3300005764 | Tropical Forest Soil | MQGMLSGGLLTAAFVAVAGFALIVLVRLSRISRPGGGKTRTGD* |
Ga0070717_112490291 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | PLRTLRCMQGMLSGGLLTAAFAAVAGFALIVLVRLFRISRPGGGKARAGG* |
Ga0070712_1002529992 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MQGMLSGGLLTAGFAAVAGFALVVLVRLLRISRPGGGKARTGD* |
Ga0070765_1006093032 | 3300006176 | Soil | MQGMVSGGLLAAVFAATAGIALLVLVRLFRISRPGGPKARTGA* |
Ga0079221_101557301 | 3300006804 | Agricultural Soil | MQGILSGGLLTASFAAVAGLALVVLVRLLRISRPGGRKARTGD* |
Ga0079220_101302652 | 3300006806 | Agricultural Soil | MQGMLSGGLLTASFAAVAGLALVVLVRLLRISRPGGRKARTGD* |
Ga0075425_1008894492 | 3300006854 | Populus Rhizosphere | MQEMLSGGLLTAAFAAVAGFALVVLVRLLRISRPGDRKARTGG* |
Ga0075425_1023580872 | 3300006854 | Populus Rhizosphere | MQGMLSGGLLTAAFAAVAGFALLVLVRLFRISRPGGGKARTGG* |
Ga0075434_10000650611 | 3300006871 | Populus Rhizosphere | MQGMLSGGLLTASFAAVAGLALVVLVRLLWISRPGGRKARTGD* |
Ga0075424_1019512602 | 3300006904 | Populus Rhizosphere | MQGMLSGGLLTAAFAAVAGFALVVLVRLLRISRPGDRTARTGG* |
Ga0079219_105541622 | 3300006954 | Agricultural Soil | MQEMLSGGLLTAAFAAVAGFALVVLVRLLRISRPGDRTARTGG* |
Ga0099828_100962343 | 3300009089 | Vadose Zone Soil | MLGGGLLVAAFAAVAGFALIVLARLFRISRPGGRKARARG* |
Ga0126380_1000007813 | 3300010043 | Tropical Forest Soil | MLSGGLLTAAFAAVAGLALVVLARLIRISRPGGRKARTGG* |
Ga0126380_103481942 | 3300010043 | Tropical Forest Soil | MQGMLSGGLLTASFAAVAGLALVVLVRLFLISGPGRRKARTGD* |
Ga0126384_102815981 | 3300010046 | Tropical Forest Soil | MLSGGLLTAAFAAVAGLALVVLACLIRISRPGGRKARTGG* |
Ga0126384_111773272 | 3300010046 | Tropical Forest Soil | MQGMLSGVLLTAAFGAAAGFALMVLVRLFRISRPAGRKARTSD* |
Ga0126382_101978462 | 3300010047 | Tropical Forest Soil | MQGMLSGALVVAAFAAVAGSGLVVLVRLFRISRPGGRKARTGA* |
Ga0126373_110906431 | 3300010048 | Tropical Forest Soil | YRMGVRCMQGMLSGALLVAAFAAVAGSGLVVLVRLFRISRPGGRKARTGA* |
Ga0126373_114577481 | 3300010048 | Tropical Forest Soil | MQGMLSGGLLTAAFAAVAGFALVVLVRLLRISRPGDRKARTGG* |
Ga0126373_131704732 | 3300010048 | Tropical Forest Soil | MQGMLGGGLLTAAFAAVAGLALVVLVRLFWISRPGGRKARTGG* |
Ga0127503_109017471 | 3300010154 | Soil | SGGLLTAAFAAVAGFALIVLVRLFRISRPGGGKARAGG* |
Ga0126370_102542902 | 3300010358 | Tropical Forest Soil | MISGGLLTAAFAAAAGFALVVLVRLFRISRPGGRRARTGG* |
Ga0126372_118393491 | 3300010360 | Tropical Forest Soil | MQGMLSGGLLTAAFAAVAGFALVVLVRLFWISRPGVRKAHAGD* |
Ga0126378_102652973 | 3300010361 | Tropical Forest Soil | MISGGLLTAAFAAVAGFALVVLVRLFRISRPGGRRARTGG* |
Ga0126378_104429832 | 3300010361 | Tropical Forest Soil | MQGLLSGGLLTAAFVAVAGFALIVLVRLSRISRPGGGKTRTGD* |
Ga0126378_106381621 | 3300010361 | Tropical Forest Soil | MQGMLSGALLVAAFAAVAGSGLVVLVRLFRISRPGGRKART |
