Basic Information | |
---|---|
Family ID | F062218 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 131 |
Average Sequence Length | 39 residues |
Representative Sequence | KDASFTLYLANNAARTPVLLEAVMPFATARVELLKAK |
Number of Associated Samples | 100 |
Number of Associated Scaffolds | 131 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.78 % |
% of genes near scaffold ends (potentially truncated) | 90.84 % |
% of genes from short scaffolds (< 2000 bps) | 86.26 % |
Associated GOLD sequencing projects | 95 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.58 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (74.809 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (35.878 % of family members) |
Environment Ontology (ENVO) | Unclassified (35.878 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.092 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 30.77% Coil/Unstructured: 69.23% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 131 Family Scaffolds |
---|---|---|
PF13580 | SIS_2 | 30.53 |
PF03720 | UDPG_MGDP_dh_C | 22.90 |
PF03721 | UDPG_MGDP_dh_N | 7.63 |
PF03551 | PadR | 3.82 |
PF13418 | Kelch_4 | 3.05 |
PF11306 | DUF3108 | 2.29 |
PF12704 | MacB_PCD | 2.29 |
PF01925 | TauE | 1.53 |
PF14257 | DUF4349 | 1.53 |
PF01047 | MarR | 1.53 |
PF01979 | Amidohydro_1 | 0.76 |
PF00903 | Glyoxalase | 0.76 |
PF16363 | GDP_Man_Dehyd | 0.76 |
PF04134 | DCC1-like | 0.76 |
PF13174 | TPR_6 | 0.76 |
PF09844 | DUF2071 | 0.76 |
PF12146 | Hydrolase_4 | 0.76 |
PF00753 | Lactamase_B | 0.76 |
PF07593 | UnbV_ASPIC | 0.76 |
PF00171 | Aldedh | 0.76 |
PF03683 | UPF0175 | 0.76 |
PF13854 | Kelch_5 | 0.76 |
PF01370 | Epimerase | 0.76 |
COG ID | Name | Functional Category | % Frequency in 131 Family Scaffolds |
---|---|---|---|
COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 7.63 |
COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 7.63 |
COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 7.63 |
COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 7.63 |
COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 7.63 |
COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 3.82 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 3.82 |
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 3.82 |
COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 1.53 |
COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.76 |
COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.76 |
COG2886 | Predicted antitoxin, contains HTH domain | General function prediction only [R] | 0.76 |
COG3011 | Predicted thiol-disulfide oxidoreductase YuxK, DCC family | General function prediction only [R] | 0.76 |
COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.76 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 74.81 % |
Unclassified | root | N/A | 25.19 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001181|JGI12663J13571_104185 | Not Available | 532 | Open in IMG/M |
3300001661|JGI12053J15887_10611525 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
3300002562|JGI25382J37095_10117142 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 914 | Open in IMG/M |
3300002907|JGI25613J43889_10045510 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1240 | Open in IMG/M |
3300004091|Ga0062387_101102047 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300004120|Ga0058901_1500514 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
3300005332|Ga0066388_102224250 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
3300005434|Ga0070709_11431682 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
3300005541|Ga0070733_11102522 | Not Available | 532 | Open in IMG/M |
