Metagenome Family F063132

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F063132
Family Type	Metagenome
Number of Sequences	130
Average Sequence Length	40 residues
Representative Sequence	ENGFIRAYGPRVEEPGLTLIPAFPYSGPLEDVRLKK
Number of Associated Samples	110
Number of Associated Scaffolds	130

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	1.54 %
% of genes near scaffold ends (potentially truncated)	97.69 %
% of genes from short scaffolds (< 2000 bps)	86.15 %
Associated GOLD sequencing projects	104
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.15

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (92.308 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (15.385 % of family members)
Environment Ontology (ENVO)	Unclassified (30.000 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (44.615 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 4.69% β-sheet: 0.00% Coil/Unstructured: 95.31%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.15
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.15
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 130 Family Scaffolds
PF00296	Bac_luciferase	26.92
PF04909	Amidohydro_2	12.31
PF07969	Amidohydro_3	9.23
PF05726	Pirin_C	6.92
PF13378	MR_MLE_C	2.31
PF00144	Beta-lactamase	1.54
PF01547	SBP_bac_1	1.54
PF13594	Obsolete Pfam Family	1.54
PF13191	AAA_16	0.77
PF00501	AMP-binding	0.77
PF00496	SBP_bac_5	0.77
PF00149	Metallophos	0.77
PF13432	TPR_16	0.77
PF13523	Acetyltransf_8	0.77
PF13462	Thioredoxin_4	0.77
PF00491	Arginase	0.77
PF07859	Abhydrolase_3	0.77
PF00903	Glyoxalase	0.77
PF09130	DUF1932	0.77
PF16576	HlyD_D23	0.77
PF07978	NIPSNAP	0.77
PF14384	BrnA_antitoxin	0.77
PF13659	Obsolete Pfam Family	0.77
PF10672	Methyltrans_SAM	0.77
PF13416	SBP_bac_8	0.77
PF05221	AdoHcyase	0.77
PF02452	PemK_toxin	0.77
PF07719	TPR_2	0.77
PF13511	DUF4124	0.77
PF13531	SBP_bac_11	0.77
PF00487	FA_desaturase	0.77
PF00881	Nitroreductase	0.77
PF02416	TatA_B_E	0.77
PF01244	Peptidase_M19	0.77
PF07366	SnoaL	0.77
PF02515	CoA_transf_3	0.77

COG ID	Name	Functional Category	% Frequency in 130 Family Scaffolds
COG2141	Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)	Coenzyme transport and metabolism [H]	26.92
COG1741	Redox-sensitive bicupin YhaK, pirin superfamily	General function prediction only [R]	6.92
COG1680	CubicO group peptidase, beta-lactamase class C family	Defense mechanisms [V]	1.54
COG1686	D-alanyl-D-alanine carboxypeptidase	Cell wall/membrane/envelope biogenesis [M]	1.54
COG2367	Beta-lactamase class A	Defense mechanisms [V]	1.54
COG0010	Arginase/agmatinase family enzyme	Amino acid transport and metabolism [E]	0.77
COG0499	S-adenosylhomocysteine hydrolase	Coenzyme transport and metabolism [H]	0.77
COG0657	Acetyl esterase/lipase	Lipid transport and metabolism [I]	0.77
COG1398	Fatty-acid desaturase	Lipid transport and metabolism [I]	0.77
COG1804	Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases	Lipid transport and metabolism [I]	0.77
COG1826	Twin-arginine protein secretion pathway components TatA and TatB	Intracellular trafficking, secretion, and vesicular transport [U]	0.77
COG2084	3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase	Lipid transport and metabolism [I]	0.77
COG2337	mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module	Defense mechanisms [V]	0.77
COG2355	Zn-dependent dipeptidase, microsomal dipeptidase homolog	Posttranslational modification, protein turnover, chaperones [O]	0.77
COG3239	Fatty acid desaturase	Lipid transport and metabolism [I]	0.77

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	92.31 %
Unclassified	root	N/A	7.69 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	92.31 %
Unclassified	root	N/A	7.69 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	92.31 %
Unclassified	root	N/A	7.69 %

Name	Rank	Taxonomy	Distribution
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	37.69 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	21.54 %
Unclassified	root	N/A	7.69 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.77 %
Spirochaetes	phylum	All Organisms → cellular organisms → Bacteria → Spirochaetes	0.77 %

Name	Rank	Taxonomy	Distribution
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	37.69 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	11.54 %
Unclassified	root	N/A	7.69 %
Spirochaetia	class	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia	0.77 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.77 %

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	37.69 %
Unclassified	root	N/A	7.69 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	6.92 %
Spirochaetales	order	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales	0.77 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.77 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.77 %

Name	Rank	Taxonomy	Distribution
unclassified Candidatus Rokubacteria	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria	34.62 %
Unclassified	root	N/A	7.69 %
unclassified Rhodospirillales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales	5.38 %
Spirochaetaceae	family	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae	0.77 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	0.77 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.77 %

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	33.85 %
Unclassified	root	N/A	7.69 %
Rhodospirillales bacterium URHD0017	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017	4.62 %
Rhodospirillales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	0.77 %