Ga0126378_126757721 | 3300010361 | Tropical Forest Soil | MQGMLSGGLLTAAFAAVAGFALVVLVRLFWISRPGGRRARTGD* |
Ga0126379_102500652 | 3300010366 | Tropical Forest Soil | MQGMLSGGLLTAAFAAVAGFALVVLVRLFWISRPGGRKARAGD* |
Ga0126379_122332642 | 3300010366 | Tropical Forest Soil | MQGMLSGGLLAAAFAAVAGFVLVVLVRLFWISRPGGRRARTGD* |
Ga0136449_1035366832 | 3300010379 | Peatlands Soil | MVSGGLLAVVFTAVAGSALVLLVRLFRISRPGRGGARTGA* |
Ga0126383_121504561 | 3300010398 | Tropical Forest Soil | MQGMLSGGLLTAAFAAVAGFALIVLVRLLRISRPGDRKARAGD* |
Ga0126383_132391231 | 3300010398 | Tropical Forest Soil | MISGGLLTAAFAAVAGFALVVLVRLFRISRPGCRRARTGG* |
Ga0126350_116436612 | 3300010880 | Boreal Forest Soil | MVSGGLLAAVFAAAAGIALVVLVRLFRISRPGGPK |
Ga0137383_103751532 | 3300012199 | Vadose Zone Soil | MQGMLSGGLLTAAFVAVVGFALIVLVCLFRISRPGGGKARASG* |
Ga0137377_113587111 | 3300012211 | Vadose Zone Soil | MQGMLSGGLLTAAFAAVAGFALIVLVRLFRISRPGGGKARAS |
Ga0137377_119020102 | 3300012211 | Vadose Zone Soil | MQGMLSGGLLVAVFAAVAGAALVVLLRLFRISRPSRSEARTSD* |
Ga0126375_104132792 | 3300012948 | Tropical Forest Soil | MLSGGLLTAAFAAVAGLALVVLARLIRISRSGGRKARTGG* |
Ga0126369_102805632 | 3300012971 | Tropical Forest Soil | MQGMLSGGLLTAAFVAVAGFALIVLVRLSRISRPGRRQDAHR* |
Ga0126369_108746302 | 3300012971 | Tropical Forest Soil | MQGMLSGGLLTAAFVAVAGFALIVLVRLFRISRPGGGKARTDG* |
Ga0126369_118888642 | 3300012971 | Tropical Forest Soil | MQGMLSGGLLAAAFAAVAGFALVVLVRLCWISRPGDRKARTGG* |
Ga0126369_119185552 | 3300012971 | Tropical Forest Soil | MQGMLGGGLLAAAFAAVAGFALVVLVRLFRISRPGGRKARGGD* |
Ga0126369_136348241 | 3300012971 | Tropical Forest Soil | MQGMLSGGLLTASFAAVAGLALVVLVRLFWISRPGGHKAHTGD* |
Ga0132258_110338182 | 3300015371 | Arabidopsis Rhizosphere | MLSGVLLTAAFAAVAGFALVVLVRLLRISRPAGRKARAGD* |
Ga0182037_101074751 | 3300016404 | Soil | MQGMLSGGLLTAAFAAVAGFALVVLVRLLRISRPGDR |
Ga0182037_101472794 | 3300016404 | Soil | MQGMLSGGLLTAAFVAVAGFALIVLVRLSRISRPGGGK |
Ga0182039_106345401 | 3300016422 | Soil | PTRVRCMQGMLSGGLLTAAFAAVAGFALVVLVRLLRISRPGDRKARTGG |
Ga0179596_105694862 | 3300021086 | Vadose Zone Soil | MLGGGLLVAAFAAVAGFALIVLARLFRIGRPGGRKARARG |
Ga0210383_101445221 | 3300021407 | Soil | MVSGGLLAVVFTAVAGSALVLLVRLFRISRPGRGGARTGA |
Ga0210384_103441542 | 3300021432 | Soil | MVSGGLLAAVFAATAGIALLVLVRLFRISRPGGPKARTGA |
Ga0210409_106390721 | 3300021559 | Soil | MVSAGLLAAGFAAAAGIAVLVLVRLFRISRPGGPRARTGA |
Ga0126371_102548343 | 3300021560 | Tropical Forest Soil | MQGMLSGGLLAAAFAAVAGFALVVLVRLFWISRPGGRRARTGD |
Ga0126371_109192952 | 3300021560 | Tropical Forest Soil | MQGMLSGGLLTAAFVAVAGFALIVLVRLSRISRPGRRQDAHR |
Ga0126371_111392822 | 3300021560 | Tropical Forest Soil | MQGMLGGGLLAAAFAAVAGFALVVLVRLFRISRPGGRKARAGD |
