NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F063268

Metagenome / Metatranscriptome Family F063268

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F063268
Family Type Metagenome / Metatranscriptome
Number of Sequences 129
Average Sequence Length 62 residues
Representative Sequence DGPRVLAAYRDPVDPGQLAVCERLRWLHLTVWYNLYAERLPELGPRAAELLASWPAG
Number of Associated Samples 117
Number of Associated Scaffolds 129

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 93.80 %
% of genes from short scaffolds (< 2000 bps) 89.92 %
Associated GOLD sequencing projects 114
AlphaFold2 3D model prediction Yes
3D model pTM-score0.56

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.124 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(31.008 % of family members)
Environment Ontology (ENVO) Unclassified
(21.705 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(51.163 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 50.59%    β-sheet: 0.00%    Coil/Unstructured: 49.41%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.56
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 129 Family Scaffolds
PF03640Lipoprotein_15 18.60
PF01243Putative_PNPOx 9.30
PF01988VIT1 6.98
PF04116FA_hydroxylase 3.88
PF01844HNH 3.88
PF07883Cupin_2 3.10
PF02720DUF222 2.33
PF01177Asp_Glu_race 1.55
PF08279HTH_11 1.55
PF05345He_PIG 1.55
PF04205FMN_bind 1.55
PF01557FAA_hydrolase 0.78
PF13085Fer2_3 0.78
PF09298FAA_hydrolase_N 0.78
PF02311AraC_binding 0.78
PF13559DUF4129 0.78
PF00392GntR 0.78
PF04193PQ-loop 0.78
PF00005ABC_tran 0.78
PF00239Resolvase 0.78
PF16859TetR_C_11 0.78
PF00694Aconitase_C 0.78
PF00069Pkinase 0.78
PF02687FtsX 0.78
PF02353CMAS 0.78
PF13419HAD_2 0.78

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 129 Family Scaffolds
COG4315Predicted lipoprotein with conserved Yx(FWY)xxD motif (function unknown)Function unknown [S] 18.60
COG1633Rubrerythrin, includes spore coat protein YhjRInorganic ion transport and metabolism [P] 6.98
COG1814Predicted Fe2+/Mn2+ transporter, VIT1/CCC1 familyInorganic ion transport and metabolism [P] 6.98
COG3000Sterol desaturase/sphingolipid hydroxylase, fatty acid hydroxylase superfamilyLipid transport and metabolism [I] 3.88
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 3.10
COG01792-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase (catechol pathway)Secondary metabolites biosynthesis, transport and catabolism [Q] 0.78
COG1961Site-specific DNA recombinase SpoIVCA/DNA invertase PinEReplication, recombination and repair [L] 0.78
COG2226Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenGCoenzyme transport and metabolism [H] 0.78
COG22272-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylaseCoenzyme transport and metabolism [H] 0.78
COG2230Cyclopropane fatty-acyl-phospholipid synthase and related methyltransferasesLipid transport and metabolism [I] 0.78
COG2452Predicted site-specific integrase-resolvaseMobilome: prophages, transposons [X] 0.78


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.12 %
UnclassifiedrootN/A3.88 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_105686928All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia643Open in IMG/M
3300002245|JGIcombinedJ26739_101050092All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria700Open in IMG/M
3300003505|JGIcombinedJ51221_10304789All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium648Open in IMG/M
3300004080|Ga0062385_10616375All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis688Open in IMG/M
3300004082|Ga0062384_100846620All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia643Open in IMG/M
3300004091|Ga0062387_100851777All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria685Open in IMG/M
3300005181|Ga0066678_11111649All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia508Open in IMG/M
3300005435|Ga0070714_100988694All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales818Open in IMG/M
3300005435|Ga0070714_102290473All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium525Open in IMG/M
3300005529|Ga0070741_10075545All Organisms → cellular organisms → Bacteria3752Open in IMG/M
