NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F062999

Metagenome / Metatranscriptome Family F062999

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F062999
Family Type Metagenome / Metatranscriptome
Number of Sequences 130
Average Sequence Length 51 residues
Representative Sequence PMLAEPTEIGYHAVFANWAYQFAAIDPPATASNGKLEVIGSQRGPSFGHAY
Number of Associated Samples 105
Number of Associated Scaffolds 130

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 98.46 %
% of genes from short scaffolds (< 2000 bps) 88.46 %
Associated GOLD sequencing projects 98
AlphaFold2 3D model prediction Yes
3D model pTM-score0.26

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (63.077 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere
(18.462 % of family members)
Environment Ontology (ENVO) Unclassified
(32.308 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(52.308 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 31.65%    β-sheet: 0.00%    Coil/Unstructured: 68.35%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.26
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 130 Family Scaffolds
PF05088Bac_GDH 56.92
PF13546DDE_5 2.31
PF07592DDE_Tnp_ISAZ013 1.54
PF00324AA_permease 0.77
PF12710HAD 0.77
PF01872RibD_C 0.77
PF03176MMPL 0.77
PF03050DDE_Tnp_IS66 0.77

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 130 Family Scaffolds
COG2902NAD-specific glutamate dehydrogenaseAmino acid transport and metabolism [E] 56.92
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 0.77
COG0531Serine transporter YbeC, amino acid:H+ symporter familyAmino acid transport and metabolism [E] 0.77
COG0833Amino acid permeaseAmino acid transport and metabolism [E] 0.77
COG1033Predicted exporter protein, RND superfamilyGeneral function prediction only [R] 0.77
COG1113L-asparagine transporter or related permeaseAmino acid transport and metabolism [E] 0.77
COG1115Na+/alanine symporterAmino acid transport and metabolism [E] 0.77
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 0.77
COG2409Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamilyGeneral function prediction only [R] 0.77
COG3436TransposaseMobilome: prophages, transposons [X] 0.77

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms63.08 %
UnclassifiedrootN/A36.92 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908009|FWIRA_GRAM18402ICO4RNot Available502Open in IMG/M
3300000955|JGI1027J12803_107397524Not Available643Open in IMG/M
3300005175|Ga0066673_10175698All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1207Open in IMG/M
3300005334|Ga0068869_100262300All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1383Open in IMG/M
3300005337|Ga0070682_101390875Not Available599Open in IMG/M
3300005343|Ga0070687_100034801All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales2496Open in IMG/M
3300005434|Ga0070709_10076931All Organisms → cellular organisms → Bacteria2168Open in IMG/M
3300005434|Ga0070709_11333240Not Available579Open in IMG/M
3300005434|Ga0070709_11433795All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales560Open in IMG/M
3300005434|Ga0070709_11482565Not Available550Open in IMG/M
3300005435|Ga0070714_100163883All Organisms → cellular organisms → Bacteria2013Open in IMG/M
3300005435|Ga0070714_101174710Not Available748Open in IMG/M
3300005435|Ga0070714_101247290All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales725Open in IMG/M
3300005435|Ga0070714_101504810All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales657Open in IMG/M
3300005435|Ga0070714_101658812Not Available624Open in IMG/M
3300005435|Ga0070714_101769070Not Available603Open in IMG/M
3300005435|Ga0070714_101991826Not Available566Open in IMG/M
3300005435|Ga0070714_102323041All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales521Open in IMG/M