3300005557|Ga0066704_11045523 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
3300005568|Ga0066703_10509012 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 714 | Open in IMG/M |
3300005568|Ga0066703_10732388 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300005574|Ga0066694_10030752 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2402 | Open in IMG/M |
3300005921|Ga0070766_10293824 | Not Available | 1042 | Open in IMG/M |
3300006028|Ga0070717_10647418 | Not Available | 959 | Open in IMG/M |
3300006163|Ga0070715_10345479 | Not Available | 811 | Open in IMG/M |
3300006175|Ga0070712_101530099 | Not Available | 583 | Open in IMG/M |
3300006176|Ga0070765_101915613 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
3300006796|Ga0066665_10032521 | All Organisms → cellular organisms → Bacteria | 3439 | Open in IMG/M |
3300006797|Ga0066659_11037718 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 685 | Open in IMG/M |
3300006914|Ga0075436_100989795 | Not Available | 631 | Open in IMG/M |
3300009038|Ga0099829_10367495 | All Organisms → cellular organisms → Bacteria | 1186 | Open in IMG/M |
3300009088|Ga0099830_11134274 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 648 | Open in IMG/M |
3300009088|Ga0099830_11624730 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
3300009088|Ga0099830_11718254 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
3300009089|Ga0099828_10409623 | All Organisms → cellular organisms → Bacteria | 1223 | Open in IMG/M |
3300009089|Ga0099828_11015012 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 739 | Open in IMG/M |
3300009137|Ga0066709_100417298 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1867 | Open in IMG/M |
3300009162|Ga0075423_10906227 | Not Available | 935 | Open in IMG/M |
3300010322|Ga0134084_10006940 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2744 | Open in IMG/M |
3300010359|Ga0126376_10215429 | Not Available | 1604 | Open in IMG/M |
3300010360|Ga0126372_10721817 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
3300010398|Ga0126383_10616906 | Not Available | 1157 | Open in IMG/M |
3300010398|Ga0126383_11981609 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 670 | Open in IMG/M |
3300011120|Ga0150983_13086831 | Not Available | 524 | Open in IMG/M |
3300011120|Ga0150983_13195329 | All Organisms → cellular organisms → Bacteria | 1208 | Open in IMG/M |
3300011120|Ga0150983_13309554 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
3300011120|Ga0150983_14519442 | Not Available | 546 | Open in IMG/M |
3300011270|Ga0137391_11056123 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 659 | Open in IMG/M |
3300011270|Ga0137391_11267901 | Not Available | 584 | Open in IMG/M |
3300011270|Ga0137391_11360956 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
3300011271|Ga0137393_10019873 | All Organisms → cellular organisms → Bacteria | 4883 | Open in IMG/M |
3300012189|Ga0137388_10275473 | All Organisms → cellular organisms → Bacteria | 1537 | Open in IMG/M |
3300012202|Ga0137363_10384257 | All Organisms → cellular organisms → Bacteria | 1167 | Open in IMG/M |
3300012202|Ga0137363_10501769 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1019 | Open in IMG/M |
3300012202|Ga0137363_11714157 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
3300012203|Ga0137399_10163964 | All Organisms → cellular organisms → Bacteria | 1784 | Open in IMG/M |
3300012203|Ga0137399_11796083 | Not Available | 502 | Open in IMG/M |
3300012362|Ga0137361_10336615 | All Organisms → cellular organisms → Bacteria | 1384 | Open in IMG/M |
3300012582|Ga0137358_10044215 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2956 | Open in IMG/M |