Alkalispirochaeta	genus	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Alkalispirochaeta	0.77 %
Candidatus Rokubacteria bacterium 13_1_40CM_68_15	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium 13_1_40CM_68_15	0.77 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.77 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.77 %

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	33.85 %
Unclassified	root	N/A	7.69 %
Rhodospirillales bacterium URHD0017	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017	4.62 %
Alkalispirochaeta odontotermitis	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Alkalispirochaeta → Alkalispirochaeta odontotermitis	0.77 %
Bradyrhizobium elkanii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	0.77 %
Rhodospirillales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	0.77 %
Candidatus Rokubacteria bacterium 13_1_40CM_68_15	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium 13_1_40CM_68_15	0.77 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.77 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000364\|INPhiseqgaiiFebDRAFT_100372887	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	718	Open in IMG/M
3300000443\|F12B_10405294	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	989	Open in IMG/M
3300000955\|JGI1027J12803_100962780	All Organisms → cellular organisms → Bacteria	567	Open in IMG/M
3300002560\|JGI25383J37093_10203266	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	521	Open in IMG/M
3300004062\|Ga0055500_10103321	All Organisms → cellular organisms → Bacteria	636	Open in IMG/M
3300005167\|Ga0066672_10727509	All Organisms → cellular organisms → Bacteria → Proteobacteria	633	Open in IMG/M
3300005171\|Ga0066677_10065463	All Organisms → cellular organisms → Bacteria → Proteobacteria	1854	Open in IMG/M
3300005175\|Ga0066673_10818625	All Organisms → cellular organisms → Bacteria	532	Open in IMG/M
3300005180\|Ga0066685_10086024	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	2082	Open in IMG/M
3300005186\|Ga0066676_10942181	All Organisms → cellular organisms → Bacteria	577	Open in IMG/M
3300005332\|Ga0066388_101724001	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017	1110	Open in IMG/M
3300005336\|Ga0070680_100437800	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017	1116	Open in IMG/M
3300005445\|Ga0070708_101111789	All Organisms → cellular organisms → Bacteria	740	Open in IMG/M
3300005450\|Ga0066682_10137970	All Organisms → cellular organisms → Bacteria	1548	Open in IMG/M
3300005451\|Ga0066681_10284032	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1010	Open in IMG/M
3300005459\|Ga0068867_100736600	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	873	Open in IMG/M
3300005468\|Ga0070707_100233662	All Organisms → cellular organisms → Bacteria → Proteobacteria	1789	Open in IMG/M
3300005468\|Ga0070707_101297021	All Organisms → cellular organisms → Bacteria	694	Open in IMG/M
3300005518\|Ga0070699_101730279	All Organisms → cellular organisms → Bacteria	572	Open in IMG/M
3300005545\|Ga0070695_101721335	All Organisms → cellular organisms → Bacteria	525	Open in IMG/M
3300005546\|Ga0070696_100777010	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	787	Open in IMG/M
3300005549\|Ga0070704_101078438	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	729	Open in IMG/M
3300005552\|Ga0066701_10018955	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017	3376	Open in IMG/M
3300005556\|Ga0066707_10306792	All Organisms → cellular organisms → Bacteria → Proteobacteria	1039	Open in IMG/M
3300005564\|Ga0070664_101703257	All Organisms → cellular organisms → Bacteria	597	Open in IMG/M
3300005713\|Ga0066905_101516786	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	611	Open in IMG/M
3300005843\|Ga0068860_100337309	All Organisms → cellular organisms → Bacteria	1482	Open in IMG/M
3300006163\|Ga0070715_10105617	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1320	Open in IMG/M
3300006755\|Ga0079222_11714330	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	603	Open in IMG/M
3300006845\|Ga0075421_101911151	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	635	Open in IMG/M
3300006845\|Ga0075421_102133148	All Organisms → cellular organisms → Bacteria	593	Open in IMG/M
3300006852\|Ga0075433_10035309	All Organisms → cellular organisms → Bacteria → Proteobacteria	4298	Open in IMG/M
3300006854\|Ga0075425_101981304	All Organisms → cellular organisms → Bacteria	651	Open in IMG/M
3300006854\|Ga0075425_101992182	All Organisms → cellular organisms → Bacteria	649	Open in IMG/M
3300006871\|Ga0075434_100287930	All Organisms → cellular organisms → Bacteria	1663	Open in IMG/M
3300006871\|Ga0075434_101786211	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	622	Open in IMG/M
3300006880\|Ga0075429_100052516	All Organisms → cellular organisms → Bacteria	3547	Open in IMG/M
3300006880\|Ga0075429_100060233	All Organisms → cellular organisms → Bacteria → Proteobacteria	3307	Open in IMG/M
3300006880\|Ga0075429_101834268	All Organisms → cellular organisms → Bacteria → Proteobacteria	526	Open in IMG/M
3300006894\|Ga0079215_10644169	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017	702	Open in IMG/M
3300006894\|Ga0079215_11166091	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	583	Open in IMG/M
3300006914\|Ga0075436_100075294	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	2337	Open in IMG/M
3300007004\|Ga0079218_12924755	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	574	Open in IMG/M