3300005591|Ga0070761_11108805All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia504Open in IMG/M
3300005712|Ga0070764_10132087All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1359Open in IMG/M
3300005994|Ga0066789_10320382All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii648Open in IMG/M
3300006041|Ga0075023_100335789All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium634Open in IMG/M
3300009521|Ga0116222_1185187All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii897Open in IMG/M
3300009524|Ga0116225_1223352All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia849Open in IMG/M
3300009665|Ga0116135_1411910All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300009698|Ga0116216_10118043All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1633Open in IMG/M
3300009698|Ga0116216_10552382All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium695Open in IMG/M
3300009698|Ga0116216_10793499All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii568Open in IMG/M
3300009700|Ga0116217_10944086All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium528Open in IMG/M
3300009839|Ga0116223_10086074All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2003Open in IMG/M
3300010043|Ga0126380_12058791All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium524Open in IMG/M
3300010303|Ga0134082_10303948All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia669Open in IMG/M
3300010341|Ga0074045_11038662All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii514Open in IMG/M
3300010343|Ga0074044_11154314All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium506Open in IMG/M
3300010379|Ga0136449_100735304All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1646Open in IMG/M
3300012199|Ga0137383_10821402All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia678Open in IMG/M
3300012206|Ga0137380_10884993All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia768Open in IMG/M
3300012210|Ga0137378_10245392All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1667Open in IMG/M
3300013105|Ga0157369_12458203All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia527Open in IMG/M
3300014164|Ga0181532_10055235All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces2605Open in IMG/M
3300014489|Ga0182018_10209749All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1086Open in IMG/M
3300015245|Ga0137409_10571123All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria959Open in IMG/M
3300016270|Ga0182036_10629654All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria863Open in IMG/M
3300017926|Ga0187807_1024399All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1867Open in IMG/M
3300017928|Ga0187806_1158523All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium750Open in IMG/M
3300017937|Ga0187809_10403193All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium521Open in IMG/M
3300017938|Ga0187854_10011925Not Available5331Open in IMG/M
3300017942|Ga0187808_10533272All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium546Open in IMG/M
3300017946|Ga0187879_10158429All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1278Open in IMG/M
3300017975|Ga0187782_10409172All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1031Open in IMG/M
3300018043|Ga0187887_10294872All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium958Open in IMG/M
3300018047|Ga0187859_10357972All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium796Open in IMG/M
3300018047|Ga0187859_10847272All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium526Open in IMG/M
3300018482|Ga0066669_11889220All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia555Open in IMG/M
3300020579|Ga0210407_11185478All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium575Open in IMG/M
3300020581|Ga0210399_10273231All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1410Open in IMG/M
3300020581|Ga0210399_11052819All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium653Open in IMG/M
3300020583|Ga0210401_10991484All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria699Open in IMG/M
3300020583|Ga0210401_11077107All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces662Open in IMG/M