3300012582|Ga0137358_10145379 | Not Available | 1614 | Open in IMG/M |
3300012582|Ga0137358_11029725 | Not Available | 530 | Open in IMG/M |
3300012685|Ga0137397_10228288 | Not Available | 1386 | Open in IMG/M |
3300012918|Ga0137396_10018036 | All Organisms → cellular organisms → Bacteria | 4477 | Open in IMG/M |
3300012918|Ga0137396_10026153 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3812 | Open in IMG/M |
3300012918|Ga0137396_10304376 | All Organisms → cellular organisms → Bacteria | 1179 | Open in IMG/M |
3300012923|Ga0137359_10729792 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
3300012924|Ga0137413_10178161 | All Organisms → cellular organisms → Bacteria | 1412 | Open in IMG/M |
3300012924|Ga0137413_11016582 | Not Available | 651 | Open in IMG/M |
3300012925|Ga0137419_10049030 | All Organisms → cellular organisms → Bacteria | 2713 | Open in IMG/M |
3300012929|Ga0137404_10141855 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1989 | Open in IMG/M |
3300012929|Ga0137404_10668999 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 937 | Open in IMG/M |
3300012929|Ga0137404_10695565 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 919 | Open in IMG/M |
3300012930|Ga0137407_12050387 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
3300012944|Ga0137410_11217846 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 649 | Open in IMG/M |
3300012986|Ga0164304_10082456 | All Organisms → cellular organisms → Bacteria | 1864 | Open in IMG/M |
3300015051|Ga0137414_1065325 | Not Available | 685 | Open in IMG/M |
3300015052|Ga0137411_1293586 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1546 | Open in IMG/M |
3300015053|Ga0137405_1120322 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 759 | Open in IMG/M |
3300015053|Ga0137405_1286530 | All Organisms → cellular organisms → Bacteria | 2189 | Open in IMG/M |
3300015053|Ga0137405_1323226 | All Organisms → cellular organisms → Bacteria | 2284 | Open in IMG/M |
3300015054|Ga0137420_1091181 | Not Available | 872 | Open in IMG/M |
3300015089|Ga0167643_1043034 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 693 | Open in IMG/M |
3300015374|Ga0132255_100752321 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1450 | Open in IMG/M |
3300016404|Ga0182037_10420055 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1106 | Open in IMG/M |
3300018433|Ga0066667_11610193 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
3300018482|Ga0066669_10255842 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1388 | Open in IMG/M |
3300020579|Ga0210407_10086966 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2361 | Open in IMG/M |
3300020579|Ga0210407_11169336 | Not Available | 580 | Open in IMG/M |
3300020581|Ga0210399_11223726 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
3300020583|Ga0210401_10316179 | Not Available | 1422 | Open in IMG/M |
3300021086|Ga0179596_10124151 | Not Available | 1202 | Open in IMG/M |
3300021088|Ga0210404_10035548 | All Organisms → cellular organisms → Bacteria | 2262 | Open in IMG/M |
3300021171|Ga0210405_10759755 | Not Available | 745 | Open in IMG/M |
3300021403|Ga0210397_10482167 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 937 | Open in IMG/M |
3300021404|Ga0210389_10069354 | All Organisms → cellular organisms → Bacteria | 2702 | Open in IMG/M |
3300024182|Ga0247669_1094051 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
3300024330|Ga0137417_1398905 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5178 | Open in IMG/M |
3300024330|Ga0137417_1468436 | All Organisms → cellular organisms → Bacteria | 4740 | Open in IMG/M |