3300007076\|Ga0075435_100016431	All Organisms → cellular organisms → Bacteria → Proteobacteria	5580	Open in IMG/M
3300007076\|Ga0075435_101621422	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017	568	Open in IMG/M
3300007265\|Ga0099794_10324751	All Organisms → cellular organisms → Bacteria	799	Open in IMG/M
3300009038\|Ga0099829_10418848	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1108	Open in IMG/M
3300009078\|Ga0105106_10847828	All Organisms → cellular organisms → Bacteria	651	Open in IMG/M
3300009098\|Ga0105245_10313150	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1544	Open in IMG/M
3300009137\|Ga0066709_102203490	All Organisms → cellular organisms → Bacteria → Proteobacteria	760	Open in IMG/M
3300009143\|Ga0099792_10865322	Not Available	596	Open in IMG/M
3300009162\|Ga0075423_12903832	All Organisms → cellular organisms → Bacteria	525	Open in IMG/M
3300009176\|Ga0105242_11330692	All Organisms → cellular organisms → Bacteria	743	Open in IMG/M
3300010043\|Ga0126380_12198730	All Organisms → cellular organisms → Bacteria	510	Open in IMG/M
3300010303\|Ga0134082_10032526	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii	1962	Open in IMG/M
3300010303\|Ga0134082_10074448	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1324	Open in IMG/M
3300010329\|Ga0134111_10025148	All Organisms → cellular organisms → Bacteria	2038	Open in IMG/M
3300010336\|Ga0134071_10112490	All Organisms → cellular organisms → Bacteria	1302	Open in IMG/M
3300010337\|Ga0134062_10016460	All Organisms → cellular organisms → Bacteria	2780	Open in IMG/M
3300010361\|Ga0126378_10615165	All Organisms → cellular organisms → Bacteria	1200	Open in IMG/M
3300010361\|Ga0126378_12575327	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	581	Open in IMG/M
3300010362\|Ga0126377_11867137	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	676	Open in IMG/M
3300010362\|Ga0126377_12592342	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	582	Open in IMG/M
3300010366\|Ga0126379_10589829	All Organisms → cellular organisms → Bacteria	1195	Open in IMG/M
3300010376\|Ga0126381_101286084	All Organisms → cellular organisms → Bacteria	1057	Open in IMG/M
3300010391\|Ga0136847_13490280	Not Available	506	Open in IMG/M
3300010397\|Ga0134124_10145710	All Organisms → cellular organisms → Bacteria	2107	Open in IMG/M
3300010399\|Ga0134127_10231625	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	1738	Open in IMG/M
3300011271\|Ga0137393_10510379	Not Available	1031	Open in IMG/M
3300012189\|Ga0137388_11160720	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	709	Open in IMG/M
3300012210\|Ga0137378_10546053	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1067	Open in IMG/M
3300012349\|Ga0137387_10490519	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	892	Open in IMG/M
3300012350\|Ga0137372_10030817	All Organisms → cellular organisms → Bacteria	4914	Open in IMG/M
3300012353\|Ga0137367_11012210	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	566	Open in IMG/M
3300012355\|Ga0137369_11064232	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium 13_1_40CM_68_15	531	Open in IMG/M
3300012361\|Ga0137360_10586487	All Organisms → cellular organisms → Bacteria → Proteobacteria	954	Open in IMG/M
3300012582\|Ga0137358_10291823	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1108	Open in IMG/M
3300012917\|Ga0137395_10201578	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1385	Open in IMG/M
3300012929\|Ga0137404_10475155	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1112	Open in IMG/M
3300012929\|Ga0137404_10811394	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	850	Open in IMG/M
3300012930\|Ga0137407_10160951	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1991	Open in IMG/M
3300012930\|Ga0137407_10514693	All Organisms → cellular organisms → Bacteria	1118	Open in IMG/M
3300012944\|Ga0137410_10787499	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	798	Open in IMG/M
3300012955\|Ga0164298_10145474	All Organisms → cellular organisms → Bacteria	1324	Open in IMG/M
3300012971\|Ga0126369_10919576	All Organisms → cellular organisms → Bacteria	961	Open in IMG/M
3300012972\|Ga0134077_10082828	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	1224	Open in IMG/M
3300012975\|Ga0134110_10268784	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	730	Open in IMG/M
3300012976\|Ga0134076_10099195	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1153	Open in IMG/M
3300015374\|Ga0132255_103617861	All Organisms → cellular organisms → Bacteria	657	Open in IMG/M
3300016371\|Ga0182034_10847296	Not Available	784	Open in IMG/M
3300016387\|Ga0182040_11366741	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	599	Open in IMG/M
3300017657\|Ga0134074_1251800	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	636	Open in IMG/M
3300018064\|Ga0187773_10742347	Not Available	617	Open in IMG/M
3300018433\|Ga0066667_10037956	All Organisms → cellular organisms → Bacteria	2787	Open in IMG/M
3300018433\|Ga0066667_10089937	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	2008	Open in IMG/M
3300018433\|Ga0066667_11961100	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	536	Open in IMG/M
3300019882\|Ga0193713_1007946	All Organisms → cellular organisms → Bacteria	3266	Open in IMG/M
3300019889\|Ga0193743_1169911	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	727	Open in IMG/M
3300020004\|Ga0193755_1030340	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1789	Open in IMG/M
