Basic Information | |
---|---|
Family ID | F062802 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 130 |
Average Sequence Length | 43 residues |
Representative Sequence | RFRPESPHLAATIDLEALSDERAAAGFLGVLRDLAAGASTHRQ |
Number of Associated Samples | 115 |
Number of Associated Scaffolds | 130 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.88 % |
% of genes near scaffold ends (potentially truncated) | 86.15 % |
% of genes from short scaffolds (< 2000 bps) | 77.69 % |
Associated GOLD sequencing projects | 110 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.52 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (55.385 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (9.231 % of family members) |
Environment Ontology (ENVO) | Unclassified (23.846 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (61.538 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 35.21% β-sheet: 0.00% Coil/Unstructured: 64.79% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 130 Family Scaffolds |
---|---|---|
PF00486 | Trans_reg_C | 35.38 |
PF00999 | Na_H_Exchanger | 9.23 |
PF00069 | Pkinase | 7.69 |
PF01797 | Y1_Tnp | 6.15 |
PF02518 | HATPase_c | 2.31 |
PF00271 | Helicase_C | 1.54 |
PF07690 | MFS_1 | 1.54 |
PF00106 | adh_short | 0.77 |
PF10861 | DUF2784 | 0.77 |
PF13088 | BNR_2 | 0.77 |
PF16162 | DUF4868 | 0.77 |
PF00923 | TAL_FSA | 0.77 |
PF00293 | NUDIX | 0.77 |
PF07228 | SpoIIE | 0.77 |
PF02472 | ExbD | 0.77 |
PF00903 | Glyoxalase | 0.77 |
PF02163 | Peptidase_M50 | 0.77 |
PF14067 | LssY_C | 0.77 |
PF14559 | TPR_19 | 0.77 |
PF03235 | DUF262 | 0.77 |
PF13502 | AsmA_2 | 0.77 |
PF00487 | FA_desaturase | 0.77 |
PF00085 | Thioredoxin | 0.77 |
COG ID | Name | Functional Category | % Frequency in 130 Family Scaffolds |
---|---|---|---|
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 30.77 |
COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 9.23 |
COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 9.23 |
COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 9.23 |
COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 9.23 |
COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 9.23 |
COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 6.15 |
COG0176 | Transaldolase/fructose-6-phosphate aldolase | Carbohydrate transport and metabolism [G] | 0.77 |
COG0848 | Biopolymer transport protein ExbD | Intracellular trafficking, secretion, and vesicular transport [U] | 0.77 |
COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 0.77 |
COG1479 | DNAse/DNA nickase specific for phosphorothioated or glycosylated phage DNA, GmrSD/DndB/SspE family, contains DUF262 and HNH nuclease domains | Defense mechanisms [V] | 0.77 |
COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 0.77 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 55.38 % |
Unclassified | root | N/A | 44.62 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2199352024|deeps__Contig_82729 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2011 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_101680100 | Not Available | 732 | Open in IMG/M |
3300001356|JGI12269J14319_10200925 | Not Available | 784 | Open in IMG/M |
3300001686|C688J18823_10422403 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 861 | Open in IMG/M |
3300003324|soilH2_10286929 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2029 | Open in IMG/M |
3300004092|Ga0062389_102420020 | Not Available | 695 | Open in IMG/M |
3300004139|Ga0058897_10941402 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 726 | Open in IMG/M |
3300005176|Ga0066679_10864123 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 572 | Open in IMG/M |