3300026296|Ga0209235_1233325 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
3300026301|Ga0209238_1225834 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300026317|Ga0209154_1155992 | All Organisms → cellular organisms → Bacteria | 943 | Open in IMG/M |
3300026330|Ga0209473_1186870 | Not Available | 798 | Open in IMG/M |
3300026332|Ga0209803_1173546 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 816 | Open in IMG/M |
3300026335|Ga0209804_1012988 | All Organisms → cellular organisms → Bacteria | 4472 | Open in IMG/M |
3300026341|Ga0257151_1033671 | Not Available | 550 | Open in IMG/M |
3300026551|Ga0209648_10553762 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 642 | Open in IMG/M |
3300026557|Ga0179587_10290460 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
3300026557|Ga0179587_10428017 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
3300027334|Ga0209529_1077397 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
3300027603|Ga0209331_1140299 | Not Available | 577 | Open in IMG/M |
3300027643|Ga0209076_1177554 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
3300027663|Ga0208990_1140452 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 644 | Open in IMG/M |
3300027684|Ga0209626_1207027 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
3300027795|Ga0209139_10094883 | Not Available | 1050 | Open in IMG/M |
3300027842|Ga0209580_10237153 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
3300027846|Ga0209180_10094179 | All Organisms → cellular organisms → Bacteria | 1702 | Open in IMG/M |
3300027853|Ga0209274_10716179 | Not Available | 516 | Open in IMG/M |
3300027869|Ga0209579_10759606 | Not Available | 524 | Open in IMG/M |
3300027882|Ga0209590_10636355 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 685 | Open in IMG/M |
3300029636|Ga0222749_10060012 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1703 | Open in IMG/M |
3300029636|Ga0222749_10217218 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
3300030056|Ga0302181_10486601 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
3300030494|Ga0310037_10441683 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
3300030617|Ga0311356_10459265 | All Organisms → cellular organisms → Bacteria | 1250 | Open in IMG/M |
3300031231|Ga0170824_120415565 | Not Available | 535 | Open in IMG/M |
3300031708|Ga0310686_105239099 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 882 | Open in IMG/M |
3300031753|Ga0307477_10609527 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 735 | Open in IMG/M |
3300031753|Ga0307477_10943088 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
3300031820|Ga0307473_10770052 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
3300031823|Ga0307478_10771991 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 805 | Open in IMG/M |
3300031823|Ga0307478_11677629 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300032076|Ga0306924_11954300 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
3300032090|Ga0318518_10605473 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
3300032174|Ga0307470_11598160 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
3300032180|Ga0307471_100204028 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1982 | Open in IMG/M |
3300032180|Ga0307471_100579703 | All Organisms → cellular organisms → Bacteria | 1279 | Open in IMG/M |
3300032180|Ga0307471_101167171 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