3300021171|Ga0210405_11232578All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium553Open in IMG/M
3300021180|Ga0210396_11376037All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium584Open in IMG/M
3300021402|Ga0210385_11300320All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium557Open in IMG/M
3300021403|Ga0210397_10017664All Organisms → cellular organisms → Bacteria4346Open in IMG/M
3300021403|Ga0210397_10942797All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium669Open in IMG/M
3300021404|Ga0210389_11338483All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium548Open in IMG/M
3300021406|Ga0210386_10963807All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium728Open in IMG/M
3300021407|Ga0210383_10011906All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces7387Open in IMG/M
3300021474|Ga0210390_11200163All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium612Open in IMG/M
3300021475|Ga0210392_10467215All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria927Open in IMG/M
3300021477|Ga0210398_10289281All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1336Open in IMG/M
3300021477|Ga0210398_11455574All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium534Open in IMG/M
3300021478|Ga0210402_11839084All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia531Open in IMG/M
3300025444|Ga0208189_1053051All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia764Open in IMG/M
3300025915|Ga0207693_10124411All Organisms → cellular organisms → Bacteria → Terrabacteria group2026Open in IMG/M
3300025928|Ga0207700_11606093All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia575Open in IMG/M
3300025929|Ga0207664_10028495All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4244Open in IMG/M
3300026515|Ga0257158_1025316All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1019Open in IMG/M
3300027047|Ga0208730_1022237All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium721Open in IMG/M
3300027504|Ga0209114_1026099All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella → Nakamurella flavida969Open in IMG/M
3300027537|Ga0209419_1123295All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium517Open in IMG/M
3300027568|Ga0208042_1154539All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium575Open in IMG/M
3300027662|Ga0208565_1094331All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria906Open in IMG/M
3300027662|Ga0208565_1105788All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria844Open in IMG/M
3300027855|Ga0209693_10181555All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1037Open in IMG/M
3300027884|Ga0209275_10485457All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium703Open in IMG/M
3300027889|Ga0209380_10564665All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium661Open in IMG/M
3300027908|Ga0209006_10301473All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1367Open in IMG/M
3300028781|Ga0302223_10190615All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium677Open in IMG/M
3300028789|Ga0302232_10369776Not Available705Open in IMG/M
3300028877|Ga0302235_10022391All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3406Open in IMG/M
3300028906|Ga0308309_10187369All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1695Open in IMG/M
3300028906|Ga0308309_11840276All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium511Open in IMG/M
3300029943|Ga0311340_10650091All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria912Open in IMG/M
3300029999|Ga0311339_10860204All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria865Open in IMG/M
3300030056|Ga0302181_10264768All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium773Open in IMG/M
3300030490|Ga0302184_10202297All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria833Open in IMG/M
3300030494|Ga0310037_10037047All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2340Open in IMG/M
3300030509|Ga0302183_10237797All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella → Nakamurella flavida708Open in IMG/M
3300030509|Ga0302183_10299200All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium622Open in IMG/M