3300005177|Ga0066690_10942783 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300005332|Ga0066388_100790398 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1543 | Open in IMG/M |
3300005332|Ga0066388_100794476 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1540 | Open in IMG/M |
3300005435|Ga0070714_102329877 | Not Available | 521 | Open in IMG/M |
3300005538|Ga0070731_10280169 | Not Available | 1107 | Open in IMG/M |
3300005541|Ga0070733_10817642 | Not Available | 626 | Open in IMG/M |
3300005545|Ga0070695_100446485 | Not Available | 990 | Open in IMG/M |
3300005554|Ga0066661_10698951 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 595 | Open in IMG/M |
3300005602|Ga0070762_10086951 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1787 | Open in IMG/M |
3300005610|Ga0070763_10160256 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1181 | Open in IMG/M |
3300005610|Ga0070763_10586047 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 645 | Open in IMG/M |
3300005614|Ga0068856_102471060 | Not Available | 526 | Open in IMG/M |
3300005841|Ga0068863_100092322 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2872 | Open in IMG/M |
3300005876|Ga0075300_1049584 | Not Available | 603 | Open in IMG/M |
3300005952|Ga0080026_10250812 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
3300006028|Ga0070717_10678225 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
3300006046|Ga0066652_100238027 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1587 | Open in IMG/M |
3300006358|Ga0068871_101758625 | Not Available | 588 | Open in IMG/M |
3300006794|Ga0066658_10154947 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1166 | Open in IMG/M |
3300006854|Ga0075425_103011786 | Not Available | 515 | Open in IMG/M |
3300006871|Ga0075434_102158920 | Not Available | 561 | Open in IMG/M |
3300006903|Ga0075426_10599076 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
3300006914|Ga0075436_100106179 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1959 | Open in IMG/M |
3300009089|Ga0099828_10492520 | Not Available | 1105 | Open in IMG/M |
3300009700|Ga0116217_10790512 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_2_20CM_55_8 | 584 | Open in IMG/M |
3300009792|Ga0126374_11544133 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
3300009824|Ga0116219_10329012 | Not Available | 858 | Open in IMG/M |
3300009839|Ga0116223_10396865 | Not Available | 812 | Open in IMG/M |
3300010046|Ga0126384_10421507 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_2_20CM_55_8 | 1132 | Open in IMG/M |
3300010049|Ga0123356_10138972 | All Organisms → cellular organisms → Bacteria | 2394 | Open in IMG/M |
3300010358|Ga0126370_12095613 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 555 | Open in IMG/M |
3300010360|Ga0126372_10526691 | Not Available | 1116 | Open in IMG/M |
3300010361|Ga0126378_11191768 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
3300010371|Ga0134125_10325741 | Not Available | 1705 | Open in IMG/M |
3300010373|Ga0134128_11402163 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
3300010373|Ga0134128_12165582 | Not Available | 612 | Open in IMG/M |
3300010376|Ga0126381_101348620 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1031 | Open in IMG/M |
3300010376|Ga0126381_103629355 | Not Available | 605 | Open in IMG/M |
3300010379|Ga0136449_100548059 | Not Available | 1990 | Open in IMG/M |
3300010379|Ga0136449_103044333 | Not Available | 653 | Open in IMG/M |
3300010379|Ga0136449_104526743 | Not Available | 511 | Open in IMG/M |