3300005436|Ga0070713_101997696Not Available562Open in IMG/M
3300005437|Ga0070710_10818407Not Available666Open in IMG/M
3300005437|Ga0070710_10849314All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales655Open in IMG/M
3300005439|Ga0070711_100934454Not Available741Open in IMG/M
3300005445|Ga0070708_101538634Not Available619Open in IMG/M
3300005457|Ga0070662_100179363Not Available1669Open in IMG/M
3300005467|Ga0070706_100517916All Organisms → cellular organisms → Bacteria → Terrabacteria group1109Open in IMG/M
3300005548|Ga0070665_101374306All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales715Open in IMG/M
3300005548|Ga0070665_102198448Not Available555Open in IMG/M
3300005587|Ga0066654_10678357Not Available576Open in IMG/M
3300005614|Ga0068856_101934464Not Available600Open in IMG/M
3300005615|Ga0070702_100047083All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales2447Open in IMG/M
3300005841|Ga0068863_100475312All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1228Open in IMG/M
3300005842|Ga0068858_100153031All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales2169Open in IMG/M
3300006028|Ga0070717_11226329Not Available682Open in IMG/M
3300006028|Ga0070717_11509874Not Available609Open in IMG/M
3300006173|Ga0070716_101383344All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales571Open in IMG/M
3300006175|Ga0070712_101253853Not Available645Open in IMG/M
3300006175|Ga0070712_101533818Not Available582Open in IMG/M
3300006237|Ga0097621_102007579Not Available552Open in IMG/M
3300006237|Ga0097621_102258746Not Available521Open in IMG/M
3300006354|Ga0075021_10527562All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales750Open in IMG/M
3300006573|Ga0074055_11822893All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1335Open in IMG/M
3300006574|Ga0074056_11131159Not Available560Open in IMG/M
3300006575|Ga0074053_12004728All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales980Open in IMG/M
3300006579|Ga0074054_12134161All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales546Open in IMG/M
3300006755|Ga0079222_10148244All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1329Open in IMG/M
3300006796|Ga0066665_11502555Not Available526Open in IMG/M
3300006871|Ga0075434_100704022All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1027Open in IMG/M
3300006954|Ga0079219_10030853All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. ADI96-152117Open in IMG/M
3300006954|Ga0079219_10195543All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1140Open in IMG/M
3300009098|Ga0105245_11445593All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales738Open in IMG/M
3300009101|Ga0105247_10306277All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1104Open in IMG/M
3300009148|Ga0105243_11925081Not Available624Open in IMG/M
3300009174|Ga0105241_10129390All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales2042Open in IMG/M
3300009545|Ga0105237_12572962Not Available519Open in IMG/M
3300009545|Ga0105237_12587570Not Available518Open in IMG/M
3300009545|Ga0105237_12675072Not Available510Open in IMG/M
3300009623|Ga0116133_1050129All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1035Open in IMG/M
3300009792|Ga0126374_10452299All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales913Open in IMG/M
3300010362|Ga0126377_10121821All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2411Open in IMG/M
3300010366|Ga0126379_13693270All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales513Open in IMG/M
3300010373|Ga0134128_11378415All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales777Open in IMG/M
3300010396|Ga0134126_11177022All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales852Open in IMG/M
3300010396|Ga0134126_11709909Not Available691Open in IMG/M
3300010396|Ga0134126_12075948All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales621Open in IMG/M
3300010397|Ga0134124_13191647Not Available502Open in IMG/M
3300010399|Ga0134127_12632933Not Available583Open in IMG/M
3300010400|Ga0134122_10541967All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1062Open in IMG/M
3300012200|Ga0137382_10430652All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales932Open in IMG/M
3300012201|Ga0137365_10367557All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1062Open in IMG/M
3300012209|Ga0137379_11678601All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales532Open in IMG/M
3300012349|Ga0137387_11280941All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales514Open in IMG/M
3300012351|Ga0137386_10981453Not Available602Open in IMG/M
3300012357|Ga0137384_11258587Not Available586Open in IMG/M
3300012929|Ga0137404_10617817All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales975Open in IMG/M
3300012988|Ga0164306_11211376All Organisms → cellular organisms → Bacteria → Proteobacteria634Open in IMG/M
3300012989|Ga0164305_11934082Not Available536Open in IMG/M
3300013296|Ga0157374_11018851All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales847Open in IMG/M
3300013296|Ga0157374_12395998Not Available555Open in IMG/M
3300013308|Ga0157375_11977573All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales693Open in IMG/M
3300014054|Ga0120135_1065263All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales591Open in IMG/M
3300014968|Ga0157379_12082552Not Available562Open in IMG/M
3300015373|Ga0132257_102493847All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales672Open in IMG/M
3300018043|Ga0187887_10406227All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales803Open in IMG/M
3300018468|Ga0066662_12611272Not Available534Open in IMG/M
3300018482|Ga0066669_11234552All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales675Open in IMG/M
3300019877|Ga0193722_1065559Not Available905Open in IMG/M
3300020580|Ga0210403_10321490All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1267Open in IMG/M
3300020581|Ga0210399_11249070All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales587Open in IMG/M
3300021088|Ga0210404_10026388All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2557Open in IMG/M
3300021404|Ga0210389_10398300All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1082Open in IMG/M
3300022724|Ga0242665_10309550All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales555Open in IMG/M
3300025527|Ga0208714_1020150All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1634Open in IMG/M
3300025898|Ga0207692_10505676All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales767Open in IMG/M
3300025898|Ga0207692_10833344Not Available604Open in IMG/M
3300025903|Ga0207680_10472309All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales891Open in IMG/M
3300025906|Ga0207699_11173967Not Available568Open in IMG/M
3300025910|Ga0207684_10109789All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2361Open in IMG/M
3300025914|Ga0207671_10765469All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales767Open in IMG/M
3300025916|Ga0207663_10050611All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2582Open in IMG/M
3300025916|Ga0207663_11143081Not Available626Open in IMG/M
3300025916|Ga0207663_11553938Not Available533Open in IMG/M
3300025922|Ga0207646_11900349All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales507Open in IMG/M
3300025945|Ga0207679_11005476All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales764Open in IMG/M
3300025960|Ga0207651_10528991All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1023Open in IMG/M
3300026088|Ga0207641_12572994Not Available507Open in IMG/M
3300026310|Ga0209239_1241986All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales624Open in IMG/M
3300026316|Ga0209155_1028443All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2279Open in IMG/M
3300027031|Ga0208986_1010516All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales891Open in IMG/M
3300027725|Ga0209178_1155677All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales791Open in IMG/M
3300027765|Ga0209073_10009547All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2577Open in IMG/M
3300027765|Ga0209073_10450433Not Available535Open in IMG/M
3300028808|Ga0302228_10156117All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1050Open in IMG/M
3300028879|Ga0302229_10423064All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales591Open in IMG/M
3300029999|Ga0311339_10195707All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales2295Open in IMG/M
3300030013|Ga0302178_10223100All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales896Open in IMG/M
3300030399|Ga0311353_11350130All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales582Open in IMG/M
3300031226|Ga0307497_10142757All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales986Open in IMG/M
3300031446|Ga0170820_15757601Not Available761Open in IMG/M
3300031681|Ga0318572_10391170All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales826Open in IMG/M
3300031718|Ga0307474_10999039All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales662Open in IMG/M
3300031744|Ga0306918_10506504All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales945Open in IMG/M
3300031747|Ga0318502_10379247All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales839Open in IMG/M
3300031771|Ga0318546_10527048All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales830Open in IMG/M
3300031779|Ga0318566_10055041All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → unclassified Roseomonas → Roseomonas sp. TAS131898Open in IMG/M
3300031835|Ga0318517_10325005All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales695Open in IMG/M
3300032008|Ga0318562_10242914All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1045Open in IMG/M
3300032059|Ga0318533_11275862All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales537Open in IMG/M
3300032898|Ga0335072_11081664All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales726Open in IMG/M
3300033134|Ga0335073_11806111Not Available571Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere18.46%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil9.23%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil6.15%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.38%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil5.38%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil4.62%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.85%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa3.85%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere3.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.08%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.08%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.31%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.31%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.31%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.31%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.31%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.54%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.54%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere1.54%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.54%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.54%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.77%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.77%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.77%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.77%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.77%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.77%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.77%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.77%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.77%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.77%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.77%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.77%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.77%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.77%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.77%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.77%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.77%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908009Soil microbial communities from sample at FACE Site Metagenome WIR_Amb2EnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006573Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006574Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006575Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006579Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009623Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10EnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014054Permafrost microbial communities from Nunavut, Canada - A34_5cm_12MEnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019877Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300022724Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025527Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026310Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026316Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes)EnvironmentalOpen in IMG/M
3300027031Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300028808Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2EnvironmentalOpen in IMG/M
3300028879Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3EnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030013Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3EnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FWIRA_039592702124908009SoilPVPAEFTPMLAEPTEVGYHAVLANWAYQFAAIDPAATASNGKLEVIGSQRGPSFGHAY
JGI1027J12803_10739752413300000955SoilGYHAVLANWAYQFAAIDPPATASNGKLEVIGSERGPSFGHAY*
Ga0066673_1017569813300005175SoilYHAVFANWAYQFAAIDPAATASNGKLEVIGAQRGPSFGHAY*
Ga0068869_10026230013300005334Miscanthus RhizosphereMLAEPTEIGYHAVFANWAYQFAAIDPSATASNGKLEVIGSQRGPSFGHAY*
Ga0070682_10139087523300005337Corn RhizosphereEFKPMLAEPTEIGYHAVFANWAYQFAAIDPAATASNGKLEVIGSQRGPSFGHAY*
Ga0070687_10003480123300005343Switchgrass RhizosphereFKPMLAEPTEIGYHAVFANWAYQFAAIDPAATASNGKLEVIGSQRGPSFGHAY*
Ga0070709_1007693113300005434Corn, Switchgrass And Miscanthus RhizosphereSPIGVPAEFKPMLAEPTEIGYHAVFANWAYQFAAIDPAATVSNGKLEVIGSQRGPSFGHAY*
Ga0070709_1133324013300005434Corn, Switchgrass And Miscanthus RhizosphereTEIGYHAVFANWAYQFAAIDPPATASNGKLEVIGSQRGPNFGHAY*
Ga0070709_1143379523300005434Corn, Switchgrass And Miscanthus RhizospherePILTTPGQVGYHAVYANWAYQYAAIDPPASASDAKLQIIGWQSGPSYGHAF*
Ga0070709_1148256513300005434Corn, Switchgrass And Miscanthus RhizosphereLVAGSPIGVPAEFKPMLAEPTEIGYHAVFANWAYQFTAIDPPATASNGKLEVIGSERGASFGHAY*
Ga0070714_10016388313300005435Agricultural SoilVAGSPIGVPAEFKPMLAEPTEIGYHAVFANWAYQFAAIDPAATVSNGKLEVIGSQRGPSFGHAY*
Ga0070714_10117471023300005435Agricultural SoilPVPDAVAPILTTPGQVGYHAVYANWAYQYAAIDPPASASGAKLQIIGWQGGPSYGHAF*
Ga0070714_10124729013300005435Agricultural SoilPMLAEPTEIGYHAVFANWAYQFAAIDPPATASNGKLEVIGSERGPSFGHAY*
Ga0070714_10150481013300005435Agricultural SoilVPAEFKPMLAEPTEIGYHAVFANWAYQFAAIDPSATASNGKLEVIGFQRGPNFGHAY*
Ga0070714_10165881223300005435Agricultural SoilGSPIGVPAEFQPMLAEPTEIGYHAVFANWAYQFAAIDPAATASNGKLEVIGSQRGPSFGHAY*
Ga0070714_10176907023300005435Agricultural SoilSPIGVPAEFKPMLAEPTEIGYHAVFANWVYQFAAIDPAATASNGKLEVIGSQRGPSFGHAY*
Ga0070714_10199182613300005435Agricultural SoilPMLAEPTEIGYHAVFANWAYQFAAIDPPATASNGKLEVIGSQRGPNFGHAY*
Ga0070714_10232304113300005435Agricultural SoilDAGSPIPVPDAVAPILTTPGQVGYHAVYANWVYQYAAIDPSASASDAKLQIIGWQGGPSYGHAF*
Ga0070713_10199769623300005436Corn, Switchgrass And Miscanthus RhizosphereKPLLDAPTEVGYHAVFANWAYQFAAIDPPATARDAKLDIIGSQAGPSFGHAY*
Ga0070710_1081840713300005437Corn, Switchgrass And Miscanthus RhizospherePIGVPAEFKPMLAEPTEIGYHAVFANWAYQFAAIDPAATVSNGKLEVIGSQRGPSFGHAY
Ga0070710_1084931413300005437Corn, Switchgrass And Miscanthus RhizosphereKPLLDAPTEVGYHAVFANWAYQFAAIDPPATARDAKLDVIGSQSSPSFGHAY*
Ga0070711_10093445413300005439Corn, Switchgrass And Miscanthus RhizosphereSPIPVPDAVAPILTTPGQVGYHAVYANWVYQYAAIDPPASASDAKLQIIGWQGGPSYGHAF*
Ga0070708_10153863413300005445Corn, Switchgrass And Miscanthus RhizosphereVPAEFKPMLAEPTEIGYHAVFANWAYQFAAIDPAATVSNGKLEVIGSQRGPSFGHAY*
Ga0070662_10017936313300005457Corn RhizospherePMLAEPTEIGYHAVFANWAYQFAAIDPSATASNGKLEVIGSQRGPSFGHAY*
Ga0070706_10051791613300005467Corn, Switchgrass And Miscanthus RhizosphereGSPIGVPAGFAPLLAAPTEVGYHEVIANWAYQFAAIDPPAAARDAKLDVIGSQSGPSFAHAY*
Ga0070665_10137430613300005548Switchgrass RhizospherePTEIGYHAVFANWAYQFAAIDPPATASNGKLEVIGSQRGPSFGHAY*
Ga0070665_10219844823300005548Switchgrass RhizosphereGYHAVFANWAYQFAAIDPPATASNGKLEVIGSQRGPNFGHAY*
Ga0066654_1067835723300005587SoilANWAYQFAAIDPAATASNGKLEVIGAQRGPSFGHAY*
Ga0070762_1105185413300005602SoilDWAYQFAAIDPPATANHAKINIIAATGLPSFGHAY*
Ga0068856_10193446413300005614Corn RhizosphereVAGSPIGVPAEFKPMLAEPTEIGYHAVFANWAYQFAAIDPPATASNGKLEVIGSQRGPSFGHAY*
Ga0070702_10004708323300005615Corn, Switchgrass And Miscanthus RhizosphereEPTEIGYHAVFANWAYQFAAIDPPATASNGKLEVIGSQRGPSFGHAY*
Ga0068863_10047531213300005841Switchgrass RhizosphereFANWAYQFAAIDPPATASNGKLEVIGSQRGPSFGHAY*
Ga0068858_10015303133300005842Switchgrass RhizosphereEIGYHAVFANWAYQFAAIDPAATVSNGKLEVIGSQRGPSFGHAY*
Ga0070717_1122632923300006028Corn, Switchgrass And Miscanthus RhizospherePIGVPAEFKPMLAEPTEIGYHAVFANWAYQFAAIDPPATASNGKLEVIGSERGASFGHAY
Ga0070717_1150987423300006028Corn, Switchgrass And Miscanthus RhizospherePIGVPAEFKPMLAEPTEIGYHAVFANWAYQFAAIDPPATASNGKLEVIGSQRGPSFGHAY
Ga0070716_10138334423300006173Corn, Switchgrass And Miscanthus RhizosphereVFANWAYQFAAIDPPATARDAKLDVIGSQSSPSFGHAY*
Ga0070712_10125385323300006175Corn, Switchgrass And Miscanthus RhizospherePAEFKPMLAEPTEIGYHAVFANWAYQFAAIDPAATASNGKLEVIGSERGPSFGHAY*
Ga0070712_10153381823300006175Corn, Switchgrass And Miscanthus RhizospherePMLAEPTEIGYHAVFANWAYQFAAIDPPATASNGKLEVIGSQRGPSFGHAY*
Ga0097621_10200757923300006237Miscanthus RhizosphereVPAEFKPMLAEPTEIGYHAVFANWAYQFAAIDPPATASNGKLEVIGSERGPSFGHAY*
Ga0097621_10225874623300006237Miscanthus RhizosphereHAVFANWAYQFAAIDPPATASNGKLEVIGSQRGPNFGHAY*
Ga0075021_1052756213300006354WatershedsGAPIGVPAAFAPLLAAPTEIGYHAVLADWAYQFAAIDPPADADGAKLAIIASQRWPSSGHAY*
Ga0074055_1182289323300006573SoilLIAGSPIGVPAEFKPMLAEPTEVGYHAVFANWAYQFAAIEPAATARDGKLEVIGSQRGPSFGHAY*
Ga0074056_1113115923300006574SoilVAGSPIGVPPEFKPMLAEPTEVGYHAVFANWAYQFAAIDPSDTASNGKLEVIGSQRGPSFGHAY*
Ga0074053_1200472813300006575SoilEFKPMLAEPTEVGYHAVFANWAYQFAAIDPAATARDGKLEVIGSQHGPSFGHAY*
Ga0074054_1213416113300006579SoilFKPMLAEPTEVGYHAVFANWAYQFAAIDPAATARDGKLEVIGSQHGPSFGHAY*
Ga0079222_1014824413300006755Agricultural SoilVPAEFKPMLAEPTEIGYHAVFANWAYQFAAIDPPATASNGKLEVIGSQRGPSFGHAY*
Ga0066665_1150255523300006796SoilEFKPLLDAPTEVGYHAVFANWAYQFAAIDPPATAHDAKLDIIGSQSGPSFGHAY*
Ga0075434_10070402223300006871Populus RhizosphereYHAVFANWAYQFAAIDPAATASNGKLEVIGSQRDPSFGHAY*
Ga0079219_1003085313300006954Agricultural SoilLTTPGQVGYHAVYANWAYQYAAIDPPASATNGKLQIIGWQGGPSYGHAY*
Ga0079219_1019554313300006954Agricultural SoilANWAYQFAAIDPPATARDGKLDVIGSQSGPSFGHAY*
Ga0105245_1144559313300009098Miscanthus RhizosphereKPMLAEPTEIGYHAVFANWAYQFAAIDPAATVSNGKLEVIGSQRGPSFGHAY*
Ga0105247_1030627713300009101Switchgrass RhizosphereLAEPTEIGYHAVFANWAYQFAAIDPAATVSNGKLEVIGSQRGPSFGHAY*
Ga0105243_1192508113300009148Miscanthus RhizospherePMLAEPTEIGYHAVFANWAYQFAAIDPAATASNGKLEVIGSQRGPSFGHAY*
Ga0105241_1012939013300009174Corn RhizosphereGVPAEFKPMLAEPTEIGYHAVFANWAYQFAAIDPPATASNGKLEVIGSQRGPSFGHAY*
Ga0105237_1257296223300009545Corn RhizosphereANWAYQFAAIDPPATASNGKLEVIGSQRGPNFGHAY*
Ga0105237_1258757013300009545Corn RhizosphereEPTEIGYHAVFANWAYQFAAIDPPATARDAKLDVIGSQSSPSFGHAY*
Ga0105237_1267507223300009545Corn RhizosphereVFANWAYQFAAIDPPATASNGKLEVIGSQRGPNFGHAY*
Ga0116133_105012923300009623PeatlandVPAAFSAILTTPNEVGYHAVYANWAYQYAAIDPPASASHAKLQIIAWQSGPSYGHAY*
Ga0126374_1045229913300009792Tropical Forest SoilAPLLGEPTEIGHHAVVATWAYQFAAIDPPASARDAKLDIIGWQSGPSDGHAY*
Ga0126377_1012182123300010362Tropical Forest SoilLAAPTEVGYHAVYGNLTYQFAAIDPPASARDAKLDIIAWQSGPSYSHAS*
Ga0126379_1369327023300010366Tropical Forest SoilSHAVFANWAYQFAAVDPPATARGAKLDIIGWQSGPSLGHAY*
Ga0134128_1137841523300010373Terrestrial SoilAGSPIPVPAEFTPMLAEPTEVGYHAVLANWAYQFAAIDPSATASNGKLEVIGSQRGPSFGHAY*
Ga0134126_1117702213300010396Terrestrial SoilLVAGSPIGVPAEFKPMLAEPTEIGYHAVFANWAYQFAAIDPAATVSNGKLEVIGSQRGPSFGHAY*
Ga0134126_1170990913300010396Terrestrial SoilYANWVYQYAAIDPPASASDAKLQIIGWQGGPSYGHAF*
Ga0134126_1207594823300010396Terrestrial SoilAVFANWAYQFAAIDPPATARDAKLDVIGSQSSPSFGHAY*
Ga0134124_1319164723300010397Terrestrial SoilGYHAVLANWAYQFAAIDPSATASNGKLEVIGSQRSPSFGHAY*
Ga0134127_1263293313300010399Terrestrial SoilAEPTEIGYHAVFANWAYQFAAIDPPATASNGKLEVIGSERGPSFGHAY*
Ga0134122_1054196723300010400Terrestrial SoilANWAYQFAAIDPSATASNGKLEVIGSQRGPSFGHAY*
Ga0137382_1043065223300012200Vadose Zone SoilANWAYQFAAIDPPANARDGKLQVIGSQSGPSFGHAY*
Ga0137365_1036755713300012201Vadose Zone SoilPTEVGYHAVFANWAYQFAAIDPPATTRDAKLDIIGSQSGPSFGHAY*
Ga0137379_1167860123300012209Vadose Zone SoilGYHAVFANWAYQFAAIDPSATARDGKLDVIGSQSGPSFGHAY*
Ga0137387_1128094123300012349Vadose Zone SoilGAPIPVPAEFKPLLDAPTEVGYHAVFANWAYQFAAIDPPATARDAKLDIIGSQSGPSFGHAY*
Ga0137386_1098145313300012351Vadose Zone SoilPIPVPAAATPLLTLPNEVGYHAVYANWAYQFAAIDPPATARNAKLQIIAWQSGPSYGRAY
Ga0137384_1125858713300012357Vadose Zone SoilLTTPGQVAYHAVYANWAYQYAAIDPPASASNAKLQIIGWQSGPSYGHAF*
Ga0137404_1061781713300012929Vadose Zone SoilIPVPAEFAPVLTTPGQVGYHAVYANWAYQYAAIDPPASASDAKLQIIGWQSGPSYGHAF*
Ga0164306_1121137623300012988SoilIPVPAEFKPMLAEPTEIGYHAVFANWAYQFAAIDPPATASNGKLEVIGSQRGPNFGHAY*
Ga0164305_1193408213300012989SoilPAEFKPMLAEPTEIGYHAVFANWAYQFAAIDPPATASNGKLEVIGSQRGPNFGHAY*
Ga0157374_1101885113300013296Miscanthus RhizospherePILTTPGQVGYHAVYANWVYQYAAIDPPASARGAKLQIIGWQGGPSYGHAF*
Ga0157374_1239599823300013296Miscanthus RhizosphereNWAYQFAAIDPAATASSGKLEVIGSQRGPSFGHAY*
Ga0157375_1197757313300013308Miscanthus RhizosphereAVFANWAYQFAAIDPAATASSGKLEVIGSQRGPSFGHAY*
Ga0120135_106526323300014054PermafrostVDLVAELRRHDDVLTTPGEVGYHAVFVDWVYQYAAIDPLATGRNAKLQIIGWQGGLHYGHAY*
Ga0157379_1208255213300014968Switchgrass RhizosphereAPTEVGYHAVFANWAYQFAAIDPPATARDAKLDVIGSQSSPSFGHAY*
Ga0132257_10249384713300015373Arabidopsis RhizosphereANWAYQFAAIDPAATASNGKLEVIGSERGPSFGHAY*
Ga0187887_1040622713300018043PeatlandPVPAAFTPLLAAPTEVGYHAVYANWTYQFAAIDPPATAPNAKIDVIASTAGPSYGHAY
Ga0066662_1261127213300018468Grasslands SoilPPIPVPDAVAPILTTPNQVGYHAVFANWAYQFAAIDPPATARDAKLQIIGSQSGLSYGHA
Ga0066669_1123455213300018482Grasslands SoilHAVFANWAYQFAAIDPPATAHDAKLDIIGSQSGPSFGHAY
Ga0193722_106555913300019877SoilPAEFTPMLAEPTEVGYHAVFANWAYQFAAIDPSATASNGKLEVIGSQRGPSFGHAY
Ga0210403_1032149023300020580SoilGYHAVFSNWAYQFAAIDPPATARDGKLDVIASQSGPSYGHAY
Ga0210399_1124907023300020581SoilYHAVFANWAYQFAAIDPPATARDAKLDIIGSQSGPSFGHAY
Ga0210404_1002638823300021088SoilFANWAYQFAAIDPPATARDAKLDIIGSQSGPSFGHAY
Ga0210389_1039830023300021404SoilVPAEFKPMLAEPAEIGYHAVFASWAYQFAAIDPAATASNGKLEVIGSQHGPSFGHAY
Ga0242665_1030955013300022724SoilPLLGAPTEVGYHAVFANWAYQFAAIDPPATARDAKLDIIGSQSGPSFGHAY
Ga0208714_102015013300025527Arctic Peat SoilTPGQVGYHAVFTNWAYQFAAIDPLASARNAKLQIIGWQSGPSYGHAY
Ga0207692_1050567613300025898Corn, Switchgrass And Miscanthus RhizosphereAGSPIGVPAEFQPMLAEPTEIGYHAVFANWAYQFAAIDPAATASNGKLEVIGSQRGPSFGHAY
Ga0207692_1083334413300025898Corn, Switchgrass And Miscanthus RhizosphereHPNLVAGSPIGVPAEFKPMLAEPTEIGYHAVFANWAYQFAAIDPPATASNGKLEVIGSERGASFGHAY
Ga0207680_1047230913300025903Switchgrass RhizosphereYHAVFANWAYQFAAIDPPATASNGKLEVIGSQRGPSFGHAY
Ga0207699_1117396723300025906Corn, Switchgrass And Miscanthus RhizosphereEPTEIGYHAVFANWAYQFAAIDPPATASNGKLEVIGSQRGPSFGHAY
Ga0207684_1010978913300025910Corn, Switchgrass And Miscanthus RhizospherePAGFAPLLAVPTEVGYREVIANWAYQFAAIDPPATARDAKLDVIGSQSGPSFAHAY
Ga0207671_1076546913300025914Corn RhizosphereHAVFANWAYQFAAIDPPATASNGKLEVIGSQRGPNFGHAY
Ga0207663_1005061113300025916Corn, Switchgrass And Miscanthus RhizosphereNLDAGSPIPVPDAVAPILTTPGQVGYHAVYANWAYQYAAIDPPASASDAKLQIIGWQGGPSYGHAF
Ga0207663_1114308123300025916Corn, Switchgrass And Miscanthus RhizosphereSPIPVPAGFKPLLDAPTEVGYHAVFANWAYQFAAIDPPATARDAKLDIIGSQSGPSFGHA
Ga0207663_1155393823300025916Corn, Switchgrass And Miscanthus RhizosphereGFKPLLGAPTEVGYHAVFANWAYQFAAIDPPATAHDAKLDIIGSQSGPSFGHAY
Ga0207646_1190034923300025922Corn, Switchgrass And Miscanthus RhizosphereYHAVLANWAYQFAAIDPPATARDGKLDVIGSQSGPSYGHAY
Ga0207679_1100547623300025945Corn RhizosphereNLVAGSPIGVPAEFKPMLAEPTEIGYHAVFANWAYQFAAIDPPATASNGKLEVIGSQRGPSFGHAY
Ga0207651_1052899123300025960Switchgrass RhizosphereAGSPIGVPAEFQPMLAEPTEIGYHAVFANWAYQFAAIDPAATVSNGKLEVIGSQRGPSFGHAY
Ga0207641_1257299413300026088Switchgrass RhizosphereEIGYHAVFANWAYQFAAIDPPATASNGKLEVIGSERGPSFGHAY
Ga0209239_124198613300026310Grasslands SoilTEVGYHEVLANWAYQFAAIDPPANARDGKLQVIGSQSGPSFGHAY
Ga0209155_102844313300026316SoilPVPAEFKPMLAEPTEIGYHAVFANWAYQFAAIDPAATASNGKLEVIGAQRGPSFGHAY
Ga0208986_101051613300027031Forest SoilYHAVFANWAYQFAAIDPAATASNGKLEVIGSQRGPSFGHAY
Ga0209178_115567713300027725Agricultural SoilTEIGYHAVFANWAYQFAAIDPPATARDAKLDVIGSQSGPSFGHAY
Ga0209073_1000954723300027765Agricultural SoilGSPIGVPAEFKPMLAEPTEIGYHAVFANWAYQFAAIDPPATASNGKLEIIGSERGPDFGHAY
Ga0209073_1045043313300027765Agricultural SoilAVFANWAYQFAAIDPPATASNGKLEVIGSQRGPSFSHAY
Ga0302228_1015611713300028808PalsaLLAAPTEVGYHEVITDWAYQFAATDPPATASHAKIDVIAATSGPSFGHAY
Ga0302229_1042306413300028879PalsaVTPLLAAPTEVGYHEVIADWAYQFAAIDPPATAHNAKIDVIAATGGPSFGHAY
Ga0311339_1019570713300029999PalsaAAPTEVGYHEVITDWAYQFAATDPPATASHAKIDVIAATSGPSFGHAY
Ga0302178_1022310013300030013PalsaAPTEVGYHEVITDWAYQFAATDPPATASHAKIDVIAATSGPSFGHAY
Ga0311353_1135013013300030399PalsaTPLLAAPTEVGYHEVITDWAYQFAATDPPATASHAKIDVIAATSGPSFGHAY
Ga0307497_1014275723300031226SoilKPMLAEPTEVGYHAVLANWAYQFAAIDPGATARGGKLEVIGSQRGPSFGHAY
Ga0170820_1575760113300031446Forest SoilPLLAVPTEVGYHAVFANWAYQFAAIDPPATARDGKLDVIASQSGPSFGHAY
Ga0318572_1039117023300031681SoilVFADWAYQFAAIDPPASAHDGKLDIIASQSGPSYGHAY
Ga0307474_1099903913300031718Hardwood Forest SoilTNWAYQFAAIDPPASARDGKLDIIAWQKSPAYGHAY
Ga0306918_1050650413300031744SoilAFAPLLGEPTEIGYHAVFATWACQFAAIDPPASARDAKLDIIGWQSGPSYGHAY
Ga0318502_1037924723300031747SoilYHAVFADWAYQFAAIDPPASARDGKLDIIASQSGPSYGHAY
Ga0318546_1052704813300031771SoilFANWAYQFAAVDPPATARGAKLDIIGWQSGPSLGHAY
Ga0318566_1005504123300031779SoilAAITSLLVEPNEVGYHAVFADWAYQFAAIDPPASAHDGKLDIIASQSGPSYGHAY
Ga0318517_1032500523300031835SoilFADWAYQFAAIDPPASAHDGKLDVIASQSGPSYGHAY
Ga0318562_1024291413300032008SoilAAITSLLVEPNEVGYHAVFADWAYQFAAIDPPASARDGKLDIIASQSGPSYGHAY
Ga0318533_1127586223300032059SoilPIGVPAAITSLLVEPNEVGYHAVFADWAYQFAAIDPPASAHDGKLDIIASQSGPSYGHAY
Ga0335072_1108166423300032898SoilEFKPMLAEPTEIGYHAVLTSWAYQFAAIDPAATARNGKLEVIGSQRGPSFGHAY
Ga0335073_1180611113300033134SoilGSPIPVPAEFKPMLAEPTEIGYHAVFANWAYQFAAIDPAATVSNGKLEVIGSQRGPSFGHAY

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.