3300021090\|Ga0210377_10437650	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	768	Open in IMG/M
3300025551\|Ga0210131_1055098	All Organisms → cellular organisms → Bacteria	650	Open in IMG/M
3300025917\|Ga0207660_11229332	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	609	Open in IMG/M
3300025922\|Ga0207646_10293833	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1468	Open in IMG/M
3300025922\|Ga0207646_11439846	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	598	Open in IMG/M
3300025938\|Ga0207704_10834260	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	772	Open in IMG/M
3300025986\|Ga0207658_10809430	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	851	Open in IMG/M
3300026089\|Ga0207648_10775080	All Organisms → cellular organisms → Bacteria	892	Open in IMG/M
3300026142\|Ga0207698_11041600	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017	830	Open in IMG/M
3300026482\|Ga0257172_1045020	Not Available	806	Open in IMG/M
3300026494\|Ga0257159_1001213	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	3325	Open in IMG/M
3300026540\|Ga0209376_1146400	All Organisms → cellular organisms → Bacteria → Proteobacteria	1138	Open in IMG/M
3300027882\|Ga0209590_10221404	Not Available	1201	Open in IMG/M
3300027882\|Ga0209590_10673660	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	663	Open in IMG/M
3300028381\|Ga0268264_10145305	All Organisms → cellular organisms → Bacteria → Proteobacteria	2120	Open in IMG/M
3300028381\|Ga0268264_10147049	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	2109	Open in IMG/M
3300028673\|Ga0257175_1037862	All Organisms → cellular organisms → Bacteria	857	Open in IMG/M
3300031547\|Ga0310887_10094851	All Organisms → cellular organisms → Bacteria	1464	Open in IMG/M
3300031679\|Ga0318561_10082000	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	1671	Open in IMG/M
3300031852\|Ga0307410_10546348	Not Available	960	Open in IMG/M
3300031949\|Ga0214473_10438187	Not Available	1469	Open in IMG/M
3300031995\|Ga0307409_100283389	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Alkalispirochaeta → Alkalispirochaeta odontotermitis	1533	Open in IMG/M
3300032010\|Ga0318569_10309631	All Organisms → cellular organisms → Bacteria	735	Open in IMG/M
3300032013\|Ga0310906_10673901	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	720	Open in IMG/M
3300032180\|Ga0307471_102713312	All Organisms → cellular organisms → Bacteria	628	Open in IMG/M
3300032180\|Ga0307471_103299216	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	572	Open in IMG/M
3300032205\|Ga0307472_100131370	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1792	Open in IMG/M
3300032205\|Ga0307472_102775679	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	501	Open in IMG/M
3300032770\|Ga0335085_10057920	All Organisms → cellular organisms → Bacteria → Proteobacteria	5193	Open in IMG/M
3300033502\|Ga0326731_1042092	Not Available	1079	Open in IMG/M
3300034056\|Ga0373893_045778	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	593	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	77.69%
Host-Associated	Host-Associated	21.54%
Engineered	Engineered	0.77%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	73.85%
Plants	Host-Associated → Plants	21.54%
Aquatic	Environmental → Aquatic	3.85%
Bioremediation	Engineered → Bioremediation	0.77%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	73.08%
Rhizosphere	Host-Associated → Plants → Rhizosphere	15.38%
Rhizoplane	Host-Associated → Plants → Rhizoplane	6.15%
Freshwater	Environmental → Aquatic → Freshwater	2.31%
Marine	Environmental → Aquatic → Marine	1.54%
Peat	Environmental → Terrestrial → Peat	0.77%
Metal	Engineered → Bioremediation → Metal	0.77%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	58.46%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	13.85%
Loam	Environmental → Terrestrial → Soil → Loam	13.08%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	5.38%
Sediment	Environmental → Aquatic → Freshwater → Sediment	1.54%
Wetlands	Environmental → Aquatic → Marine → Wetlands	1.54%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	1.54%
Soil	Host-Associated → Plants → Rhizosphere → Soil	1.54%
Lake	Environmental → Aquatic → Freshwater → Lake	0.77%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	0.77%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	0.77%
Unclassified	Engineered → Bioremediation → Metal → Unclassified	0.77%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	33.08%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	13.85%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	11.54%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	9.23%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	8.46%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	5.38%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	3.08%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	2.31%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	1.54%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	1.54%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	1.54%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	1.54%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	1.54%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	1.54%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	0.77%
Uranium Contaminated	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated	0.77%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	0.77%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	0.77%