Ga0126371_116106941 | 3300021560 | Tropical Forest Soil | MQGMLSGGLLTAAFAAVAGFALVVLVRLFWISRPGGRKARTGG |
Ga0126371_117841151 | 3300021560 | Tropical Forest Soil | RSMQGMLSGGLLVAAFAAIAGCALVVLVRLIRISRPGGPKARTGG |
Ga0126371_122506721 | 3300021560 | Tropical Forest Soil | MQGMLSGGLLTAAFAAVAGFALVVLLRLFWISRPGDRKAHTGG |
Ga0207684_100274945 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MQGMLSGGLLTAAFAAVAGFALIVLVRLFRISRPGGGKARAGG |
Ga0207693_114424102 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | QGMLSGGLLTAGFAAVAGFALVVLVRLLRISRPGGGKARTGD |
Ga0257156_10103923 | 3300026498 | Soil | MQGMLSGGLLTAAFAAVAGFALIVLVRLFRISRPGGGKARASG |
Ga0209648_101261242 | 3300026551 | Grasslands Soil | MLGGGLLVAAFAAVAGFALIVLARLFRISRPGGRKARARG |
Ga0209178_10301572 | 3300027725 | Agricultural Soil | MQGMLSGGLLTASFAAVAGLALVVLVRLLRISRPGGRKARTGD |
Ga0209073_104835541 | 3300027765 | Agricultural Soil | MQGMLSGGLLTASFAAVAGFALVVLVRLLRISRPGGRKARTGD |
Ga0209074_102925562 | 3300027787 | Agricultural Soil | MQGMLSGGLLTAGFAAVAGFALVVLVRLLRISRPGGRKARTGD |
Ga0209166_100055697 | 3300027857 | Surface Soil | MQGMLSGGLLAVVFAAVAGVALVVLARLFRISRPGRPQAAAGD |
Ga0209465_103883611 | 3300027874 | Tropical Forest Soil | MQGMLSGGLLTAAFVAVAGFALIVLVRLSRISRPGGGKTRTGD |
Ga0308309_109707172 | 3300028906 | Soil | MQGMVSGGLLAAVFAATAGIALLVLVRLFRISRPGGPKARTGA |
Ga0318516_100235123 | 3300031543 | Soil | MQGMLSGGLLVAAFVAVAGFALIVLVRLSRISRPGGGQTRTGD |
Ga0318516_100471104 | 3300031543 | Soil | MQGMLSGGLLTAAFVAVAGFALIVLVRLFRISRPGGGKARTGD |
Ga0318516_100979443 | 3300031543 | Soil | MLSGGLLVAAFAAVAGCALIVLVRLFRISRPGGPKARTGD |
Ga0318516_101622113 | 3300031543 | Soil | MQGMLSGGLLTAAFVAVAGFALIVLVRLFRISRPGGGKTRTGD |
Ga0318534_101621691 | 3300031544 | Soil | MQGMLSGELLTAAFAAVAGFALVVLVRLLRISRPGDRKARTGG |
Ga0318538_103975682 | 3300031546 | Soil | MQGMLSGGLLTAAFAAVAGFALIVLVRLFRISRPGGGKTRTGD |
Ga0318538_106036611 | 3300031546 | Soil | MQGMLSGGLLTAAFAAVAGFALVVLVRLVRISRPGDRKARTGG |
Ga0318538_106862971 | 3300031546 | Soil | MQGLLSGGLLTAAFVAVAGFALIVLVRLFRISRPGGGKTRTGD |
Ga0318571_103258812 | 3300031549 | Soil | MQGMLSGGLLTAAFAAVAGFALLVLVRLVRIARPGSRKARAGG |
Ga0318528_106825851 | 3300031561 | Soil | MQGMLSGGLLVAAFVAVAGFALIVLMRLSRISRPGGGQTR |
Ga0318573_103625281 | 3300031564 | Soil | MQGMLSGGLLVAAFAAVAGCALIVLVRLFRISRPGGPKARTGD |
Ga0318572_109775822 | 3300031681 | Soil | RDPTRVRSMQGMLSGGLLVAAFAAVAGCALIVLVRLFRISRPGGPKARTGG |
Ga0306917_113378311 | 3300031719 | Soil | SGGLLTAAFAAVAGFALLVLVRLFRIGRPGGRKARAGG |
Ga0318500_105249132 | 3300031724 | Soil | GGLLTAAFAAVAGFALVVLVRLLRISRPGDRKARTGG |
Ga0318502_110298261 | 3300031747 | Soil | MQGMLSGELLTAAFAAVAGFALVVLVRLLRISRPGDR |