3300011269|Ga0137392_10099473 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2291 | Open in IMG/M |
3300012207|Ga0137381_10682958 | Not Available | 893 | Open in IMG/M |
3300012210|Ga0137378_10194657 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1887 | Open in IMG/M |
3300012210|Ga0137378_11799306 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 516 | Open in IMG/M |
3300012356|Ga0137371_10310024 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1228 | Open in IMG/M |
3300012357|Ga0137384_11346539 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300012363|Ga0137390_10691841 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
3300012923|Ga0137359_10618951 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 948 | Open in IMG/M |
3300012925|Ga0137419_11214587 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
3300013297|Ga0157378_13246395 | Not Available | 505 | Open in IMG/M |
3300013832|Ga0120132_1029586 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
3300014150|Ga0134081_10027734 | All Organisms → cellular organisms → Bacteria | 1625 | Open in IMG/M |
3300014491|Ga0182014_10289517 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 845 | Open in IMG/M |
3300014495|Ga0182015_10958009 | Not Available | 533 | Open in IMG/M |
3300015241|Ga0137418_11039604 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_2_20CM_55_8 | 588 | Open in IMG/M |
3300015374|Ga0132255_101969948 | Not Available | 889 | Open in IMG/M |
3300016404|Ga0182037_12173550 | Not Available | 500 | Open in IMG/M |
3300017946|Ga0187879_10413347 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 747 | Open in IMG/M |
3300017959|Ga0187779_10005219 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7671 | Open in IMG/M |
3300017972|Ga0187781_10476851 | Not Available | 894 | Open in IMG/M |
3300018032|Ga0187788_10492758 | Not Available | 529 | Open in IMG/M |
3300018038|Ga0187855_10170095 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1294 | Open in IMG/M |
3300018044|Ga0187890_10078241 | All Organisms → cellular organisms → Bacteria | 1937 | Open in IMG/M |
3300018044|Ga0187890_10384354 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
3300018047|Ga0187859_10409647 | Not Available | 745 | Open in IMG/M |
3300018086|Ga0187769_10933753 | Not Available | 656 | Open in IMG/M |
3300018088|Ga0187771_10059185 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3003 | Open in IMG/M |
3300018088|Ga0187771_11810055 | Not Available | 518 | Open in IMG/M |
3300018433|Ga0066667_10019295 | All Organisms → cellular organisms → Bacteria | 3577 | Open in IMG/M |
3300019879|Ga0193723_1162201 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
3300020021|Ga0193726_1183539 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 891 | Open in IMG/M |
3300020581|Ga0210399_10648524 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 871 | Open in IMG/M |
3300021181|Ga0210388_10400135 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1207 | Open in IMG/M |
3300021344|Ga0193719_10118013 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1153 | Open in IMG/M |
3300021404|Ga0210389_10268963 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1334 | Open in IMG/M |
3300021404|Ga0210389_11077377 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 621 | Open in IMG/M |
3300021406|Ga0210386_10083414 | All Organisms → cellular organisms → Bacteria | 2594 | Open in IMG/M |
3300021407|Ga0210383_11781113 | Not Available | 502 | Open in IMG/M |
3300021474|Ga0210390_11465512 | Not Available | 541 | Open in IMG/M |
3300025910|Ga0207684_10420848 | All Organisms → cellular organisms → Bacteria | 1148 | Open in IMG/M |
3300025927|Ga0207687_11020603 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 709 | Open in IMG/M |
3300026281|Ga0209863_10180444 | Not Available | 614 | Open in IMG/M |
3300026300|Ga0209027_1078239 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1220 | Open in IMG/M |
3300026322|Ga0209687_1010867 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3028 | Open in IMG/M |
3300026325|Ga0209152_10058584 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1368 | Open in IMG/M |
3300026329|Ga0209375_1226383 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 659 | Open in IMG/M |
3300026332|Ga0209803_1265128 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 590 | Open in IMG/M |
3300026334|Ga0209377_1278280 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 553 | Open in IMG/M |
3300026528|Ga0209378_1057586 | Not Available | 1848 | Open in IMG/M |
3300027696|Ga0208696_1134866 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 805 | Open in IMG/M |
3300027824|Ga0209040_10549726 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 502 | Open in IMG/M |
3300027854|Ga0209517_10097868 | Not Available | 1986 | Open in IMG/M |
3300027869|Ga0209579_10312708 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 847 | Open in IMG/M |
3300028381|Ga0268264_10600005 | Not Available | 1085 | Open in IMG/M |
3300028673|Ga0257175_1003349 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2028 | Open in IMG/M |
3300028807|Ga0307305_10279514 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_2_20CM_55_8 | 761 | Open in IMG/M |
3300028828|Ga0307312_10061473 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2265 | Open in IMG/M |
3300030659|Ga0316363_10207980 | Not Available | 812 | Open in IMG/M |
3300031128|Ga0170823_15195312 | Not Available | 659 | Open in IMG/M |
3300031715|Ga0307476_10324755 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1131 | Open in IMG/M |
3300031720|Ga0307469_10174079 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1646 | Open in IMG/M |
3300031954|Ga0306926_11693840 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
3300032783|Ga0335079_10881766 | Not Available | 921 | Open in IMG/M |
3300032828|Ga0335080_10073799 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3784 | Open in IMG/M |
3300033158|Ga0335077_11775150 | Not Available | 580 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.23% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.23% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 7.69% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.92% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.38% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.62% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.85% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.85% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.08% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.08% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.08% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.08% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.31% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.31% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.31% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.54% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.54% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.54% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.54% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.54% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.54% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.54% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.54% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.54% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.77% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.77% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.77% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.77% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.77% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.77% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.77% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.77% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.77% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.77% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.77% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.77% |
Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.77% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.77% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.77% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.77% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004139 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF230 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005876 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_401 | Environmental | Open in IMG/M |
3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Host-Associated | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013832 | Permafrost microbial communities from Nunavut, Canada - A3_5cm_0M | Environmental | Open in IMG/M |
3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300028866 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_2 | Environmental | Open in IMG/M |
3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
deeps_01390760 | 2199352024 | Soil | PDSPNLAATIPLDALSDEEATASFLSVLRDLAAGSSASRH |
INPhiseqgaiiFebDRAFT_1016801002 | 3300000364 | Soil | VRFRSKSPHLVATVALEALSDQQASAGFLDVVRDLAAGASTRQ* |
JGI12269J14319_102009252 | 3300001356 | Peatlands Soil | HLAATIDLESLSDERAAAGFLGVLRDLAAGASTHRQ* |
C688J18823_104224031 | 3300001686 | Soil | KSPHLVAVVGLDALSDEQGAATFLGVVRDLAAGASTSHQ* |
soilH2_102869294 | 3300003324 | Sugarcane Root And Bulk Soil | RFRSKSPHLTATVALESLSDPKAGAGFLDVVRELAAGASTPQS* |
Ga0062389_1024200201 | 3300004092 | Bog Forest Soil | RPESPHLAATIDLEALSDERAAAGFLGVLRDLAAGASTHRQ* |
Ga0058897_109414022 | 3300004139 | Forest Soil | RFRPESPHLAATIDLEALTDERAAAGFLGVLRDLAGASTPRH* |
Ga0062386_1016352242 | 3300004152 | Bog Forest Soil | RFRSESPHIAATVPLEALSDEQAAAGFLSVLRELAAGASASRQ* |
Ga0066679_108641232 | 3300005176 | Soil | PESPHLAATVPLDAVVDEQAAAGFLTVVRELAAGAAHQQ* |
Ga0066690_109427831 | 3300005177 | Soil | HNLVTVRFRPESPHLAATVPLDAVVDEQAAAGFLTVVRELAAGAAHQQ* |
Ga0066388_1007903983 | 3300005332 | Tropical Forest Soil | PDSPNLAATIALDALSDEETTAAFLGVLRDLAAGSSASRH* |
Ga0066388_1007944763 | 3300005332 | Tropical Forest Soil | FRPDSPNLAATIALDALSDEETTAAFLGVLRDLAAGSSASRH* |
Ga0070668_1000855091 | 3300005347 | Switchgrass Rhizosphere | VRFRSESPHIAATVPLEALSDEQAAAGFLSVLRELAAGASASRQ* |
Ga0070714_1023298771 | 3300005435 | Agricultural Soil | RPNSPHLSATIPLDALSGEETTASFLSVLRDLAAGSSASRQ* |
Ga0070711_1014246152 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | SESPHIAATVPLEALADEQAAAGFLSVLRELAAGASASRQ* |
Ga0070731_102801693 | 3300005538 | Surface Soil | SVRFRPESPHLAATIDLEALSDERAAAGFLGVLRDLAAGASTHRQ* |
Ga0070733_108176421 | 3300005541 | Surface Soil | FRPDSPHLAATIDLEALTDERAAASFLGVLRDLAAGASTHRQ* |
Ga0070695_1004464851 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | GYDLLSVRFRAESPHLVATVALEAISDEKAAAGFLGVMRELAAGASTHRHSN* |
Ga0066661_106989511 | 3300005554 | Soil | LAATVPLDAVVDEQAAAGFLTVVRELAAGAAHQQ* |
Ga0070762_100869513 | 3300005602 | Soil | FRPESPHLAATIDLEALSDEQAAAGFLGVLRDLAASASTPRQ* |
Ga0070762_102924233 | 3300005602 | Soil | AATVDLDALSGEEAAAGFLSVLRELAAGASRTRQ* |
Ga0070763_101602562 | 3300005610 | Soil | SPHLAATIDLEALSDERAAAGFLGVLRDLAAGASTHRQ* |
Ga0070763_105860472 | 3300005610 | Soil | RFRPESPHLAATIDLEALSDERAAAGFLGVLRDLAAGASTHRQ* |
Ga0068856_1024710602 | 3300005614 | Corn Rhizosphere | GHNLMSVRFRPNSPHLAATIPLEALSDEHAAAGFLSVLRELAAGASTHQQ* |
Ga0068863_1000923221 | 3300005841 | Switchgrass Rhizosphere | SLISVRFRSKSPHLVATVALETLSDQQASAGFLDIVRDLAAGASTRQ* |
Ga0075300_10495842 | 3300005876 | Rice Paddy Soil | PHLTATVALATLSDRQAGAGFLEVLRDLAAGASTSRQ* |
Ga0080026_102508122 | 3300005952 | Permafrost Soil | NLISVRFRSESPHIAATVPLESRSDEQAAAGFLSVLRELAAGASASRQ* |
Ga0070717_106782252 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VRFRPDSPNLAATIPLDALSDEEATAAFLNVLRDLASGASASRQ* |
Ga0066652_1002380271 | 3300006046 | Soil | NLSATIPLDALSDEETTASFLSVLRDLAAGSSASRQ* |
Ga0068871_1017586251 | 3300006358 | Miscanthus Rhizosphere | PNLTATIPLDALSGEETTASFLSVLRDLAAGSSASRH* |
Ga0068871_1021275221 | 3300006358 | Miscanthus Rhizosphere | SPHIAATVPLEALSDEQAAAGFLSVLRELAAGASASRQ* |
Ga0066658_101549474 | 3300006794 | Soil | RPESPHLAATVPLDAVVDEQAAAGFLTVVRELAAGAAHQQ* |
Ga0075425_1030117862 | 3300006854 | Populus Rhizosphere | SSPHLAATIPLEALSDEHAAAGFLSVLRELAAGASTHQQ* |
Ga0075434_1021589201 | 3300006871 | Populus Rhizosphere | PHLAATIPLEAVSDEHAAAGFLSVLRELAAGASTHQQ* |
Ga0075426_105990761 | 3300006903 | Populus Rhizosphere | VRFRPESPHLAATVPLDALVNEQAAAGFLTVVRELAAGAAHQQ* |
Ga0075436_1001061793 | 3300006914 | Populus Rhizosphere | SESPHLAATIPLEALSDDQAAIGFLSVVRELAAGASTHQQ* |
Ga0099828_104925203 | 3300009089 | Vadose Zone Soil | TVRFRPDSPNLSATIPLDALSDEETTAAFLSVLRDLAAGASASRH* |
Ga0116217_107905121 | 3300009700 | Peatlands Soil | GHNLLSVRFRPESPHLAATIDLESLSDERAAAGFLGVLRDLAARASTHRQ* |
Ga0126374_115441332 | 3300009792 | Tropical Forest Soil | LISVRFRPESPHLAASVPLDALSDEQAAISFLTVVRELAAGAAHQQ* |
Ga0116219_103290122 | 3300009824 | Peatlands Soil | LTVRFRPHSPHLAATIDLEALSDERAAAGFLGVLRDLAAGASTHRQ* |
Ga0116223_103968652 | 3300009839 | Peatlands Soil | NLLSVRFRPESPHLAATIDLESLSDERAAAGFLGVLRDLAAGASTHRQ* |
Ga0126384_104215071 | 3300010046 | Tropical Forest Soil | MSVRFRPSSPHLAATIPLEALSDEHAAAGFLSVLRELAAGASTHQQ* |
Ga0123356_101389723 | 3300010049 | Termite Gut | MTVRFRPDSPNLAATIPLEALADEEATAAFLNVLRDLASGASASRH* |
Ga0126370_120956131 | 3300010358 | Tropical Forest Soil | GHNLISVRFRPESPHLAATVPLDAVVDEQAAAGFLTVVRELAAGAAHQQ* |
Ga0126372_105266913 | 3300010360 | Tropical Forest Soil | LSVRFRPDSPNLAATIALDALSDEETTAAFLGVLRDLAAGSSASRH* |
Ga0126378_111917681 | 3300010361 | Tropical Forest Soil | RFRPDSPNLSATIPLDALSGEETTASFLSVLRDLAAGSSASRQ* |
Ga0134125_103257411 | 3300010371 | Terrestrial Soil | TVRFRQESPNLTATIPLDALSGEETTASFLSVLRDLAAGSSASRH* |
Ga0134128_114021631 | 3300010373 | Terrestrial Soil | VRFRPDSPNLAATIPLEALADEEATAAFLNVLRDLASGASASRH* |
Ga0134128_121655821 | 3300010373 | Terrestrial Soil | VRFRPDSPNITATIPLDALSGEETTASFLSVLRDLAAGSSASRH* |
Ga0134128_124053642 | 3300010373 | Terrestrial Soil | SESPHLAATVPLEALADEQAAAGFLSVLRELAAGASASRQ* |
Ga0126381_1013486201 | 3300010376 | Tropical Forest Soil | ESPHLAATIPLDSLSDEEAAAGFVGMLRELAAGASTSHQ* |
Ga0126381_1036293551 | 3300010376 | Tropical Forest Soil | LAATIALDALSDEETTAAFLGVLRDLAAGSSASRH* |
Ga0136449_1005480591 | 3300010379 | Peatlands Soil | SVRFRPESPHLAATIDLESLSDERAAAGFLGVLRDLAAGASTHRQ* |
Ga0136449_1030443331 | 3300010379 | Peatlands Soil | LLSVRFRSESPHLAATVPLEALTDKGAAASFLKVLRELAAGASTSRQ* |
Ga0136449_1045267431 | 3300010379 | Peatlands Soil | FRPHSPHLAATIDLEALSDERAAAGFLGVLRDLAAGASTHRQ* |
Ga0137392_100994731 | 3300011269 | Vadose Zone Soil | HNLVSVRFRPESPHLAATVPLEALSDEQAAAGFLSVLRDLAAGASTSRQ* |
Ga0137363_115901432 | 3300012202 | Vadose Zone Soil | SPHIAATVPLEALSDEQAAAGFLSVLRELAAGASASHQ* |
Ga0137381_106829581 | 3300012207 | Vadose Zone Soil | PNLAATIALDALSDEETTAAFLGVLRDLAAGSSASRH* |
Ga0137378_101946573 | 3300012210 | Vadose Zone Soil | DSPNLAATIALDALSDEETTAAFLGVLRDLAAGSSASRH* |
Ga0137378_117993061 | 3300012210 | Vadose Zone Soil | RPESPHLAATVPLDAVVDEQAAAGFLTVVRELAAGATHQQ* |
Ga0137371_103100241 | 3300012356 | Vadose Zone Soil | ESPHLAATVPLDAVVDEHAAAGFLTVVRELAAGAAHQQ* |
Ga0137384_113465392 | 3300012357 | Vadose Zone Soil | LTVRFRPDSPNLAATVPLDALSDEEAMAAFFTVLRDLAAGSSASRH* |
Ga0137390_106918412 | 3300012363 | Vadose Zone Soil | LAATVPLEALPDEQATAAFLSVLRDLAAGASTSRQ* |
Ga0137359_106189512 | 3300012923 | Vadose Zone Soil | RPESPHLAAPVPLGAVVDERAAAGFLTVVRELAAGAAHQQ* |
Ga0137419_112145872 | 3300012925 | Vadose Zone Soil | NLISVRFRSESPHIAATVPLEALSDEQAAAGFLSVLRELAAGASASRQ* |
Ga0157378_101874083 | 3300013297 | Miscanthus Rhizosphere | FRSESPHIAATVPLEALSDEQAAAGFLSVLRELAAGASASRQ* |
Ga0157378_132463952 | 3300013297 | Miscanthus Rhizosphere | LLSVLFRSKSPHLTATVALESLSDPQAGAGFLDVVRELAAGASTRQS* |
Ga0120132_10295861 | 3300013832 | Permafrost | HSLMTVRFRPNSPHLVATVPLDAVCDEQTAAGFLTVLRDLAAGASTSRQ* |
Ga0134081_100277341 | 3300014150 | Grasslands Soil | LVTVRFRPESPHLAATVPLDAVVDEQAAAGFLTVVRELAAGAAHQQ* |
Ga0182014_102895173 | 3300014491 | Bog | SQSPHLAVTIPLESLSDQGSAAGFMKVLRDLAAGASAFRQ* |
Ga0182015_109580092 | 3300014495 | Palsa | VRFRPESPHLAATIDLEALSDERAAAGFLGVLRDLAAGASTHRQ* |
Ga0137418_110396042 | 3300015241 | Vadose Zone Soil | MSVRFRSESPHLAATVPLEALADEQGAAGFLSVLRELAAGASASHQ |
Ga0134073_104189401 | 3300015356 | Grasslands Soil | SESPHIAATVPLEALSDEQAAAGFLSVLRELAAGASASHQ* |
Ga0132255_1019699481 | 3300015374 | Arabidopsis Rhizosphere | QESPNLTATIPLDALSGEETTASFLSVLRDLAAGSSASRH* |
Ga0182037_121735501 | 3300016404 | Soil | LMNVRFCPESPHLAATIDLEALSDEQAAAGFLGVLRDLAAGASAHRQ |
Ga0187879_104133472 | 3300017946 | Peatland | GHNLLSVRFRPESPHLAATIDLEALSDEQAAAGFLGVLRDLAAGASTPRQ |
Ga0187779_100052197 | 3300017959 | Tropical Peatland | RGHDLISVRFGPNSPHLAATIDLEALSGEEAAASFLGVVRDLAAGASTSRQ |
Ga0187781_104768511 | 3300017972 | Tropical Peatland | FGPNSPHLAATIELEALSGQEAAAGFLGVLRDLASGASAPRQ |
Ga0187788_104927581 | 3300018032 | Tropical Peatland | PDSPNLAATIDLNALSNEEAAAGFLGVVRDLAAGASASRP |
Ga0187855_101700952 | 3300018038 | Peatland | NLLSVRFRPESPHLAATIDLEALSDEQAAAGFLGVLRDLAASASTPRQ |
Ga0187890_100782411 | 3300018044 | Peatland | RFRPESPHLAATIDLEALSDEQAAAGFLGVLRDLAASASTPRQ |
Ga0187890_103843541 | 3300018044 | Peatland | RFREESPHLAATLPLAALSDEQAATSFLKVLRALAEGASLHPQ |
Ga0187859_104096471 | 3300018047 | Peatland | NLLSVRLRPESPHLAATIDLEDVSNEAAAASFLGVLRDLAGASISRQ |
Ga0187769_109337531 | 3300018086 | Tropical Peatland | RPESPHLAATIDLEALSGEDAAAGFLGVLRDLAPGASASRQ |
Ga0187771_100591854 | 3300018088 | Tropical Peatland | RPESPHLAATIDLEDLSNEAAAASFLGVLRDLAGAAASRQ |
Ga0187771_118100551 | 3300018088 | Tropical Peatland | SVRLRPESPHLAATIDLEDISNEAAAASFLSVLRDLAGASTFRQ |
Ga0066667_100192951 | 3300018433 | Grasslands Soil | HNLVTVRFRPESPHLAATVPLDAVVDEQAAAGFLTVVRELAAGAAHQQ |
Ga0193723_11622012 | 3300019879 | Soil | SVRFRSESPHIAATVPLEALSDEQAAAGFLSVLRELAAGASASRQ |
Ga0193726_11835391 | 3300020021 | Soil | LITVRFRPDSPHLAATVPLDAFSDEHTAANFLNVVRELAAGASTYRE |
Ga0210399_106485242 | 3300020581 | Soil | HSPHLAATIDLEALSDERAAAGFLGVLRDLAAGVSTHRQ |
Ga0210388_104001351 | 3300021181 | Soil | HLAATIDLEALSDERAAAGFLGVLRDLAAGASTHRQ |
Ga0193719_101180132 | 3300021344 | Soil | DLMSVRFRAESPHLVATVALEALSDEQAAAGFLGVMRELAVGASAHRH |
Ga0210389_102689632 | 3300021404 | Soil | LAATIDLEALSDERAAAGFLGVLRDLAAGVSTHRQ |
Ga0210389_110773771 | 3300021404 | Soil | TVRFHPQSPHLAATIDLEALSDERAAAGFLGVLRDLAAGASTHRQ |
Ga0210386_100834144 | 3300021406 | Soil | QSPHLAATIDLEALSDERAAAGFLGVLRDLAAGASTHRQ |
Ga0210383_117811132 | 3300021407 | Soil | PQSPHLAATIDLEALSDERAAAGFLGVLRDLAAGASTHRQ |
Ga0210390_114655121 | 3300021474 | Soil | FRPHSPHLAATIDLEALSDERAAAGFLGVLRDLAAGASTHRQ |
Ga0210409_106653911 | 3300021559 | Soil | LAATIPLEALSDEQAAASFLTVLRELAAGASTHRQ |
Ga0207684_104208483 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | NLAATIPLEALSDEETTATFLSVLRDLAAGASASRH |
Ga0207687_110206032 | 3300025927 | Miscanthus Rhizosphere | ISVRFRSESPHIAATVPLEALSDEQAAAGFLSVLRELAAGASASRQ |
Ga0207709_108162011 | 3300025935 | Miscanthus Rhizosphere | ESPHIAATVPLEALSDEQAAAGFLSVLRELAAGASASRQ |
Ga0209863_101804442 | 3300026281 | Prmafrost Soil | PHLSATIPLEALSDEETTASFLNVLRELAVGASASRH |
Ga0209027_10782393 | 3300026300 | Grasslands Soil | VRFRPDSPNLAATIPLEALSDEEATASFLTVLRDLASGASASRH |
Ga0209687_10108671 | 3300026322 | Soil | MSVRFRPNSPHLAATIPLEALSDEHAAAGFLSVLRELAAGASTHQQ |
Ga0209152_100585843 | 3300026325 | Soil | PNSPHLAATIPLEALSDEHAAAGFLSVSRELAAGASTHQQ |
Ga0209375_12263832 | 3300026329 | Soil | GHHLVTVRFRPESPHLAATVPLDAVVDEQAAAGFLTVVRELAAGAAHQQ |
Ga0209803_12651282 | 3300026332 | Soil | LVTVRFRPESPHLAATVPLDAVVDEQAAAGFFTVVRELAAGAAHQQ |
Ga0209377_12782802 | 3300026334 | Soil | PESPHLAATVPLDAVVDEQAAAGFLTVVRELAAGAAHQQ |
Ga0209378_10575861 | 3300026528 | Soil | HLAATVPLDAVVDEQAAAGFLTVVRELAAGAAHQQ |
Ga0208696_11348661 | 3300027696 | Peatlands Soil | ESPHLAATIDLDALSDERAAAGFLGVLRDLAAGASTHRQ |
Ga0209040_105497261 | 3300027824 | Bog Forest Soil | HSLLNVRLRPDSPHLAATIDLESLSDEKAAAGFLGVLRDLAAGASRSRQ |
Ga0209517_100978683 | 3300027854 | Peatlands Soil | HLAAPIDLESLSDERAAAGFLGVLRDLAAGASTHRQ |
Ga0209579_103127081 | 3300027869 | Surface Soil | GHNLLSVRFRPESPHLAATIDLEALSDERAAAGFLGVLRDLAAGASTHRQ |
Ga0209275_104682151 | 3300027884 | Soil | SPHLAATVDLDALSGEEAAAGFLSVLRELAAGASRTRQ |
Ga0209006_104900971 | 3300027908 | Forest Soil | HIAATMDLDALSGEDAATGFLSVLRELAAGALRSRQ |
Ga0268264_106000052 | 3300028381 | Switchgrass Rhizosphere | SKSPHLTATVALESLSDPQAGAGFLDVVRELAAGASTRQS |
Ga0257175_10033492 | 3300028673 | Soil | HSLISVRFRSESPHLAATVPLDTLSDEQAAAGFLSVLRELAAGASASHQ |
Ga0307305_102795141 | 3300028807 | Soil | VATVALEALSDEQAAAGFLGVMRELAAGASTHRHKS |
Ga0307312_100614731 | 3300028828 | Soil | RFRSESPHLAATVPLEALSDQQAAAGFLSVLRELAAGASASHQ |
Ga0302278_100787572 | 3300028866 | Bog | PDSPHLAATVALDSLSNEETAASFVKVLRELAAGASAPQ |
Ga0316363_102079802 | 3300030659 | Peatlands Soil | NLLSVRFRPESPHLAATIDLESLSDERAAAGFLGVLRDLAAGASTHRQ |
Ga0170823_151953121 | 3300031128 | Forest Soil | RRDSPHLSATIPLDALSGEETTASFLSVLRDLAAGSSASRQ |
Ga0307476_103247552 | 3300031715 | Hardwood Forest Soil | NLLTVRFRPHSPHLAATIDLEALSDERAAAGFLGVLRDLAAGVSTHRQ |
Ga0307469_101740793 | 3300031720 | Hardwood Forest Soil | VRFRPESPHLAVTVTLDSLSDGRTAASFLGLLRELAAGASTHRQ |
Ga0306926_116938402 | 3300031954 | Soil | RFRPVSPHLAATIPLDSLSDEEAAAGFVGMLRELAAGASTSHQ |
Ga0307472_1007572191 | 3300032205 | Hardwood Forest Soil | HLAATVPLEALSDEQAAAGFLSVLRELAAGASASRQ |
Ga0335079_101197124 | 3300032783 | Soil | LAATIPLEALSDEEATAAFLNVLRDLASGASASRH |
Ga0335079_108817661 | 3300032783 | Soil | LLNVRFRPESPHLAATIDLEVLSGEEAAAGFLGVLRDLAAGASTSRHWPLSG |
Ga0335080_100737991 | 3300032828 | Soil | LDPDSPNLAATIDLNALSDEEAAAGFLGVVRDLAAGASASRP |
Ga0335077_117751501 | 3300033158 | Soil | ASRGHSLLRVKFRSESPHLAATVAFEALSDDRLAASFLNVLRDLAADASTSRQ |
⦗Top⦘ |