Unclassified	Engineered → Bioremediation → Metal → Unclassified → Unclassified	0.77%

Habitat	Taxonomy	Distribution
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	15.38%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	10.77%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	7.69%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	7.69%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	6.92%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	6.15%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	3.85%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	3.85%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	3.08%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	3.08%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	3.08%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	2.31%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	2.31%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	2.31%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	1.54%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.54%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	1.54%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	1.54%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	1.54%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	1.54%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	1.54%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.54%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	0.77%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	0.77%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment	0.77%
Soil	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil	0.77%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	0.77%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	0.77%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	0.77%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.77%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.77%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.77%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.77%
Sediment Slurry	Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry	0.77%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000443	Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemly	Environmental	Open in IMG/M
3300000955	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300002560	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm	Environmental	Open in IMG/M
3300004062	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D2	Environmental	Open in IMG/M
3300005167	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121	Environmental	Open in IMG/M
3300005171	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126	Environmental	Open in IMG/M
3300005175	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122	Environmental	Open in IMG/M
3300005180	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134	Environmental	Open in IMG/M
3300005186	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Environmental	Open in IMG/M
3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Environmental	Open in IMG/M
3300005450	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131	Environmental	Open in IMG/M
3300005451	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130	Environmental	Open in IMG/M
3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Host-Associated	Open in IMG/M
3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Environmental	Open in IMG/M
3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Environmental	Open in IMG/M
3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Environmental	Open in IMG/M
3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Environmental	Open in IMG/M
3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Environmental	Open in IMG/M
3300005552	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150	Environmental	Open in IMG/M
3300005556	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156	Environmental	Open in IMG/M
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated	Open in IMG/M
3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Environmental	Open in IMG/M
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental	Open in IMG/M
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006880	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Host-Associated	Open in IMG/M
3300006894	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control	Environmental	Open in IMG/M
3300006914	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Host-Associated	Open in IMG/M
3300007004	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost	Environmental	Open in IMG/M
3300007076	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Host-Associated	Open in IMG/M
3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Environmental	Open in IMG/M
3300009038	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG	Environmental	Open in IMG/M
3300009078	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015	Environmental	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009143	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2	Environmental	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated	Open in IMG/M
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental	Open in IMG/M
3300010303	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015	Environmental	Open in IMG/M