Ga0318537_101820012 | 3300031763 | Soil | MQGMLSGGLLTAAFAAVAGFALIVLVRLFRISRPGGGKARTGD |
Ga0318554_104641062 | 3300031765 | Soil | MQGMLSGGLLTAAFAAVAGFALLVLVRLVRIGRPGGRKARAGG |
Ga0318526_100343744 | 3300031769 | Soil | HPMGVRCMQGLLSGGLLTAAFVAVAGFALIVLVRLFRISRPGGGKTRTGD |
Ga0318526_101232361 | 3300031769 | Soil | MQGMLSGGLLVAAFVAVAGFALIVLVRLSRISRPGGGKTRTGD |
Ga0318526_103661211 | 3300031769 | Soil | GLLTAAFAAVAGFALVVLVRLVRISRPGDRKARTGG |
Ga0318521_104111211 | 3300031770 | Soil | MHGMLSGGLLTAAFAAVAGFALIVLVRLFRISRPGGGKTRTGD |
Ga0318546_109104371 | 3300031771 | Soil | MLSGGLLVAAFAAVAGCALIVLVRLFRISRPGGPKARTGG |
Ga0318552_100377371 | 3300031782 | Soil | LIGGLLVAAFVAVAGFALIVLVRLSRISRPGGGQTRTGD |
Ga0318529_100540681 | 3300031792 | Soil | PMGVRCMQGMLSGGLLVAAFVAVAGFALIVLVRLSRISRPGGGQTRTGD |
Ga0318548_105481482 | 3300031793 | Soil | QGMLSGGLLVAAFAAVAGCALIVLVRLFRISRPGGPKARTGD |
Ga0318550_103344542 | 3300031797 | Soil | SGPTRVRCMQGMLSGGLLTAAFAAVAGFALVVLVRLVRISRPGDRKARTGG |
Ga0318565_102113111 | 3300031799 | Soil | TRVRCMQGMLSGGLLTAAFAAVAGFALVVLVRLVRISRPGDRKARTGG |
Ga0318497_102444092 | 3300031805 | Soil | MQGMLSGGLLTAAFAAVAGFALLVLVRLFRIGRPGGRKARAGG |
Ga0318512_102827911 | 3300031846 | Soil | VRCMQGMLSGGLLTAAFAAVAGFALVVLVRLLRISRPGDRKARTGG |
Ga0306919_101419093 | 3300031879 | Soil | MQGMLSGGLLTAAFAAVAGFALVVLVRLLRISRPGDRKARTGG |
Ga0318551_103342092 | 3300031896 | Soil | SSPPLRTLRCMQGMLSGGLLTAAFAAVAGFALLVLVRLFRIGRPGGRKARAGG |
Ga0318520_103230642 | 3300031897 | Soil | FKAWPLRTLRCMQGMLSGGLLTAAFAAVAGFALLVLVRLFRIGRPGGRKPRAGG |
Ga0306921_119319891 | 3300031912 | Soil | QGMLSGGLLTAAFAAVAGFALVMLVRLFWISRPGGRKARTGG |
Ga0310913_101181551 | 3300031945 | Soil | MQGMLSGGLLTAAFVAVAGFALIVLVRLFRISRPGGGKART |
Ga0310913_103999502 | 3300031945 | Soil | GVRRMQGMLSGGLLTAAFVAVAGFALIVLVRLFRISRPGGGKARTGD |
Ga0318531_105006871 | 3300031981 | Soil | QGMLSGGLLTAAFAAVAGFALVVLVRLLRISRPGDRKARTGG |
Ga0306922_112090721 | 3300032001 | Soil | MQGMLSGGLLTAAFAAVAGFALLVLVRLFRIARPGGRKARAGG |
Ga0318562_102020543 | 3300032008 | Soil | MQGMLSGGLLTAAFVAVAGFALIVLVRLFRISRPGG |
Ga0318556_103980911 | 3300032043 | Soil | CMQGMLSGGLLTAAFVAVAGFALIVLVRLFRISRPGGGKTRTGD |
Ga0318558_102786921 | 3300032044 | Soil | PRHPMGVRCMQGMLSGGLLVAAFVAVAGFALIVLVRLSRISRPGGGQTRTGD |
Ga0318506_102094632 | 3300032052 | Soil | PTRVRCMQGMLSGGLLTAAFAAVAGFALVVLVRLVRISRPGDRKARTGG |
Ga0318505_101322462 | 3300032060 | Soil | PMGVRCMQGMLSGGLLTAAFVAVAGVALIVLVRLFRISRPGGGKARTGD |
Ga0318504_102435922 | 3300032063 | Soil | CMQGMLSGGLLTAAFAAVAGFALVVLVRLVRISRPGDRKARTGG |
Ga0318513_100225111 | 3300032065 | Soil | TRVRSMQGMLSGGLLVAAFAAVAGCALIVLVRLFRISRPGGPKARTGG |
Ga0306924_112760122 | 3300032076 | Soil | MQGMLSGGLLTAAFVAVAGFALIVLVRLFRISRPGGGKTR |
⦗Top⦘ |