3300030520|Ga0311372_12650273All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae557Open in IMG/M
3300030706|Ga0310039_10190491Not Available812Open in IMG/M
3300030707|Ga0310038_10148970All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae1166Open in IMG/M
3300030739|Ga0302311_10229093All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1389Open in IMG/M
3300030743|Ga0265461_11210984All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria780Open in IMG/M
3300030969|Ga0075394_11981799All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium632Open in IMG/M
3300031234|Ga0302325_12450785All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae625Open in IMG/M
3300031525|Ga0302326_10571128All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1691Open in IMG/M
3300031543|Ga0318516_10684391All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium583Open in IMG/M
3300031680|Ga0318574_10472449All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria734Open in IMG/M
3300031681|Ga0318572_10562258All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium680Open in IMG/M
3300031713|Ga0318496_10447086Not Available715Open in IMG/M
3300031715|Ga0307476_10076526All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae2329Open in IMG/M
3300031736|Ga0318501_10252840All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria932Open in IMG/M
3300031748|Ga0318492_10622553Not Available576Open in IMG/M
3300031751|Ga0318494_10281370All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria957Open in IMG/M
3300031753|Ga0307477_10123330All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1807Open in IMG/M
3300031753|Ga0307477_10328468All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1054Open in IMG/M
3300031765|Ga0318554_10121539All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1474Open in IMG/M
3300031771|Ga0318546_10376665All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria989Open in IMG/M
3300031798|Ga0318523_10018682All Organisms → cellular organisms → Bacteria2982Open in IMG/M
3300031819|Ga0318568_10143317All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1457Open in IMG/M
3300031823|Ga0307478_10597063All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria923Open in IMG/M
3300031846|Ga0318512_10702285All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium518Open in IMG/M
3300031890|Ga0306925_11253421All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii740Open in IMG/M
3300031894|Ga0318522_10113264All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1010Open in IMG/M
3300032025|Ga0318507_10031722All Organisms → cellular organisms → Bacteria1976Open in IMG/M
3300032043|Ga0318556_10085194All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1583Open in IMG/M
3300032052|Ga0318506_10027167All Organisms → cellular organisms → Bacteria2157Open in IMG/M
3300032054|Ga0318570_10401363All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium625Open in IMG/M
3300032067|Ga0318524_10257897All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria898Open in IMG/M
3300032261|Ga0306920_103272463All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium605Open in IMG/M
3300032783|Ga0335079_11041963All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii832Open in IMG/M
3300032896|Ga0335075_11696382All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium514Open in IMG/M
3300032954|Ga0335083_10289728All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1444Open in IMG/M
3300032955|Ga0335076_11666534All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria526Open in IMG/M
3300033289|Ga0310914_10911525All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium778Open in IMG/M