3300010329	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015	Environmental	Open in IMG/M
3300010336	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015	Environmental	Open in IMG/M
3300010337	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015	Environmental	Open in IMG/M
3300010361	Tropical forest soil microbial communities from Panama - MetaG Plot_23	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental	Open in IMG/M
3300010391	Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406	Environmental	Open in IMG/M
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300011271	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG	Environmental	Open in IMG/M
3300012189	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG	Environmental	Open in IMG/M
3300012210	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG	Environmental	Open in IMG/M
3300012349	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG	Environmental	Open in IMG/M
3300012350	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG	Environmental	Open in IMG/M
3300012353	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG	Environmental	Open in IMG/M
3300012355	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG	Environmental	Open in IMG/M
3300012361	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG	Environmental	Open in IMG/M
3300012582	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG	Environmental	Open in IMG/M
3300012917	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG	Environmental	Open in IMG/M
3300012929	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012930	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012944	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012955	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300012972	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG	Environmental	Open in IMG/M
3300012975	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015	Environmental	Open in IMG/M
3300012976	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG	Environmental	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300016371	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172	Environmental	Open in IMG/M
3300016387	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176	Environmental	Open in IMG/M
3300017657	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015	Environmental	Open in IMG/M
3300018064	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG	Environmental	Open in IMG/M
3300018433	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116	Environmental	Open in IMG/M
3300019882	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2	Environmental	Open in IMG/M
3300019889	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c2	Environmental	Open in IMG/M
3300020004	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2	Environmental	Open in IMG/M
3300021090	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo	Environmental	Open in IMG/M
3300025551	Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 (SPAdes)	Environmental	Open in IMG/M
3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026482	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B	Environmental	Open in IMG/M
3300026494	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-A	Environmental	Open in IMG/M
3300026540	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes)	Environmental	Open in IMG/M
3300027882	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028673	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B	Environmental	Open in IMG/M
3300031547	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4	Environmental	Open in IMG/M
3300031679	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23	Environmental	Open in IMG/M
3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Host-Associated	Open in IMG/M
3300031949	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197	Environmental	Open in IMG/M
3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Host-Associated	Open in IMG/M
3300032010	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22	Environmental	Open in IMG/M
3300032013	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental	Open in IMG/M
3300032770	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5	Environmental	Open in IMG/M
3300033502	Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF9FY SIP fraction	Environmental	Open in IMG/M
3300034056	Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A3A4.3	Engineered	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
INPhiseqgaiiFebDRAFT_1003728872	3300000364	Soil	PIWENGFIRAYGPRVEEAGLKLIPSFPYSGPPEDLRLKPSAR*
F12B_104052942	3300000443	Soil	FAPIWENGFIRAVGPRMQEAALTLIPAYPYAAPYEDIRLKP*
JGI1027J12803_1009627802	3300000955	Soil	FIRAYGPRVEEAGLTLIQSFPYSAPLEDVRLKKQ*
JGI25383J37093_102032662	3300002560	Grasslands Soil	NGFIRAYGPRVEESGLTLIPAFPYSGPLEDVRLKKQAAAR*
Ga0055500_101033211	3300004062	Natural And Restored Wetlands	ERVMFAPIWENGFIRAYGPRLEEAALNLIPSFPYAGPLEDLRLKAR*
Ga0066672_107275092	3300005167	Soil	FAPIWENGFIRAYGPRLEEAGLKLIPSFPYSAPLEDLRLKPSAR*
Ga0066677_100654634	3300005171	Soil	IWENGFIRAYGPRLEEAGLKLIPSFPYSAPLEDLRLKPSAR*
Ga0066673_108186251	3300005175	Soil	VFAPIWENGFIRGVSAKLEEPALTLIPAFPYVAPFEELRLKK*
Ga0066685_100860242	3300005180	Soil	MFVPIWENGFIRAYGSRVEEPGRTLIPAFPDSGPLEDVRLKK*
Ga0066676_109421812	3300005186	Soil	PIWENGFIRGVGSRAEEPALTLIPAFPYSAPFEDLRLKK*
Ga0066388_1017240012	3300005332	Tropical Forest Soil	MYVAPIWENGFIRAFGPRMEEAGLQLIQSFPYAAPLEELRLKKQ*
Ga0070680_1004378002	3300005336	Corn Rhizosphere	FAPIWENGFIRAYGPRMEEAALNLIPSFPYAGPPEDLKLKAK*