3300032180|Ga0307471_101282609 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 895 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 35.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.69% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 8.40% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.63% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.63% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 6.11% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.05% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.05% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.29% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.29% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.53% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.53% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.53% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.53% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.53% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.76% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.76% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.76% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.76% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.76% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.76% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.76% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001181 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 | Environmental | Open in IMG/M |
3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300002907 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm | Environmental | Open in IMG/M |
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004120 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF238 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015089 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8A, Adjacent to main proglacial river, end of transect (Watson river)) | Environmental | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300024182 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK10 | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
3300026341 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-A | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027334 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12663J13571_1041852 | 3300001181 | Forest Soil | VLDNGVELKDAHFILYLSNTEARLPVLLEAVMPFAVARVELVKAE* |
JGI12053J15887_106115252 | 3300001661 | Forest Soil | GVEMKDASFTLYFANNAARTPVLLEAVMPFATARVELLKAK* |
JGI25382J37095_101171421 | 3300002562 | Grasslands Soil | EMKDASFTLYLANNEARTPVLLEAVLPFAAARVELVKTK* |
JGI25613J43889_100455101 | 3300002907 | Grasslands Soil | GVEMKDASFTLYFANNAARTPVLLEAVMPFAAARVELLKAK* |
Ga0062387_1011020472 | 3300004091 | Bog Forest Soil | EEMKDAHFFVYFADNEARTPVLLEAEMPFASARVALRESK* |
Ga0058901_15005141 | 3300004120 | Forest Soil | QEMKDAHFTMYFANNVARTPILLEAIMPFATARVELQRAK* |
Ga0066388_1022242503 | 3300005332 | Tropical Forest Soil | DGGAEMKDAHFVLYLAHDERRTPVLLEAVMPWTTARVELKSSK* |
Ga0070709_114316821 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | FDNGAELKDAHFALYLASNPARTPVLLEAVMPFANARVALVKMK* |
Ga0070733_111025221 | 3300005541 | Surface Soil | QFTIYIANNVARTPVLLEAILPFATARVELQRAK* |
Ga0066704_110455232 | 3300005557 | Soil | DNGVEMNDAHFTLYVAKDEARTPVLLEAVLPFAAARVELRKRQ* |
Ga0066703_105090122 | 3300005568 | Soil | DNGVEMNDAHFTLYVAKDEARTPVLLEAVLPFAAARVELTKKQ* |
Ga0066703_107323882 | 3300005568 | Soil | KDASFTLYLANNAARTPVLLEAVMPFATARVELLKAK* |
Ga0066694_100307525 | 3300005574 | Soil | TKDASFTLYLANNAARTPVLLEAVMPFATARVELLKAK* |
Ga0070766_102938242 | 3300005921 | Soil | DAHFFVYFAGNEARTPVLLEAEMPFASARVALKESK* |
Ga0070717_106474181 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MKDAHFFVYFARNDLRTPVLLEAEMPFASARVALKSAH* |