3300033829|Ga0334854_034442All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella → Nakamurella flavida1216Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil31.01%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil10.85%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa10.08%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil5.43%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.65%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.10%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.10%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.10%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.10%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland3.88%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.33%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil2.33%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland1.55%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.55%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil1.55%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.55%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.78%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.78%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.78%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.78%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.78%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.78%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.78%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.78%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.78%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.78%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.78%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300004080Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005994Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049EnvironmentalOpen in IMG/M
3300006041Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014EnvironmentalOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300009524Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaGEnvironmentalOpen in IMG/M
3300009665Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10EnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017938Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300025444Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026515Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-AEnvironmentalOpen in IMG/M
3300027047Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF042 (SPAdes)EnvironmentalOpen in IMG/M
3300027504Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027537Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027568Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027662Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300028781Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_3EnvironmentalOpen in IMG/M
3300028789Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3EnvironmentalOpen in IMG/M
3300028877Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030056Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3EnvironmentalOpen in IMG/M
3300030490Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3EnvironmentalOpen in IMG/M
3300030494Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2)EnvironmentalOpen in IMG/M
3300030509Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2EnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030706Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2)EnvironmentalOpen in IMG/M
3300030707Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2)EnvironmentalOpen in IMG/M
3300030739Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3EnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300030969Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032896Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033829Peat soil microbial communities from Stordalen Mire, Sweden - 715 P2 1-5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10568692823300000364SoilILAAYGEPVDPVQLEVCQQLRKLHLTVWYNLYAERLPHLAPRAAELLTLWPVP*
JGIcombinedJ26739_10105009213300002245Forest SoilQDGRRVLAAYRDPVDPGQLAVCEQLRWLHLTVWYSLYAERLPELGPRAAELLATWPAGT*
JGIcombinedJ51221_1030478923300003505Forest SoilWDLAASTSSQYQDGPRILAAYREPVDAGQLAVCEQLRWLHLTVWYNLYAERLPELGPRAAELLASWPMG*
Ga0062385_1061637523300004080Bog Forest SoilPVTWDLAASTARLGAPYILAAYGEPVDEGQLTVCEQLRRLHLTIWYGLYAERFPDLRPRAAELLARWPAP*
Ga0062384_10084662023300004082Bog Forest SoilYNDGPRVLAAYRDPVDPGQLAVCEQLRRLHLTVWYNLYAERLPELAPRAADLLASWPAG*
Ga0062387_10085177723300004091Bog Forest SoilPVAWDLAASTSSQYQDGPRILAAYREPVDPGQLAVCEQLRWLHLTVWYNLYAERLPELGPRAAELLASWPAG*
Ga0066678_1111164923300005181SoilSPRLDGSRILAAYGEDPAQLEVCQQLRKLHLTVWYNLYAERLPDLAPRAAELLTLWPVP*
Ga0070714_10098869413300005435Agricultural SoilLAAYGEVPAQLEVCQQLRKLHLTVWYNLYAERLPHLAPRAAELLTLWPVP*
Ga0070714_10229047313300005435Agricultural SoilVAPAPPGHPPSPAWDVAASTASQRLDARRVLAADGDPVDPATLAACEQLRRLHLTVWYNLYAERLPELRPRAAELLARWPPP*
Ga0070741_1007554523300005529Surface SoilVAASTASQRLDARRVLAAYGEPVDPATLAACEQLRRLHLTVWYNLYAERLPELRPRAAELLARWPAP*
Ga0070761_1110880513300005591SoilTWDLAASTASQYQDGSRVLAAYGEPVDRGQLVVCEQLRRLHLTVWYSLYAERIPRLQSRATELLALWPAP*
Ga0070764_1013208713300005712SoilYTETAPFLAAYGGAPDAGQVQVCVQLRRLHLTIWYCLYAERLPGLRLRAAELLAGWPAP*
Ga0066789_1032038213300005994SoilPQASAWTGRILGAYGACVDAAQLAVCEQLRRLHLTVWYALYAERLPDLRPRAAGLLALWSPG*
Ga0075023_10033578923300006041WatershedsGTAVDPDQLATCQQLRRLNLIVWYALYAERLPELRPRSAELLAAWPPNDLQWRG*
Ga0116222_118518713300009521Peatlands SoilAAYGDPVDPAQLHMCQELRRLHLTIWYALYAERLPECQPRAADLLAAWRAPSS*
Ga0116225_122335233300009524Peatlands SoilWDLAASTASPRLDGARILAAYGEPAPAKLAVCQQLRRLHLTVWYALYAERLPQLRSRAAELLALWPAP*
Ga0116135_141191013300009665PeatlandASQRLDGRKILAAYGAPVDPGLLAVCEQLRLLHLTIWYALYAERLPDLRPRAAELLDLWTSRG*
Ga0116216_1011804323300009698Peatlands SoilLAAYGDPTPPQLAVCQQLRRLHLTVWYALYTERLPQLRSRAAEFLALWPAP*
Ga0116216_1055238213300009698Peatlands SoilWDLAASTASQFQDGQRVLAAYRDPVDRGQLAVCEQLRRLHLTVWYSLYAERLPELAPRAAELLASWPAA*
Ga0116216_1079349923300009698Peatlands SoilLAAYGDPTPPQLAVCQQLRRLHLTVWYALYTERLPQLRSRATELLALWPAP*
Ga0116217_1094408613300009700Peatlands SoilSRYQDGPRVLAAYRDPVDRGQLAVCEQLRRLHLTVWYSLYAERLPELAPRAAELLASWPAA*
Ga0116223_1008607443300009839Peatlands SoilWDLAASTASKRLDGLRILAAYGDPTPPQLAVCQQLRRLHLTVWYALYAERLPQLRSRAAELLALWPAP*
Ga0126380_1205879113300010043Tropical Forest SoilSTASPRLDARRILAAYGEPVDPVQLEVCRQLRRLHLTVWYNLYAERLPDLCPRAAELLTLWPAP*
Ga0134082_1030394813300010303Grasslands SoilLAAYGEPVDPAQLEVCQQLRKLHLTVWYNLYAERLPDLAPRAAELLALWPAP*
Ga0074045_1103866223300010341Bog Forest SoilANQRLDGSRVLAAYGDPVDVAQLTVCQQLRRLHLTVWYALYSERLPRLRSRAAELLALWPAP*
Ga0074044_1115431423300010343Bog Forest SoilDGPRVLAAYRDPVDPGQLAVCERLRWLHLTVWYNLYAERLPELGPRAAELLASWPAG*
Ga0136449_10073530443300010379Peatlands SoilLAAYGDQDPPKLAVCQQLRRLNLTVWYALYTERLPQLRSRAAELLALWPAP*
Ga0137383_1082140233300012199Vadose Zone SoilAAYGEPVDPDQLEVCQQLRKLHLTVWYNLYAERLPDLAPRAAELLALWPTP*
Ga0137380_1088499313300012206Vadose Zone SoilTASARLDGPRILAAYGEPVDPDQLEVCQQLRKLHLTVWYNLYAERLPDLAPRAAELLALWPTP*
Ga0137378_1024539213300012210Vadose Zone SoilRLDGPRILAAYGEPVDPVQLEVCQQLRKLHLTVWYNLYAERLPDLAPRAAELLALWLEP*
Ga0157369_1245820323300013105Corn RhizosphereSTASPRLDGPRILAAYGEPVDPAQLEVCQQLRRLHLTVWYNLYAERLPDLAPRAAELLTLWPVP*
Ga0181532_1005523533300014164BogTASQRLDGARILAAYGGAADREQIAVCEQLRRLHLTVWYALYAERLPQCQPRAAELLASWPAP*
Ga0182018_1020974933300014489PalsaVLYGEPVDQGQLAACEQFRRLHLTVWYSLYAERFPNLQSRADELLALWPVL*
Ga0137409_1057112333300015245Vadose Zone SoilDLAASTASPRLDGPRILAAYGEPVDSAQLEVCQQLRKLHLTVWYNLYAERLPDLAPRAAELLTLWPVP*
Ga0182036_1062965413300016270SoilTASQFQDGQRVLAAYREPIDPSQLAVCEQLRRLHLTVWYNLYAERLPELGPRAADLLASWPAGAPPVH
Ga0187807_102439943300017926Freshwater SedimentAWDLAASTGSRYQDGPRVLAAYRDPVDPGQLAVCEQLRRLHLTVWYNLYAERLPELAPRAAELLASWPAA
Ga0187806_115852323300017928Freshwater SedimentVLAAYRDPVDQHQLAVCEQLRWLHLTVWYNLYAERLPELAPRAAELLAGWSTIPPVN
Ga0187809_1040319313300017937Freshwater SedimentPATASARLDGPRVLAAYAEPVDAAALAVCQQLRRLHLTVWYALYAERLPHLRPRATDLLAQWPPP
Ga0187854_1001192513300017938PeatlandPLPSQILAASTASQRLDGARILAAYGGAADREQIAVCEQLRRLHLTVWYALYAERLPQCQPRAAELLASWPAP
Ga0187808_1053327223300017942Freshwater SedimentLAAYGTGIDAAQLAVCQQLRRLNLTIWYALYAERLPELRPRSAELLAAWPAS
Ga0187879_1015842923300017946PeatlandMTVTDAALLAAYGEPVDGAQLAVCEQLRRLHLTVWYALYAERLPGLRSRAAELLALWQPA
Ga0187782_1040917213300017975Tropical PeatlandAAWDLAASTANRHLDGSRILAAYGTPVDAGQLAVCQQLRRLHLTVWYALYAERLPECGPRAAELLAAWPVP
Ga0187887_1029487223300018043PeatlandMTVTDAALLAAYGEPVDGAQLAVCEQLRRLHLTVWYALYAERLPGLRSRAAELLALWQ
Ga0187859_1035797223300018047PeatlandMTVTDAALLAAYGEPVDGAQLAVCEQLRRLHLTVWYALYAERLPGLRSRAAELLALWQAA
Ga0187859_1084727213300018047PeatlandVAASTASQRLDAARVLAAYGDPVDAAKLSACEQLRRLHLTVWYNLYAERLPDLRPRAAELAARWPPP
Ga0066669_1188922023300018482Grasslands SoilILAAYGEPVDPAQLEVCQQLRKLNLTVWYNLYAERLPDLAPRAAELLTLWPVP
Ga0210407_1118547813300020579SoilASPRLDGPRILAAYGEPVDPTQLEVCQQLRRLHLTVWYNLYAERLPDLAPRAAELLTLWPVP
Ga0210399_1027323133300020581SoilASTASPRLDGPRILAAYGEPVDPTQLEVCQQLRRLHLTVWYNLYAERLPDLAPRAAELLTLWPTP
Ga0210399_1105281913300020581SoilVLAAYRDPVDPGQLAVCEQLRWLHLTVWYNLYAERLPELGPRAAELLASWSAG
Ga0210401_1099148413300020583SoilGPRILAAYGENPAQLEVCQQLRKLHLTVWYNLYAERLPDLAPRAAELLALWPVP
Ga0210401_1107710723300020583SoilHTGILAAYGGPVDPALLHTCEQLRRLHLTVWYALYAERLPECRQRATELLAAWRRSS
Ga0210405_1123257823300021171SoilVAWDLAASTASQRLDGRRILAAYGEPVDAAKIAVCLQLRRLHLTVSYALYAERLPDLRSRAAELLALWSAP
Ga0210396_1137603723300021180SoilRVLAAYRDPVDPEQLAVCEQLRWLHLTVWYNLYAERLPGLGPRAAELLASWPAS
Ga0210385_1130032023300021402SoilPVDPGRLAVCEQLRRLHLTVWYCLYAERLPGLEPRAAELVAGWPPAEAPSAAR
Ga0210397_1001766463300021403SoilTASQRLDGRRILAAYGEPVDAAKLAVCQQLRRLHLTVWYALYAERLPDLRSRAAELLALWSAP
Ga0210397_1094279723300021403SoilSGPVAWDLAASTSSRYQDGPRVLAAYRDPVDPEQLAVCEQLRWLHLTVWYNLYAERLPGLGPRAAELLASWPAS
Ga0210389_1133848313300021404SoilPRLDGPRILAAYGEPVDPTQLEVCQQLRRLHLTVWYNLYAERLPDLAPRAAELLTLWRVP
Ga0210386_1096380723300021406SoilTSSRYQDGPRVLAAYREPIDQRQLAVCEQLRWLHLTVWYNLYAERLPELGPRAAELLASWSAG
Ga0210383_1001190693300021407SoilAWDLAASTSSRYQDGPRVLAAYRDPVDPGQLAVCEQLRWLHLTVWYNLYAERLPELGPRAAELLASWSAG
Ga0210390_1120016313300021474SoilLAAYRDPVDPEELAVCERLRWLHLTVWYNLYAERLPELGPRAAELLATWCAE
Ga0210392_1046721513300021475SoilWDLAASTASPRLDGPRILAAYGEPVDRAQLEVCQQLRKLHLTVWYNLYAERLPDLAPRAAELLTLWPVP
Ga0210398_1028928133300021477SoilWDLAASTSSRYQDGPRVLAAYREPIDQRQLAVCEQLRWLHLTVWYNLYAERLPELGPRAAELLASWSAG
Ga0210398_1145557413300021477SoilASTSSQYQDGPRVLAAYRDPVDPGQLAVCERLRWLHLTVWYNLYAERLPELGPRAAELLASWPAG
Ga0210402_1183908423300021478SoilLDGARILAAYGENPAQLEVCQQLRKLHLTVWYNLYAERLPDLAPRAAELLALWPVP
Ga0208189_105305123300025444PeatlandCSGPVSWDLAASTASQRLDGARILAAYGGAADREQIAVCEQLRRLHLTVWYALYAERLPQCQPRAAELLASWPAP
Ga0207693_1012441113300025915Corn, Switchgrass And Miscanthus RhizosphereRILAAYGEPANPAQLEVCQQLRKLHLTVWYNLYAERLPDLAPRAAELLTLWPVP
Ga0207700_1160609313300025928Corn, Switchgrass And Miscanthus RhizosphereQRLDARRVLAAYGDPVDPATLAACEQLRRLHLTVWYNLYAERLPELRPRAAELLARWPPP
Ga0207664_1002849523300025929Agricultural SoilVAPAPPGHPPSPAWDVAASTASQRLDARRVLAAYGDPVDPATLAACEQLRRLHLTVWYNLYAERLPELRPRAAELLARWPPP
Ga0257158_102531613300026515SoilCSGPVAWDLAASTSSQYQDGPRILAAYREPVDPGQLAVCEQLRWLHLTVWYNLYAERLPELGPRAAELLASWPAG
Ga0208730_102223723300027047Forest SoilPVAWDLAATTANPRLDHTRILAAYGGPVDPALLHTCEQLRRLHLTVWYNLYAERLPELGPRAAELLASWPAG
Ga0209114_102609913300027504Forest SoilPVTWDLAASTASAFQHAPKVLAAYADPVDPHQLAVCEQLRRLHLTVWYTLYAERLPDLRPRAAELQSRWPA
Ga0209419_112329523300027537Forest SoilSSRYQDGPRVLAAYRDQVDPGQLAVCEQLRWLHLTVWYNLYAERLPELAPRAAELLATWCVE
Ga0208042_115453923300027568Peatlands SoilPVDPGQLAVCEQLRRLHLTVWYCLYAERLPELGPRAAELVAAWPPAEAPSASR
Ga0208565_109433133300027662Peatlands SoilAASTASKRLDGLRILAAYGDPTPPQLAVCQQLRRLHLTVWYALYAERLPQLRSRAAELLALWPAP
Ga0208565_110578833300027662Peatlands SoilARILAAYGDPAPPLLAVCQQLRRLNLTVWYALYTERLPQLRSRATELLALWPAP
Ga0209693_1018155533300027855SoilLAASTSSQYPDGPRILAAYREPVDPGQLAVCEQLRWLHLTVWYNLYAERLPELGPRAAELLARWPAG
Ga0209275_1048545713300027884SoilPVAWDLAASTSSQYQDGPRVLAAYGEPVDPGQLAVCEQLRWLHLTVWYNLYAERLPELGPRAAELLASWPRGKAR
Ga0209380_1056466513300027889SoilQYQDGPRILAAYGEPVDAGQLAVCEQLRWLHLTVWYNLYAERLPELGPRAAELLASWPMG
Ga0209006_1030147313300027908Forest SoilAAYRDPVDPGQLAVCEQLRWLHLTVWYSLYAERLPELGPRAAELLATWPAGT
Ga0302223_1019061513300028781PalsaTASQYQAGPRVLAAYREPVDPAQLAICEQLRRLHLTVWYNLYAERLPELAPRAAELLASWPAG
Ga0302232_1036977623300028789PalsaLAASTASQRLDGQKILAAYGEPVDPAQLAVCEQLRSLHLTIWYALYAERLPDLRPRAAELLAQWTSKG
Ga0302235_1002239113300028877PalsaLDSARILRAYGEPVDTVQLAVCEQLRRLHLAVWYALYAERLPEHRQRAAELLATWRAP
Ga0308309_1018736913300028906SoilLAAYRDPVDPGQLAVCEQLRWLHLTVWYNLYAERLPELGPRAAELLASWSAG
Ga0308309_1184027623300028906SoilTSSQYQDGPRILAAYGEPVDAGQLAVCEQLRWLHLTVWYNLYAERLPELGPRAAELLASWPMG
Ga0311340_1065009113300029943PalsaSGPVTWDVAASTANPRRDRARILAAYGADVDAGQLAVCEQLRRLHLTVWYGLYAERFPDLRARADELLALWPVP
Ga0311339_1086020413300029999PalsaCSGPVVWDLAASTSSQYQAGSRVLAAYREPVDPGQLAICEQLRRLHLTVWYNLYAERLPELAPRAAELLASWPAA
Ga0302181_1026476823300030056PalsaRVLAAYREPVDPGQLAICEQLRRLHLTVWYNLYAERLPELAPRAAELLASWPAA
Ga0302184_1020229723300030490PalsaLAAYGADVDAGQLAVCEQLRRLHLTVWYGLYAERFPDLRARAGELLALWPVP
Ga0310037_1003704723300030494Peatlands SoilILAAYGDPTPPQLAVCQQLRRLHLTVWYALYTERLPQLRSRAAEFLALWPAP
Ga0302183_1023779723300030509PalsaLAAYGEPVDPAQLAVCEQLRSLHLTIWYALYAERLPDLRPRAAELLAQWTSKG
Ga0302183_1029920013300030509PalsaSTANPRRDRARILAAYGADVDAGQLAVCEQLRRLHLTVWYGLYAERFPDLRARADELLALWPVP
Ga0311372_1265027323300030520PalsaQKILAAYGKPVDPAQLAVCERLRLLHLTIWYALYAERLPDLRPRAAELLALWTTSG
Ga0310039_1019049133300030706Peatlands SoilAASTTSQRLDGSRILAAYGDPAPPQLAVCQQLRRLHLTVWYALYTERLPQLRSRAAELLALWPAP
Ga0310038_1014897033300030707Peatlands SoilGSRILAVYGDPTPPQLAVCQQLRRLHLTVWYALYAERLPQLRSRAAELLALWPAP
Ga0302311_1022909333300030739PalsaGPMAWDLAASTSSQYQAGPRVLAAYGEPVDPGQLAVCEQLRRLHLTVWYNLYAERLPELAPRAAELLASWPAG
Ga0265461_1121098423300030743SoilFFFLCFFLLLAAYGDPVDPVQLRTCEQLRRLHLTIWYALYAERLPECRQRAAELLATWRPPPP
Ga0075394_1198179923300030969SoilLAAYGEPVDSDQLEVCQQLRRLHLTVWYNLYAERLPDLAPRAAELLTL
Ga0302325_1245078513300031234PalsaLAASTANPRRDRERILAAYGEPVDRHQLAVCERLRLLHLTVWYALYAERLPDLRSRADELVALWPAP
Ga0302326_1057112813300031525PalsaRSRILAAYGVPVDPGQLAVCEQLRWLHLTIWYQLYAERLPDLRPRAAQLLARWTVGDNPPGGRTDP
Ga0318516_1068439113300031543SoilPRVLAAYRDPVDPGQLAVCEQLRRLHLTVWYNLYAERLPELGPRAAELLASWSPG
Ga0318574_1047244913300031680SoilYLDGPRVLAAYRDPINRAQLAVCEQLRRLDLTVWYSLYAERLPELGPRAADLLASWPAGAPPVH
Ga0318572_1056225813300031681SoilPVAWDLAASTASRYQDGPRVLAAYRDPVDPGQLAVCEQLRRLHLTVWYNLYAERLPELGPRAAELLASWPG
Ga0318496_1044708613300031713SoilPAAWDLAASTASPRLDAARILAAYGEPVDPGQLEVCQQLRKLHLTVWYNLYAERLPDLAARAAELLTLWPAP
Ga0307476_1007652643300031715Hardwood Forest SoilWDLAATTANPRLDGSRILAAYGTAVDPAQLAACQQLRRLHLTIWYALYAERLPDLRPRSAELLAEWPAPRPA
Ga0318501_1025284023300031736SoilPRVLAAYRDPVNRTQLAVCEQLRRLDLTIWYSLYAERLPELGPRAAGLLASWPAGSPPVH
Ga0318492_1062255313300031748SoilLAAYGEPVDPGQLEVCQQLRKLHLTVWYNLYAERLPDLAARAAELLTLWPAP
Ga0318494_1028137023300031751SoilASDLAASTASRYQDGPRVLAAYRDPVEPGQLAVCEQLRRLHLTVWYSLYAERMPELGPRAAELLASWPAA
Ga0307477_1012333043300031753Hardwood Forest SoilRYQDAPRVLAAYRDPVDPEELAVCEQLRWLHLTVWYNLYAERLPELGPRAAELLATWCAE
Ga0307477_1032846813300031753Hardwood Forest SoilAWDLAASTASRFQDGQRILAAYRDPVDPRQLAVCEQLRRLHLTVWYNLYAERLPELSPRAAELLASWPAA
Ga0318554_1012153933300031765SoilDRPRVLAAYRDPVYPGQLAVCEQLRRLHLTVWYNLYAERLPELGPRAAELLASWSPG
Ga0318546_1037666513300031771SoilYLDGPRVLAAYRDPVNRTQLAVCEQLRRLDLTIWYSLYAERLPELGPRAAGLLASWPAGSPPVH
Ga0318523_1001868213300031798SoilVTWDLAASTASQYLDGPRVLAAYRDPVNRTQLAVCEQLRRLDLTIWYSLYAERLPELGPRAAGLLASWPAGSPPVH
Ga0318568_1014331713300031819SoilASTASRHQDGPRVLAAYRDPVDPGQLAVCEQLRRLHLTVWYSLYAERMPELGPRAAELLASWPAA
Ga0307478_1059706313300031823Hardwood Forest SoilRDPVDPEELAVCEQLRWLHLTVWYNLYAERLPELGPRAAELLATWLQPAPRRRR
Ga0318512_1070228523300031846SoilWDLAASTASQYLDGPRMLAAYRDPVNRTQLAVCEQLRRLDLTIWYSLYAERLPELGPRAAGLLASWPAGSPPVH
Ga0306925_1125342113300031890SoilAASTASPRLDGPRVLAAYGQPVDAAQLAVCQQLRRLHLTVWYNLYAERLPGLRSRAAELLALWPEP
Ga0318522_1011326423300031894SoilSTASQYLDGPRVLAAYRDPINRAQLAVCEQLRRLDLTVWYSLYAERLPELGPRAADLLASWPAGAPPVH
Ga0318507_1003172233300032025SoilSGPVTWDLAASTASQYLDGPRVLAAYRDPVNRTQLAVCEQLRRLDLTIWYSLYAERLPELGPRAAGLLASWPAGSPPVH
Ga0318556_1008519413300032043SoilWDLAASTASQYLDGPRVLAAYRDPVNRTQLAVCEQLRRLDLTIWYSLYAERLPELGPRAAGLLASWPAGSPPVH
Ga0318506_1002716733300032052SoilWDLAASTASQYLDGPRVLAAYRDPVNRTQLAVCEQLRRLDLTVWYSLYAERLPELGPRAAGLLASWPAGSPPVH
Ga0318570_1040136323300032054SoilASTASRYQDGPRVLAAYRDPVEPGQLAVCEQLRRLHLTVWYNLYAERLPELGPRAAELLASWSPG
Ga0318524_1025789713300032067SoilLAAYRDPVNRAQLAVCEQLRRLDLTVWYSLYAERLPELGPRAAELLASWPAALDGHDQLN
Ga0306920_10327246313300032261SoilAYRDPVDPGQLAVCEQLRRLHLTVWYNLYAERLPELGPRAAELLASWPG
Ga0335079_1104196323300032783SoilDARRILAAYGEPVDPDQLEVCQQLRRLHLTVWYNLYAERLPDLAPRAAELLTLWPEP
Ga0335075_1169638223300032896SoilILAAYGAPVDEARLRVCERLRRLHLTIWYALYAERLPRCRPRAAELLAEWRRAS
Ga0335083_1028972813300032954SoilGPRILAAYGEPAPAQLEVCQQLRKLHLTVWYNLYAERLPDLRPRAAELLTLWPAP
Ga0335076_1166653423300032955SoilRILAAYGTPVDPAQLAVCEQLRRLHLTVWYSLYAERLPGLRSRAAELLALWPES
Ga0310914_1091152513300033289SoilTASQYLDGPRVLAAYRDPVNRTQLAVCEQLRRLDLTIWYSLYAERLPELGPRAAGLLASWPAGSPPVH
Ga0334854_034442_2_1933300033829SoilASQRLDGQKILAAYGEPVDPAQLAVCEQLRSLHLTIWYALYAERLPDLRPRAAELLAQWTSKG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.