Ga0070708_1011117892	3300005445	Corn, Switchgrass And Miscanthus Rhizosphere	RVIFAPIWENGFIRAYGPRMEEAALSLIPAFPYAGPLEELRLKGR*
Ga0066682_101379703	3300005450	Soil	VVFAPIWENGFIRAYGPRLEEAGLKLIPSFPYSAPLEDLRLKTSAR*
Ga0066681_102840321	3300005451	Soil	FAPIWENGFIRAFGPRLEEAALNLIPSFPYVGPLEDLKLKKP*
Ga0068867_1007366002	3300005459	Miscanthus Rhizosphere	FAPIWENGFIRAYGPRMEEAALSLIPSFPYAGPLEDLRLKAR*
Ga0070707_1002336623	3300005468	Corn, Switchgrass And Miscanthus Rhizosphere	QERVVFAPIWENGFIRAYGPRMEEAALNLIPSFPYAGPLEELRLKAR*
Ga0070707_1012970212	3300005468	Corn, Switchgrass And Miscanthus Rhizosphere	RIVQERVVFAPIWENGFIRAYGPRMEEAALNLIPSFPYAGPLEELRLKAR*
Ga0070699_1017302792	3300005518	Corn, Switchgrass And Miscanthus Rhizosphere	FAPIWENGFIRAYGPRMEEAALNLIPSFPYAGPLEELRLKAR*
Ga0070695_1017213351	3300005545	Corn, Switchgrass And Miscanthus Rhizosphere	VFAPIWENGFIRAYGPRLEEAALNLIPSFPYAGPLEELRLKAR*
Ga0070696_1007770101	3300005546	Corn, Switchgrass And Miscanthus Rhizosphere	ENGFIRAYGPRVEEAGLKLIPSFPYSGPLEDLRLKPSAR*
Ga0070704_1010784382	3300005549	Corn, Switchgrass And Miscanthus Rhizosphere	VIFAPIWENGFIRAYGPRMEEAALSLIPAFPYAGPLEELRLKGR*
Ga0066701_100189557	3300005552	Soil	FIRGVGPKVDEPGLTLIPAYPYSAPYEDVRLKQQ*
Ga0066707_103067921	3300005556	Soil	PIWENGFIRAYGPRLEEAGLKLIPSFPYSAPLEDLRLKPSAR*
Ga0070664_1017032571	3300005564	Corn Rhizosphere	ALFAPVWENGFIRAYGPRMEEAALSLIPAFPYAAPLEELRVKGK*
Ga0066905_1015167861	3300005713	Tropical Forest Soil	PIWENGFIRAFGPRMEEAGLQLIQSFPYAAPLEELRLKKQ*
Ga0068860_1003373091	3300005843	Switchgrass Rhizosphere	PIWENGFIRAYGQRVEEPGLTLLPAFPYSGPLEDVRLKK*
Ga0070715_101056172	3300006163	Corn, Switchgrass And Miscanthus Rhizosphere	NGFIRGVGPRVEEPALSLIPSFPYSAPYEDVRLKP*
Ga0079222_117143302	3300006755	Agricultural Soil	GFIRAYGPRMEEAALSLIPAFPYAAPLEELRVKGK*
Ga0075421_1019111512	3300006845	Populus Rhizosphere	APVWENGFIRAYGPRMEEAALSLIPAFPYAAPLEELRVKGK*
Ga0075421_1021331482	3300006845	Populus Rhizosphere	ELAFLVGVGPRVEEPALGLIDHFPTPAPWEDVRLKRQ*
Ga0075433_100353091	3300006852	Populus Rhizosphere	VWENGFIRAYGPRMEEAALSLIPAFPYAGPLEELRVKGK*
Ga0075425_1019813041	3300006854	Populus Rhizosphere	IQRVVQERALFAPVWENGFIRAYGPRMEEAALSLIPAFPYAAPLEELRVKGK*
Ga0075425_1019921821	3300006854	Populus Rhizosphere	IQRVVQERALFAPVWENGFIRAYGPRMEEAALSLIPAFPYAGPLEELRVKGK*
Ga0075434_1002879303	3300006871	Populus Rhizosphere	RVVFAPIWENGFIRAFGPRVEEAGLTLIPAFPYSGPLEELRLKR*
Ga0075434_1017862111	3300006871	Populus Rhizosphere	ENGFIRAYGPRVEEPGLTLIPAFPYSGPLEDVRLKK*
Ga0075429_1000525161	3300006880	Populus Rhizosphere	IADRMMFVPIWENGFIRAYGPRLEEPALTLIPAFPYSGPPEDVRLRK*
Ga0075429_1000602331	3300006880	Populus Rhizosphere	VVFAPIWENGFIRAYGPRLDEAGLKLIPSFPYSGPLEDLRLKPSAR*
Ga0075429_1018342681	3300006880	Populus Rhizosphere	IWENGFIRAYGPRVEEAGLSLIQAFPYSGPLEDVKLKKP*
Ga0079215_106441691	3300006894	Agricultural Soil	IFAPIWENGFIRGVGSRLEEPALALVPAFPYVAPYEELRLKK*
Ga0079215_111660911	3300006894	Agricultural Soil	PIWENGFIRASGPRAEEPGLTLIPAFPYAAPAEDLRVKRP*
Ga0075436_1000752941	3300006914	Populus Rhizosphere	ENGFIRAYGPRMEEAALNLIPSFPYAGPLEELRLKGR*
Ga0079218_129247552	3300007004	Agricultural Soil	IWENALIRGVGPRVEEGGLSLIPSFPYSAPAEELRLKSR*
Ga0075435_1000164314	3300007076	Populus Rhizosphere	QRVVQERALFAPVWENGFIRAYGPRMEEAALSLIPAFPYAAPLEELRVKGK*
Ga0075435_1016214222	3300007076	Populus Rhizosphere	WENGFIRAFGPRMEEAGLNLIQSFPYAGPLEDLKLKKQ*
Ga0099794_103247512	3300007265	Vadose Zone Soil	ENGFIRAYGPRVEESGLQLIPSFPYSGPLEDVRLKR*
Ga0099829_104188482	3300009038	Vadose Zone Soil	VKHIFAPIWENGFIRAFGPRVEKAGLTLIPAFPYSGPLEDVRLKK*
Ga0105106_108478281	3300009078	Freshwater Sediment	RGLIRGVGPRVEEPALALIPAFPYSAPYEDVRLKP*
Ga0105245_103131503	3300009098	Miscanthus Rhizosphere	APIWENGFIRAYGPRMEEAALSLIPSFPYAGPLEDLRLKAR*
Ga0066709_1022034902	3300009137	Grasslands Soil	FAPIWENGFIRAFGPRVEEAGLTLIPAFPYSAPLEDLRLKPSAR*
Ga0099792_108653221	3300009143	Vadose Zone Soil	GFIRAFGPRVEESGLTLIQSFPYSAPLEDVRLKKQ*
Ga0075423_129038321	3300009162	Populus Rhizosphere	MLADQVVFAPIWENGFIRAYGPRVEEAGLKLIPSFPYSGPVEDLRLKPSAR*
Ga0105242_113306922	3300009176	Miscanthus Rhizosphere	GFIRGVGPRVEEPALTLIPSFPYSAPYEDVRLKP*
Ga0126380_121987301	3300010043	Tropical Forest Soil	ERVMFAPIWENGFIRAFGPRMEEAGMTLIPAFPYSGPLEELRLKR*
Ga0134082_100325263	3300010303	Grasslands Soil	FIRASGPRVEESGLTLIPAFPYSGPLEDVRLKKEAGPR*
Ga0134082_100744481	3300010303	Grasslands Soil	GFIRAFGPRVEEAGLTLIPAFPYSAPLEDLRLKPSAR*
Ga0134111_100251481	3300010329	Grasslands Soil	FLRGVGPRVEEPGLTLIPSYPYSAPYEDIRLKRR*
Ga0134071_101124904	3300010336	Grasslands Soil	GFIRGVGPKVEEPALTLIPSYPYSAPYEDVRLKPR*
Ga0134062_100164601	3300010337	Grasslands Soil	LADHVVFAPIWENGFIRAYGPRLEEAGLKLIPSFPYSAPLEDLRLKPSAR*
Ga0126378_106151652	3300010361	Tropical Forest Soil	ENGFIRGVGPRVEEPALSMIPAFPYSAPFEDLRLKK*
Ga0126378_125753272	3300010361	Tropical Forest Soil	WENGFIRAYGPRLEEPGLTLIPAFPYSGPLEDVRLKK*
Ga0126377_118671372	3300010362	Tropical Forest Soil	QERVMFAPIWENGFIRAFGPRMEEAGMTLIPAFPYSGPLEELRLKR*
Ga0126377_125923422	3300010362	Tropical Forest Soil	ENGFIRAAGPRVEEPALSLIPAFPYAAPLEDLRLKK*
Ga0126379_105898291	3300010366	Tropical Forest Soil	ENGFIRGVGPKVEEPALTLIPAYPYSAPYEDVRLKRQ*
Ga0126381_1012860841	3300010376	Tropical Forest Soil	GFIRGVGPRVQEGSLELIPAFPYSAPMEDVRLKP*
Ga0136847_134902801	3300010391	Freshwater Sediment	IWENGFIRGVGPRVEEAALTLIPAFPYAAPYEELRLRRQTP*
Ga0134124_101457103	3300010397	Terrestrial Soil	ENGFIRAFGPRLEEAALNLIPSFPYAGPLEDLKLKKP*
Ga0134127_102316251	3300010399	Terrestrial Soil	APIWENGFIRAYGPRMEEAALNLIPSFPYAGPPEDLKLKAK*
Ga0137393_105103791	3300011271	Vadose Zone Soil	NGFIRAFGPRVEESGLTLIQSFPYSAPLEDVRLKKQ*