Ga0070715_103454791 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | AEMKDAHFTLYLAHDAARTPVLLLAVLPFAEARVELQPKGGE* |
Ga0070712_1015300991 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MKDAHFTLCLAHDAARTPVLLLAVLPFAEARVELQPKGGE* |
Ga0070765_1019156131 | 3300006176 | Soil | QEMKDAHFTMYLANNASRTPVLLEAVMPFATAQVLLVRAK* |
Ga0066665_100325211 | 3300006796 | Soil | KDASFSLYVANSAERTPVLLEAVMPFATARVELLKAK* |
Ga0066659_110377182 | 3300006797 | Soil | EMNDAHFTLYVAKDEARTPVLLEAVLPFAAARVELRKRQ* |
Ga0075436_1009897951 | 3300006914 | Populus Rhizosphere | QEMKDAHFTLYLAEDAARTPVLLEATLPFAEARVQLVKKSGQ* |
Ga0099829_103674951 | 3300009038 | Vadose Zone Soil | KELKDAHFTLHLADNNFRTPVLLEAVMPFATARAELVKAK* |
Ga0099830_111342742 | 3300009088 | Vadose Zone Soil | DNGVEMKDASFTLYLANDQAHTPVLLEAILPFATARVELVKAK* |
Ga0099830_116247301 | 3300009088 | Vadose Zone Soil | EMKDASFTLYVANNAARTPVLLEAVMPFATARVELSNVK* |
Ga0099830_117182542 | 3300009088 | Vadose Zone Soil | RVFDAGKELKDAHFTLHLADNNFRTPVLLEAVMPFATARAELVKAK* |
Ga0099828_104096232 | 3300009089 | Vadose Zone Soil | VEMKDASFTLYVANNSARTPVLLEAVMPFATARVELLKAK* |
Ga0099828_110150121 | 3300009089 | Vadose Zone Soil | DAGAELQDAHFALYLASNAARTPILLAAVMPFATARVALVKIK* |
Ga0066709_1004172981 | 3300009137 | Grasslands Soil | DAHFTLYLAKDEARTPVLLEAVLPFAAARVELTNKK* |
Ga0075423_109062273 | 3300009162 | Populus Rhizosphere | EEMKDAHFTLYLAKDAARTPVLLEAVLPFAAARVELTKKQ* |
Ga0134084_100069402 | 3300010322 | Grasslands Soil | MKDSSFVLYIANNAARTPVLLEAVMPFATARVELLKAK* |
Ga0126376_102154292 | 3300010359 | Tropical Forest Soil | KDARFTLYLANNPARTPVLLQAVLPFAEARVELQPASE* |
Ga0126372_107218171 | 3300010360 | Tropical Forest Soil | ESGIELKDAHFVLYLAEGPARTPVLLEAVLPFATARVALARMR* |
Ga0126383_106169061 | 3300010398 | Tropical Forest Soil | DAKFTLYLGHDAAHTPVLLEAVLPFATARVELIKSR* |
Ga0126383_119816091 | 3300010398 | Tropical Forest Soil | LKDAHFVLYLAEGPARTPVLLEAVLPFATARVALARMR* |
Ga0134121_111745523 | 3300010401 | Terrestrial Soil | AEMKDAHFSLYLADDAGRTPVLLEATMPFAVARVELVKKK* |
Ga0150983_130868311 | 3300011120 | Forest Soil | EMKDARFTLYLANNPTRTPVLLEAVMPFATARVALVKMK* |
Ga0150983_131953291 | 3300011120 | Forest Soil | NGQEMKDAHFTMYFANNVARTPVLLEAIMPFATAKVELQRAK* |
Ga0150983_133095541 | 3300011120 | Forest Soil | MKDASFTLYLANNAARTPVLLEAILPFATARVELSKVK* |
Ga0150983_145194421 | 3300011120 | Forest Soil | EMKDAHFTMYFANNVSRTPVLLEAILPFATAQVQLLSAK* |
Ga0137391_110561231 | 3300011270 | Vadose Zone Soil | NGVEMKDASFTLYLANDQARTPVLLEAILPFATARVELVKAK* |
Ga0137391_112679012 | 3300011270 | Vadose Zone Soil | MKDASFALYVANNAARTPVLLEAVMPFATARVELEKVK* |
Ga0137391_113609562 | 3300011270 | Vadose Zone Soil | DAGKELKDAHFTLHLADNNFRTPVLLEAVMPFATARAELVKAK* |
Ga0137393_100198731 | 3300011271 | Vadose Zone Soil | DASFTLYLANNEARTPVLLEAILPFAAARVELVKTK* |
Ga0137388_102754733 | 3300012189 | Vadose Zone Soil | DASFTLYLANTAARIPVLLEAVLPFATARVELQKTH* |
Ga0137363_103842573 | 3300012202 | Vadose Zone Soil | EMKDASFTLYVANNSARTPVLLEAVMPFATARVELLKAK* |
Ga0137363_105017691 | 3300012202 | Vadose Zone Soil | DGVEKKDASFTLYLANNTTHIPVLLEAVLPFATARVELLKSK* |
Ga0137363_117141572 | 3300012202 | Vadose Zone Soil | VEMKDASFTLYLANDQAHTPVLLEAILPFATARVELVKAK* |
Ga0137399_101639641 | 3300012203 | Vadose Zone Soil | HFTLYLASNPARTPVLLEAVMPFATARVALVKMK* |
Ga0137399_117960832 | 3300012203 | Vadose Zone Soil | EAGVELKDAHFTLYLADNPSRTPVLLEAVMPFATARVALVKMK* |
Ga0137361_103366153 | 3300012362 | Vadose Zone Soil | ELKDAHFALYLASNTSRTPVLLEAVMPFATARVALVKIK* |
Ga0137358_100442151 | 3300012582 | Vadose Zone Soil | EMKDASFSLYVANNAARTPALLEAVMPFATARVELLKSK* |
Ga0137358_101453791 | 3300012582 | Vadose Zone Soil | ARFTLYLAHDAARTPVLLQAVLPFAEARVELQGKGE* |
Ga0137358_110297252 | 3300012582 | Vadose Zone Soil | FDSGVEMKDARFTLYLASNPTRTPVLLEAVMPFATARVALVKMK* |
Ga0137397_102282882 | 3300012685 | Vadose Zone Soil | EMKDAHFTLYLAHDAARTPVLLQAVLPFAEARVELQPKGGE* |
Ga0137396_100180361 | 3300012918 | Vadose Zone Soil | AGVEMKDAPFTLYLASNPTRTPVVLEAVMPFATARVALVKMK* |
Ga0137396_100261533 | 3300012918 | Vadose Zone Soil | DGVEMTDASFSLYVANNAGRTPVLLEAVMPFATARVELLKAK* |
Ga0137396_103043761 | 3300012918 | Vadose Zone Soil | VFDDGVEMKDASFSLYVANNAARTPALLEAVMPFATARVELLKAK* |
Ga0137359_107297923 | 3300012923 | Vadose Zone Soil | AHFTLYLASNPARTPVLLEAVMPFATARVALVKMK* |
Ga0137413_101781612 | 3300012924 | Vadose Zone Soil | KDAHFTVYLAKDAARTPVLLEAVLPFAAARVELTKKQ* |
Ga0137413_110165821 | 3300012924 | Vadose Zone Soil | DAHFFVYFAGNEARTPVLLEAEMPFANARVALSRSK* |
Ga0137419_100490303 | 3300012925 | Vadose Zone Soil | LHVFDAGVEMKDARFTLYLASNPTRTPVVLEAVMPFATARVALVKMK* |
Ga0137404_101418552 | 3300012929 | Vadose Zone Soil | MNDAHFTLYVAKDEARTPVLLEAVLPFAAARVELRKKQ* |
Ga0137404_106689992 | 3300012929 | Vadose Zone Soil | MKDASFTLYLANNEARTPVLLEAILPFAAASVELVKVK* |
Ga0137404_106955652 | 3300012929 | Vadose Zone Soil | DAHFTLYVAKDEARTPVLLEAVLPFAAARVELRKRQ* |
Ga0137407_120503872 | 3300012930 | Vadose Zone Soil | VEMKDASFTLYLANNEARTPVLLEAILPFAAARVELVKAK* |
Ga0137410_112178461 | 3300012944 | Vadose Zone Soil | FDDGVEMKDASFTLYFANNAARTPVLLEAVMPFATARVELLKAK* |
Ga0164304_100824563 | 3300012986 | Soil | ENGEEMKDAHFTIYLANNAARTPVLLEAIMPFATARVELQTAK* |
Ga0137414_10653251 | 3300015051 | Vadose Zone Soil | GVEMKDARFTLYLASNPTRTPVLLEAVMPFATARVALVKMK* |
Ga0137411_12935862 | 3300015052 | Vadose Zone Soil | MKDAHFTLYLAHDAARTPVLLQAVLPFAEARVELQPKGGE* |
Ga0137405_11203221 | 3300015053 | Vadose Zone Soil | AHFTLYVAKDEARTPVLLEALLPFAAARVELRKKR* |
Ga0137405_12865304 | 3300015053 | Vadose Zone Soil | MKDAHFTLYLAHDAARTPVLLLAVLPFAEARVELQPKGGE* |
Ga0137405_13232264 | 3300015053 | Vadose Zone Soil | MKDARFTLYLASNPTRTPVLLEAVMPFATARVALVKMK* |
Ga0137420_10911811 | 3300015054 | Vadose Zone Soil | NEGCPLHTVSRFTLYLASNPTRTPVLLEAVMPFATARVALVKMK* |
Ga0167643_10430341 | 3300015089 | Glacier Forefield Soil | FALYLADTAARTPVLIEAVLPFATARVELVKASGR* |
Ga0132255_1007523213 | 3300015374 | Arabidopsis Rhizosphere | TLYLAKDAARTPVLLEAVLPFAEARVQLMKKNGQ* |
Ga0182037_104200551 | 3300016404 | Soil | MKDAHFTLYLAKDDARTPVLLEAVLPFAAARVELTKRQ |
Ga0066667_116101932 | 3300018433 | Grasslands Soil | EMKDASYSLYVANNAARNPVLHEAVMPFATARVELQKAN |
Ga0066669_102558423 | 3300018482 | Grasslands Soil | ETKDASFTLYLANNAARTPVLLEAVMPFATARVELLKAK |
Ga0210407_100869662 | 3300020579 | Soil | MNDAKFALYLTKDPAHTPVLLEAVLPFAEARVELTKSH |
Ga0210407_111693362 | 3300020579 | Soil | DAHFFVYFAGDEARTPVLLEAEMPFASARVALTKNK |
Ga0210399_112237262 | 3300020581 | Soil | KDASFTLYLANNTARTPVLLEAVMPFATARVELLSSK |
Ga0210401_103161792 | 3300020583 | Soil | KDAHFFVYFAGNEARTPVLLEAEMPFASARVALKESK |
Ga0179596_101241511 | 3300021086 | Vadose Zone Soil | DARFTLYLASNPTRTPVLLEAVMPFATARVALVKMK |
Ga0210404_100355481 | 3300021088 | Soil | VEMKDASFTLYLANNAARTPVLLEAVMPFATARVELSKAK |
Ga0210405_107597552 | 3300021171 | Soil | MKDAHFTLYLANTEARTPVLLEAVLPFATARVELVKAK |
Ga0210397_104821671 | 3300021403 | Soil | DANFTLYLANNAAHTPVLLEAVMPFATARVELSKAQ |
Ga0210389_100693541 | 3300021404 | Soil | EMKDTHFTMYFANNVARTPVLLEAIMPFATAQVQLLRAK |
Ga0210409_110889012 | 3300021559 | Soil | AHFAVYFAHDQTHTPVLLEAVLPWTTARVGLKSSK |
Ga0247669_10940512 | 3300024182 | Soil | ENGEEMKDAHFTIYLAINAARTPVLLEAIMPFATARVELQKAK |
Ga0137417_139890511 | 3300024330 | Vadose Zone Soil | MKDASFSLYVANNAARTPALLEAVMPFATARVELLKSK |
Ga0137417_146843611 | 3300024330 | Vadose Zone Soil | VFDNGVEMKDASFALYLANNAARTPVLLEAVMPFATARVEL |
Ga0209235_12333252 | 3300026296 | Grasslands Soil | ETKDASFTLYLANNEARTPVLLEAVLPFAAARVELVKTK |
Ga0209238_12258341 | 3300026301 | Grasslands Soil | DGVEMKDASFTLYVANNAARTPVLLEAVMPFATARVELQKAN |
Ga0209154_11559921 | 3300026317 | Soil | TKDASFTLYLANNAARTPVLLEAVMPFATARVELLKAK |
Ga0209473_11868701 | 3300026330 | Soil | TLYLADDAARTPVLLEAIMPFATARVALLKDQKLD |
Ga0209803_11735462 | 3300026332 | Soil | MKDASFVLYLANNAARTPVLLEAVMPFATARVELEKVK |
Ga0209804_10129883 | 3300026335 | Soil | MKDASFVLYIANNAARTPVLLEAVMPFATARVELLKAK |
Ga0257151_10336711 | 3300026341 | Soil | EMKDARFTLYLASNPTRTPVVLEAVMPFATARVALVKMK |
Ga0209648_105537622 | 3300026551 | Grasslands Soil | MKDASFSLYVANDSTRTPVLLEAVMPFAAARVELQKAK |
Ga0179587_102904603 | 3300026557 | Vadose Zone Soil | FDEGVEMKDASFSLYVVNNAERTPVLLEAVMPFATARVELLKAK |
Ga0179587_104280171 | 3300026557 | Vadose Zone Soil | MKDASFTLYLANDQARTPVLLEAILPFATARVELVKAK |
Ga0209529_10773971 | 3300027334 | Forest Soil | MKDAHFFVYFAKNNARTPVLLEAEMPFASARVALKSVK |
Ga0209331_11402991 | 3300027603 | Forest Soil | GAEMKDAHFFVYFAGDEARTPVLLEAEMPFASARVALTKSK |
Ga0209076_11775542 | 3300027643 | Vadose Zone Soil | ELKDAHFALYLASNAWRTPVLLEAVMPFATARVALVKIK |
Ga0208990_11404521 | 3300027663 | Forest Soil | KKDASFALYLANNAARTPVLLEAVMPFATARVELLNSK |
Ga0209626_12070271 | 3300027684 | Forest Soil | AHFTLHLANNNSRTPVLLEAVMPFATARVELVKAK |
Ga0209139_100948832 | 3300027795 | Bog Forest Soil | GSEMKDTHFTLYLANTEARTPVLLEAVMPFATARVELVKAK |
Ga0209580_102371533 | 3300027842 | Surface Soil | TELKDAHFTLHLANNAFPTPVLLEAVMPFATARVELVKEK |
Ga0209180_100941791 | 3300027846 | Vadose Zone Soil | GAELKDAHFALYLASNAWRTPVLLEAVMPFATARVALVKIK |
Ga0209274_107161791 | 3300027853 | Soil | FDSGQEMKDAHFFVYFAKNDARTPVLLEAEMPFASARVALKSVK |
Ga0209579_107596061 | 3300027869 | Surface Soil | MNDAHFFVYFAKNEGRTPVLLEAEMPFAAARVALKSVK |
Ga0209590_106363552 | 3300027882 | Vadose Zone Soil | GVEMKDASFTLYLANDQAHTPVLLEAILPFATARVELVKAK |
Ga0222749_100600123 | 3300029636 | Soil | AHFTMYFANNVARTPVLLEAIMPFATAKVELQRAK |
Ga0222749_102172182 | 3300029636 | Soil | DAKFALYLTKDSTHTPVLLEAVLPFADARVELSKSH |
Ga0302181_104866011 | 3300030056 | Palsa | NGVEMKDAQFALYLANNAARTPVLIEAVIPVATARVELVKAGGR |
Ga0310037_104416831 | 3300030494 | Peatlands Soil | EMKDASFTLYLANNAARTPVLLEAVMPFATARVELSSAK |
Ga0311356_104592653 | 3300030617 | Palsa | VELKDAQFSLYLANNAARTPVLIEAVIPVATARVELVKSESAR |
Ga0170824_1204155652 | 3300031231 | Forest Soil | VEMKDARFTLYLANDAAHTPVLLQAVLPFAEARVELQEKSE |
Ga0310686_1052390991 | 3300031708 | Soil | ADGAEMKDAHFGLYLTQDAAHTPVLLEAVLPFATARVGLKSRK |
Ga0307477_106095272 | 3300031753 | Hardwood Forest Soil | DAAFTLYLANLPARTPVLLEATLPFASARVELVKAK |
Ga0307477_109430882 | 3300031753 | Hardwood Forest Soil | EMKDAHFMLYLANNPARTPVLLEAVMPFATARVALVKMK |
Ga0307473_107700522 | 3300031820 | Hardwood Forest Soil | AHFTLYVAKDEARTPVLLEAVLPFAAARVELRKKQ |
Ga0307478_107719911 | 3300031823 | Hardwood Forest Soil | GVEMKDASFTLYLAKSDARTPVLLEAVMPFATARVELVKAK |
Ga0307478_116776292 | 3300031823 | Hardwood Forest Soil | NGAEMKDAHFTLYLAKDQARTPVLLEAILPFAAARVELTKRQ |
Ga0306924_119543002 | 3300032076 | Soil | DAHFTLYLANDQARTPVLLLAVLPFADARVELQEKSE |
Ga0318518_106054732 | 3300032090 | Soil | FTLYLAKDVARTPVLLEATLPFAEARVQLVKRSGV |
Ga0307470_115981602 | 3300032174 | Hardwood Forest Soil | GVEMKDASFTLYLSNNEARTPLLLEAILPFATARVELVKAK |
Ga0307471_1002040281 | 3300032180 | Hardwood Forest Soil | NGEEMKDAHFTVYLAKDAARTPVLLEAVLPFAAARVELTKRQ |
Ga0307471_1005797031 | 3300032180 | Hardwood Forest Soil | KDAHFALYLAVDAARTPVLLEAVMPFATARVALVKMKYN |
Ga0307471_1011671713 | 3300032180 | Hardwood Forest Soil | AHFTLYLASNPMRTPVLLEAVMPFATARVALVKMK |
Ga0307471_1012826091 | 3300032180 | Hardwood Forest Soil | KDAHFTVYLAKDAARTPVLLEAVLPFAAARVELTRKQ |
⦗Top⦘ |