Ga0137388_111607201	3300012189	Vadose Zone Soil	QERMVFAPIWENGFIRAYGPRMEEAALNLIPSFPYAGPLEELRLKAK*
Ga0137378_105460531	3300012210	Vadose Zone Soil	IWENGFIRAYGPRVEEPGLTLLPAFPYSGPLEDVRLKK*
Ga0137387_104905192	3300012349	Vadose Zone Soil	NGFIRGVHARAEEPALTLIPAFPYAAPYEELRVKK*
Ga0137372_100308171	3300012350	Vadose Zone Soil	PIWENGFIRGVGSRAEEPALSLIPSFPYSAPFEDLRLKK*
Ga0137367_110122102	3300012353	Vadose Zone Soil	AIQERVIFAPIWENGFIRAYGPRMEEAALNLIPSFPYAGPLEDLRLKAR*
Ga0137369_110642321	3300012355	Vadose Zone Soil	FLWGVGPRVGEPGADLIQAYPYSAPYEDVRLKKP*
Ga0137360_105864872	3300012361	Vadose Zone Soil	VIFAPIWENGFIRAFGPRVEEAGLTLIPAFPYSAPLEDLRLKASAR*
Ga0137358_102918232	3300012582	Vadose Zone Soil	VVFAPIWENGFIRAYGPRLEEAALNLIPSYPYAGPLEELRLKAR*
Ga0137395_102015782	3300012917	Vadose Zone Soil	WENGFIRAYGPRVEEPGLTLLPAFPYSGPLEDVRLKK*
Ga0137404_104751552	3300012929	Vadose Zone Soil	FAPIWENGFIRAYGPRMEEAALNLIPSFPYAGPLEDLRLKAR*
Ga0137404_108113942	3300012929	Vadose Zone Soil	ENGFIRAYGPRVEEPGLTLLPAFPYSGPLEDVRLKK*
Ga0137407_101609511	3300012930	Vadose Zone Soil	VFAPIWENGFIRAYGPRVEEAGLALIPAFPYSGPLEDLRLKAR*
Ga0137407_105146931	3300012930	Vadose Zone Soil	FIRGVGPKVEEPALTLIPSFPYSAPYEDVRLKRP*
Ga0137410_107874991	3300012944	Vadose Zone Soil	ERVMFAPIWENGFIRAYGPRMEEAALSLIPSFPYAGPLEDLRLKAR*
Ga0164298_101454742	3300012955	Soil	ENGFIRGVGPRAEEPALALIPSYPYSAPYEDVRLKP*
Ga0126369_109195762	3300012971	Tropical Forest Soil	VMFAPIWENGFIRAFGPRMEEAGMTLIPAFPYSGPLEELRLKR*
Ga0134077_100828281	3300012972	Grasslands Soil	FIRAYGPRVEESGLTLIPAFPYSGPLEDVRLKKQAAAR*
Ga0134110_102687842	3300012975	Grasslands Soil	ENGFIRGVGPRAEEPALTLIPSYPYSAPYEDLRLK*
Ga0134076_100991952	3300012976	Grasslands Soil	ENGFIRAYGPRMEEAGLKLIPAFPYSAPLEDLKLKPAAR*
Ga0132255_1036178612	3300015374	Arabidopsis Rhizosphere	GFIRGVGPRVEEPALSLIPSFPYSAPYEDVKLKP*
Ga0182034_108472962	3300016371	Soil	ENGFIRGVGPRVEEPGLALIPFYPYSAPYEELRLKP
Ga0182040_113667411	3300016387	Soil	IWENGFIRGAGARVEEPALTLIPAYPYSAPYEEVRLKRQ
Ga0134074_12518001	3300017657	Grasslands Soil	ENGFIRGVGPRMQEAALTLIPAFPYSAPYEDVRLKP
Ga0187773_107423472	3300018064	Tropical Peatland	WENGFIRGVGPRVAEPALALIPAFPYSAPSEALRLKPADPPAR
Ga0066667_100379563	3300018433	Grasslands Soil	VFAPIWENGFIRAFGARVEEPGLTLIPSYPYSAAYEDIRLKRR
Ga0066667_100899372	3300018433	Grasslands Soil	IWENGFIRAYGSRVEEPGPTLIPASPYSGPLEDVRLKK
Ga0066667_119611001	3300018433	Grasslands Soil	NGFIRAYGPRVEEPGLTLIPAFPYSGPLEDVRLKK
Ga0193713_10079461	3300019882	Soil	WENGFIRAYGPRMEEAALSLIPSFPYAGPLEDLRLKAR
Ga0193743_11699111	3300019889	Soil	LIQERMVFAPIWENGFIRAYGPRLEEAALNLIPSFPYAGPLEDLKLRR
Ga0193755_10303401	3300020004	Soil	WENGFIRGVGPRVDEPALALIPYFPYSASYEELRLKP
Ga0210377_104376501	3300021090	Groundwater Sediment	NGFIRAFGPRVEEAGLKLIPAFPYSAPLEELRLKR
Ga0210131_10550981	3300025551	Natural And Restored Wetlands	AEFIRGVGPRVEEPALALIPAFPYSAPYEDVRLKP
Ga0207660_112293321	3300025917	Corn Rhizosphere	IWENGFIRAYGPRMEEAALNLIPSFPYAGPPEDLKLKAK
Ga0207646_102938333	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	VFAPIWENGFIRAYGPRMEEAALNLIPSFPYAGPLEELRLKAR
Ga0207646_114398461	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	IWENGFIRAFGPRVEEAGLKLIPSFPYSGPLEDLRLKPSAR
Ga0207704_108342601	3300025938	Miscanthus Rhizosphere	IWENGFIRAYGPRMEEAALSLIPSFPYAGPLEDLRLKAR
Ga0207658_108094302	3300025986	Switchgrass Rhizosphere	NGFIRAYGPRMEEAALSLIPAFPYAGPLEELRVKGK
Ga0207648_107750802	3300026089	Miscanthus Rhizosphere	WENGFIRGVGSRVEEPGLSLIPAFPYSAPLEDLRLKK
Ga0207698_110416001	3300026142	Corn Rhizosphere	NGFIRAFGPRVEEAGLTLIPAFPYSGPLEELRLKR
Ga0257172_10450202	3300026482	Soil	NGFIRAFGPRVEESGLTLIQSFPYSAPLEDVRLKKQ
Ga0257159_10012133	3300026494	Soil	RIVQERMVFAPIWENGFIRAYGPRMEEAALNLIPSFPYAGPLEELRLKAK
Ga0209376_11464002	3300026540	Soil	FAPIWENGFIRAYGPRLEEAGLKLIPSFPYSAPLEDLRLKPSAR
Ga0209590_102214041	3300027882	Vadose Zone Soil	IWENEFIRAFGPRVEESGLTLIQSFPYSAPLEDVRLKKQ
Ga0209590_106736602	3300027882	Vadose Zone Soil	NGFIRGVGPRVEEPALTLIPAFGYSAPYEDLRLKRP
Ga0268264_101453053	3300028381	Switchgrass Rhizosphere	FAGIWENGFIRAFGPRVEEAGLTLIPAFPYSGPLEDVRLKK
Ga0268264_101470492	3300028381	Switchgrass Rhizosphere	RAMFVPIWENGFIRAYGQRVEEPGLTLLPAFPYSGPLEDVRLKK
Ga0257175_10378622	3300028673	Soil	NGFIRGVGPRVEEPALALIPAFPYSAPYEDVRLKP
Ga0310887_100948511	3300031547	Soil	VPIWENGFIRAYGPRLEEPGLTLLPAFPYSGPLEDVRLKRGS
Ga0318561_100820003	3300031679	Soil	IWENGFIRGVGPRIEEPGLALIPFYPYSAPYEELRLKP
Ga0307410_105463481	3300031852	Rhizosphere	VWENGFIRAYGPRMEEPGLTLIQSFPYSAPLEDIRLKPR
Ga0214473_104381874	3300031949	Soil	AIIRGVGPRVEEGGLTLIPSYPYSAPAEELKLKRP
Ga0307409_1002833891	3300031995	Rhizosphere	ENGFIRAYGPRVEEAGLALIQAFPYSGPLEDVRLKKP
Ga0318569_103096312	3300032010	Soil	ENGFIRAFGPRMEEAGMTLIPAFPYAGPLEELRLKR
Ga0310906_106739011	3300032013	Soil	IWENGFIRAYGPRMEEAGLQLIQSFPYTAPLEDLRLKKQ
Ga0307471_1027133121	3300032180	Hardwood Forest Soil	ENGFIRGVGPRVEEPALALIPYFPYSAPYEELRLKP
Ga0307471_1032992162	3300032180	Hardwood Forest Soil	IVQERVIFAPIWENGFIRAYGPRMEEAALSLIPAFPYAGPLEELRLKGR
Ga0307472_1001313703	3300032205	Hardwood Forest Soil	RLVQERVVFAPIWENGFIRAFGPRMEQAGLNLIPSFPYAGPPEELRLKSL
Ga0307472_1027756791	3300032205	Hardwood Forest Soil	IWENGFIRGVAARAEEPALTLIPAFPYAAPYEELRVKK
Ga0335085_100579207	3300032770	Soil	APIWENGFIRAYGPRMVEAGLKLIPAFPYSAPLEELRLKP
Ga0326731_10420922	3300033502	Peat Soil	IWENGFIRGVGPRAEEPALSLIPAFPYAAPFEDLRLKR
Ga0373893_045778_338_448	3300034056	Sediment Slurry	MRAHPGVGARVEEAALTLIPSYPYSAPYEELRLKAR

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F063132

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences