NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F063475

Metagenome / Metatranscriptome Family F063475

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F063475
Family Type Metagenome / Metatranscriptome
Number of Sequences 129
Average Sequence Length 41 residues
Representative Sequence FNQTALYGVVVGNQNGGSHGFPRTLQLSVSNRGTLADAD
Number of Associated Samples 117
Number of Associated Scaffolds 129

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.78 %
% of genes near scaffold ends (potentially truncated) 98.45 %
% of genes from short scaffolds (< 2000 bps) 96.90 %
Associated GOLD sequencing projects 115
AlphaFold2 3D model prediction Yes
3D model pTM-score0.15

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.450 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(10.853 % of family members)
Environment Ontology (ENVO) Unclassified
(32.558 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(43.411 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 0.00%    Coil/Unstructured: 100.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.15
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 129 Family Scaffolds
PF08439Peptidase_M3_N 42.64
PF03741TerC 10.08
PF00072Response_reg 0.78
PF00145DNA_methylase 0.78
PF01381HTH_3 0.78
PF01704UDPGP 0.78

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 129 Family Scaffolds
COG1164Oligoendopeptidase FAmino acid transport and metabolism [E] 42.64
COG0861Tellurite resistance membrane protein TerCInorganic ion transport and metabolism [P] 10.08
COG0270DNA-cytosine methylaseReplication, recombination and repair [L] 0.78
COG4284UDP-N-acetylglucosamine pyrophosphorylaseCarbohydrate transport and metabolism [G] 0.78

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.45 %
UnclassifiedrootN/A1.55 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908043|A2_c1_ConsensusfromContig33533All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria603Open in IMG/M
2170459010|GIO7OMY01AVGFJAll Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria524Open in IMG/M
3300001664|P5cmW16_1003498All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2893Open in IMG/M
3300002532|JGI24019J35510_1022881Not Available972Open in IMG/M
3300003505|JGIcombinedJ51221_10476209All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria504Open in IMG/M
3300003659|JGI25404J52841_10078230All Organisms → cellular organisms → Bacteria → Proteobacteria691Open in IMG/M
3300004633|Ga0066395_10976929All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria515Open in IMG/M
3300005176|Ga0066679_10022550All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD00693360Open in IMG/M
3300005329|Ga0070683_102022468All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria554Open in IMG/M
3300005332|Ga0066388_101368914All Organisms → cellular organisms → Bacteria → Proteobacteria1226Open in IMG/M
3300005466|Ga0070685_10325016All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1044Open in IMG/M
3300005557|Ga0066704_10572000All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria732Open in IMG/M
3300005616|Ga0068852_102573173All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria529Open in IMG/M
3300006804|Ga0079221_10860606All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria659Open in IMG/M
3300006864|Ga0066797_1105234All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1988Open in IMG/M
3300006904|Ga0075424_102813974All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria507Open in IMG/M
3300007788|Ga0099795_10272420All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria736Open in IMG/M
3300009101|Ga0105247_10222691All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1278Open in IMG/M
3300009101|Ga0105247_10635820All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria795Open in IMG/M
3300009143|Ga0099792_10517533All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria749Open in IMG/M
3300009148|Ga0105243_11608070All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria676Open in IMG/M
3300009545|Ga0105237_10733461All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria994Open in IMG/M
3300009545|Ga0105237_10770327All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria969Open in IMG/M
3300009551|Ga0105238_10288395All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. Sm61623Open in IMG/M
3300009551|Ga0105238_10489091All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. Sm61230Open in IMG/M
3300009624|Ga0116105_1207855All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria542Open in IMG/M
3300009768|Ga0116193_1091771All Organisms → cellular organisms → Bacteria1409Open in IMG/M
3300010042|Ga0126314_11492511All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria508Open in IMG/M
3300010321|Ga0134067_10344224All Organisms → cellular organisms → Bacteria → Proteobacteria585Open in IMG/M
3300010371|Ga0134125_12285300All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria588Open in IMG/M
3300010373|Ga0134128_11979738All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria641Open in IMG/M
3300010375|Ga0105239_11592333All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria755Open in IMG/M
3300010376|Ga0126381_104359712All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria547Open in IMG/M
3300010396|Ga0134126_10286337All Organisms → cellular organisms → Bacteria1938Open in IMG/M
3300010396|Ga0134126_12450453All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria568Open in IMG/M
3300010398|Ga0126383_12027934All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria663Open in IMG/M
3300010399|Ga0134127_12609251All Organisms → cellular organisms → Bacteria → Proteobacteria585Open in IMG/M
3300010403|Ga0134123_13326965All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria519Open in IMG/M
3300011119|Ga0105246_10189721All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD00691590Open in IMG/M
3300011119|Ga0105246_10601812All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria950Open in IMG/M
3300011270|Ga0137391_10836002All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria757Open in IMG/M
3300012008|Ga0120174_1053970All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1099Open in IMG/M
3300012205|Ga0137362_10823577All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria795Open in IMG/M
3300012208|Ga0137376_10679049All Organisms → cellular organisms → Bacteria → Proteobacteria889Open in IMG/M
3300012356|Ga0137371_10762401All Organisms → cellular organisms → Bacteria → Proteobacteria738Open in IMG/M
3300012469|Ga0150984_119311521All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria508Open in IMG/M
3300012582|Ga0137358_10473147All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria845Open in IMG/M
3300012683|Ga0137398_10367477All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria976Open in IMG/M
3300012924|Ga0137413_10422053All Organisms → cellular organisms → Bacteria → Proteobacteria964Open in IMG/M
3300012944|Ga0137410_10724288All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria830Open in IMG/M
3300012944|Ga0137410_11311646All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria626Open in IMG/M
3300012951|Ga0164300_10577497All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria659Open in IMG/M
3300012960|Ga0164301_11830926All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria511Open in IMG/M
3300012986|Ga0164304_11232008All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria606Open in IMG/M
3300012988|Ga0164306_11212280All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria633Open in IMG/M
3300012989|Ga0164305_11097605All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria683Open in IMG/M
3300012989|Ga0164305_12188837All Organisms → cellular organisms → Bacteria → Proteobacteria509Open in IMG/M
3300013102|Ga0157371_11512288All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria524Open in IMG/M
3300013306|Ga0163162_10324576All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1672Open in IMG/M
3300013307|Ga0157372_10970505All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. Sm6985Open in IMG/M
3300013308|Ga0157375_10874479All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1044Open in IMG/M
3300014157|Ga0134078_10126012All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria984Open in IMG/M
3300014201|Ga0181537_10264473All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1181Open in IMG/M
3300014325|Ga0163163_11507623All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria734Open in IMG/M
3300014499|Ga0182012_10272114All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1152Open in IMG/M
3300014501|Ga0182024_12526857All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria553Open in IMG/M
3300014587|Ga0135122_104726All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria570Open in IMG/M
3300015199|Ga0167647_1152113All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria500Open in IMG/M
3300015264|Ga0137403_10148019All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2315Open in IMG/M
3300015264|Ga0137403_10305306All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1485Open in IMG/M
3300015372|Ga0132256_103708688All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria514Open in IMG/M
3300015374|Ga0132255_104284557All Organisms → cellular organisms → Bacteria → Proteobacteria605Open in IMG/M
3300016404|Ga0182037_11900870All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria533Open in IMG/M
3300017965|Ga0190266_10262297All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria875Open in IMG/M
3300018433|Ga0066667_11670414All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria570Open in IMG/M
3300019996|Ga0193693_1027772All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. Sm61007Open in IMG/M
3300021082|Ga0210380_10058583All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. Sm61670Open in IMG/M
3300021180|Ga0210396_10552906All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1004Open in IMG/M
3300021404|Ga0210389_10392657All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1091Open in IMG/M
3300021405|Ga0210387_10722104All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria883Open in IMG/M
3300021406|Ga0210386_11562018All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria548Open in IMG/M
3300021420|Ga0210394_10426178All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1168Open in IMG/M
3300021420|Ga0210394_11013573All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria719Open in IMG/M
3300021475|Ga0210392_10896988All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria663Open in IMG/M
3300021478|Ga0210402_10835948All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria847Open in IMG/M
3300022529|Ga0242668_1134737All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria531Open in IMG/M
3300022911|Ga0247783_1213502All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria555Open in IMG/M
3300023068|Ga0224554_1113087All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300025893|Ga0207682_10225127All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria868Open in IMG/M
3300025903|Ga0207680_10439471All Organisms → cellular organisms → Bacteria925Open in IMG/M
3300025905|Ga0207685_10439854Not Available676Open in IMG/M
3300025905|Ga0207685_10856633All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria503Open in IMG/M
3300025914|Ga0207671_10355161All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1163Open in IMG/M
3300025914|Ga0207671_10589178All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. Sm6886Open in IMG/M
3300025929|Ga0207664_11599054All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria574Open in IMG/M
3300025938|Ga0207704_10335588All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD00691171Open in IMG/M
3300025944|Ga0207661_10414723All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. Sm61223Open in IMG/M
3300025949|Ga0207667_11240382All Organisms → cellular organisms → Bacteria → Proteobacteria724Open in IMG/M
3300026078|Ga0207702_10736849All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. Sm6972Open in IMG/M
3300026088|Ga0207641_12300852All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria538Open in IMG/M
3300026274|Ga0209888_1053214All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria759Open in IMG/M
3300026277|Ga0209350_1097039All Organisms → cellular organisms → Bacteria → Proteobacteria739Open in IMG/M
3300026306|Ga0209468_1128838All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria731Open in IMG/M
3300026515|Ga0257158_1069109All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria672Open in IMG/M
3300026527|Ga0209059_1179614All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria734Open in IMG/M
3300026557|Ga0179587_11137734All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria514Open in IMG/M
3300027334|Ga0209529_1019635All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1143Open in IMG/M
3300027505|Ga0209218_1063725All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria753Open in IMG/M
3300027651|Ga0209217_1215498All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria511Open in IMG/M
3300027676|Ga0209333_1133846All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria669Open in IMG/M
3300027853|Ga0209274_10290893All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. Sm6839Open in IMG/M
(restricted) 3300027861|Ga0233415_10324957All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria729Open in IMG/M
3300028379|Ga0268266_11848399All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria578Open in IMG/M
3300028380|Ga0268265_11989896All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria588Open in IMG/M
3300028720|Ga0307317_10170396All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria733Open in IMG/M
3300030580|Ga0311355_10984302All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria759Open in IMG/M
3300030646|Ga0302316_10474906All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria500Open in IMG/M
3300031232|Ga0302323_102578784All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria580Open in IMG/M
3300031235|Ga0265330_10019454All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3111Open in IMG/M
3300031239|Ga0265328_10067099All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. Sm61318Open in IMG/M
3300031446|Ga0170820_12764780All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria534Open in IMG/M
3300031446|Ga0170820_14783348All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria658Open in IMG/M
3300031521|Ga0311364_12333705All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria522Open in IMG/M
3300031715|Ga0307476_10844382All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria677Open in IMG/M
3300031726|Ga0302321_101670711All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria736Open in IMG/M
3300031833|Ga0310917_10953202All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria576Open in IMG/M
3300031938|Ga0308175_102388003All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria592Open in IMG/M
3300032076|Ga0306924_11042895All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria895Open in IMG/M
3300032897|Ga0335071_10271237All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. Sm61650Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil10.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.53%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.98%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere5.43%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil4.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.10%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.88%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen2.33%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.33%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.33%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.55%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.55%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost1.55%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.55%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.55%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.55%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.55%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.55%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.55%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.55%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.55%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.55%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.55%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.55%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.55%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.78%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.78%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.78%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.78%
Deep Oceanic, Basalt-Hosted Subsurface Hydrothermal FluidEnvironmental → Aquatic → Marine → Volcanic → Unclassified → Deep Oceanic, Basalt-Hosted Subsurface Hydrothermal Fluid0.78%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.78%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.78%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.78%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.78%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.78%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.78%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.78%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.78%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.78%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.78%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.78%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.78%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.78%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.78%
Indoor Hospital AirEnvironmental → Air → Indoor Air → Unclassified → Unclassified → Indoor Hospital Air0.78%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.78%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.78%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.78%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.78%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.78%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.78%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.78%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.78%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.78%
Anaerobic Digestor SludgeEngineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge0.78%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908043Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active Layer A2EnvironmentalOpen in IMG/M
2170459010Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!)EnvironmentalOpen in IMG/M
3300001664Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - 5cm_reassembledEnvironmentalOpen in IMG/M
3300002532Deep oceanic, basalt-hosted subsurface ecosystem from Juan de Fuca Ridge flank, Pacific Ocean, CORK Borehole 1362B_J2.571EnvironmentalOpen in IMG/M
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300003659Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006864Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193EnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300007788Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2EnvironmentalOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009624Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10EnvironmentalOpen in IMG/M
3300009768Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC115_MetaGEngineeredOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010321Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012008Permafrost microbial communities from Nunavut, Canada - A39_80cm_12MEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014499Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014587Indoor hospital air microbial communities from San Diego, USA - 248_D2_2014-9-5EnvironmentalOpen in IMG/M
3300015199Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-2c, rock/snow interface)EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300019996Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a2EnvironmentalOpen in IMG/M
3300021082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redoEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300022529Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022911Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L064-202C-5EnvironmentalOpen in IMG/M
3300023068Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 20-24EnvironmentalOpen in IMG/M
3300025893Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026274Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-059 (SPAdes)EnvironmentalOpen in IMG/M
3300026277Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026306Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes)EnvironmentalOpen in IMG/M
3300026515Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-AEnvironmentalOpen in IMG/M
3300026527Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027334Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027505Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027651Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027676Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027861 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MGEnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028720Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357EnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030646Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_2EnvironmentalOpen in IMG/M
3300031232Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3EnvironmentalOpen in IMG/M
3300031235Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaGHost-AssociatedOpen in IMG/M
3300031239Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaGHost-AssociatedOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031521III_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
A2_c1_006419902124908043SoilAARHRVVIGDQNAGSHGVPRALQLSVSNRGTLADAD
F62_083399002170459010Grass SoilVFNQTALYGVVIGNQNGGSHGFPRTLQLSVSNRGTLADAD
P5cmW16_100349843300001664PermafrostLHHVLDQAALDRVVIDNQNGRRHGFPRTLQLFVSNRGTLADAD*
JGI24019J35510_102288123300002532Deep Oceanic, Basalt-Hosted Subsurface Hydrothermal FluidLHHILDEAPLYGIVVGNQNGRNHGIPRNSGLSQQHVSNRGTLADAD*
JGIcombinedJ51221_1047620923300003505Forest SoilHYRLIAAFLHHILDQAPLYGIIVGDQNAGSHGFPRNATLFVSNRGTLADAD*
JGI25404J52841_1007823023300003659Tabebuia Heterophylla RhizosphereLHHVFNQATLHGVIVGDQDGGSHWHSPHVTNLPVPNRVTVADAD*
Ga0066395_1097692913300004633Tropical Forest SoilAFLHHVLDQTALYWIVVGDQNDGSHGFLPALLLFVSNRGTLADAD*
Ga0066679_1002255053300005176SoilIAAFLHHVFNQATLYGIVVGNQNGGSHGIPRTLQLSVSNRGTLADAD*
Ga0070683_10202246823300005329Corn RhizosphereAFLHHVLDQAALYGVVVGDQNAGSHGFPRALRLSVSNRGTVADAD*
Ga0066388_10136891413300005332Tropical Forest SoilAAFLHHVFNEATLNGVIVGNQDGGSHGTPRTYKLSVPNRGTVDDAD*
Ga0070685_1032501623300005466Switchgrass RhizosphereDHDGFIAAFLHHVLNQATLYGVVVGNQNGGSHGIPRTLQLFVPNRGTVADAD*
Ga0066704_1057200023300005557SoilFLHHVFDQAARYGVIVGDQNAGSHGVPRTLQLSVSNRGTLAEAD*
Ga0068852_10257317323300005616Corn RhizosphereLYGVVIGNQNGGSHGFPHSLRLSVSNRGTLADAD*
Ga0079221_1086060623300006804Agricultural SoilQTARYGIVVGDQNAGSHGFPRNATLFVPNRGTFADAA*
Ga0066797_110523423300006864SoilFLHHILDQATLDRVVVCDQNAGSHGFPRTLQLSVSNRGNVADAD*
Ga0075424_10281397413300006904Populus RhizosphereVFNQTALNGVVIGNQDGGSHGFPRTLQLSVSNRGTLADAD*
Ga0099795_1027242013300007788Vadose Zone SoilLYGVVIGNQNGGSHGFPRTLRLSVSNRGTVSDAD*
Ga0105247_1022269123300009101Switchgrass RhizosphereLDRIIIGNQNTGSHGFPCTLRLSVSNRGTLADAD*
Ga0105247_1063582013300009101Switchgrass RhizosphereLDQTALYWIVVGDQNGGSHGFPPALLLSVSNRGTVADGD*
Ga0099792_1051753313300009143Vadose Zone SoilLLHHVFNQATLYGVVVGNQNGGSHGVPRTLQLSVSNRGTLADAD*
Ga0105243_1160807023300009148Miscanthus RhizosphereEGLITAFLHHVFNQTALYGVIVGNQNGGDHGFPRALRLSVSNRGTVADAD*
Ga0105237_1073346113300009545Corn RhizosphereSLIAAFLHHILDEAALYGVVVCDQNAGSHGFPRNATLFVPNRGTFADAA*
Ga0105237_1077032723300009545Corn RhizosphereAAFLNHVLYQPALDRIIISNQNTGSHGFPCTLRLSVSNRGTLADAD*
Ga0105238_1028839513300009551Corn RhizosphereDQAALYGVVVGDQNAGSHGFPRALLLSVSNRGTVADAD*
Ga0105238_1048909123300009551Corn RhizosphereLYGVVVGNQNGGSHGFPRTFLLSVSNRGTLADAD*
Ga0116105_120785523300009624PeatlandFDQAALYCVVIGNQNANRHGFPRALQLSVSNRVTVADAD*
Ga0116193_109177113300009768Anaerobic Digestor SludgeHVFDEAALYGVVIGKQNGRNHGIPRNSGLSQQHVSNRGTLADAD*
Ga0126314_1149251113300010042Serpentine SoilAAFLHHVFDEPALYRVIVGDQNAGSHGFPRALQLSVSNRGTLADAD*
Ga0134067_1034422413300010321Grasslands SoilQAPCHSVVIDNQNAGSHGFPRTLQLSVLNRGTLADAD*
Ga0134125_1228530023300010371Terrestrial SoilGFLHHVLDQTALDCVIIDNQNGRRHGFPNLVQLFVSNRGTVADAD*
Ga0134128_1197973813300010373Terrestrial SoilATLDRIVVGDQNAGSHGFARTLQLSVSSRGTVAAAD*
Ga0105239_1159233323300010375Corn RhizosphereGYGVVVGDQNTGSHGVPRTLLLSVSNRGTLAEAD*
Ga0126381_10435971223300010376Tropical Forest SoilLIAAFLHHILDQAPLYGVIVGDQNAGSHGFPRNATLFVSNRGTLADAD*
Ga0134126_1028633713300010396Terrestrial SoilHIFDEAPLDGVIIGDQNAGSHGFPRNATLSVSNRGTLADAD*
Ga0134126_1245045323300010396Terrestrial SoilALDCVIIDNQNGRRHGFPHTLQLVVSNRGTLADAD*
Ga0126383_1202793413300010398Tropical Forest SoilVDNNRLITAFLHHVLDKAALYGVVVGDQNAGSHGFTPRATLSVSNRGNVADTD*
Ga0134127_1260925113300010399Terrestrial SoilQATLYGVVVGNQYGGSHGIPRTLQLFVPNRGTVADAD*
Ga0134123_1332696523300010403Terrestrial SoilVFNQTALHGVVVGNQNGGSHGIPRTLQLFVPNRGTVADAD*
Ga0105246_1018972113300011119Miscanthus RhizosphereHVFNQTALYGVVVGNQNGGSHGFPHTLQLSVSNRGTLADAD*
Ga0105246_1060181223300011119Miscanthus RhizosphereLYGVVVGNQNGGSHGIPRTLQLFVPNRGTVADAD*
Ga0137391_1083600213300011270Vadose Zone SoilRYRVVVGNQNGGSHGIPRTLRLFVSNRGTLADAD*
Ga0120174_105397023300012008PermafrostMAIAASAGIDDDGVIAAFLHHVFDQAAGDRVVVDNQNAGSHGFPRALQLSVSNRGNLADAD*
Ga0137362_1082357713300012205Vadose Zone SoilLDQAPCHSVVIDNQNAGSHGFPRTLQLFVLNRGTLADAD*
Ga0137376_1067904913300012208Vadose Zone SoilTARYRVVVGNQNAGSHGFPRAVQLFVLNRGTLADAD*
Ga0137371_1076240113300012356Vadose Zone SoilRLIAAFLHHVLDLAPCHSGGIDNQNAGSHGFPRTLQLSVLNRGTLADAD*
Ga0150984_11931152113300012469Avena Fatua RhizospherePAGYSVVVGDQNTGSHGVPRTLLLSVSNRGTLAEAD*
Ga0137358_1047314713300012582Vadose Zone SoilTALYRIVVGDQNGGCHGFPPALLLFVSNRGTLADAD*
Ga0137398_1036747723300012683Vadose Zone SoilFNQTTLYGVVVGNQNGGSHGFPRTLRLSVSNRGTVADAD*
Ga0137413_1042205313300012924Vadose Zone SoilFKRALIGINQNAGSHGFPRTLQLAVLNRGTLADAD*
Ga0137410_1072428823300012944Vadose Zone SoilDHLRFIAAFLHHVFDQATLYGIVVGNQNGSSHGIPRTLQLSVSNRGTLADAD*
Ga0137410_1131164613300012944Vadose Zone SoilLYRVVIGNQNGGSHGFPRTLQLSVSNRGTLADAD*
Ga0164300_1057749723300012951SoilGITAFDHEGLITAFLHHVFNQTALYGVIIGNQNGGDHGFPRALRLSVSNRGTLADAD*
Ga0164301_1183092623300012960SoilFLHHVFNQTALYGVIIGNQNGGDHGFPRALRLLVSNRGTLADAD*
Ga0164304_1123200823300012986SoilGVDDDGLIAAFLNHVFDQTALDRIVVGDQNAGSHGFPRTLRLSVLNRGTVADAD*
Ga0164306_1121228023300012988SoilAAALHHVFDQAARYRVIIGNQNGRSHGIPRTLQLSVSNRGTLADAD*
Ga0164305_1109760523300012989SoilTAFLHHVFNQTALYGVIIGNQNGGNHGFPRVLRLSVSNRGTLAEAD*
Ga0164305_1218883713300012989SoilLYGVIIGNQNGGDHGFPRALRLFVSNRGTLADAD*
Ga0157371_1151228823300013102Corn RhizosphereILDQATLHGIVVGNQNGGGHGVPHALQLSVSNRGTLADAD*
Ga0163162_1032457613300013306Switchgrass RhizosphereAFNHEGLITAFLHHVFNQTALYGVIIGNQNGGNHGFPRALRLSVSNRGTLADAD*
Ga0157372_1097050513300013307Corn RhizosphereFLHHILDQTARYGIVVGDQNAGSHGFPRNATLFVPNRGTFADAA*
Ga0157375_1087447923300013308Miscanthus RhizosphereEGLIAALLHHVFNQTALYGVVIGNQNGGSHGFPRTLQLSVSNRGTLAEAD*
Ga0134078_1012601223300014157Grasslands SoilVDQPALYRVIVGYQNAGSHGFPRPLQLSVSNRGTLADAD*
Ga0181537_1026447323300014201BogVLDQSPLHGIVIGNQNTGSHGFPRALQLSVSNRGTLADAD*
Ga0163163_1150762313300014325Switchgrass RhizosphereALYGVVIGNQNGGSHGFPRTLQLSVSNRGTLAEAD*
Ga0182012_1027211423300014499BogAAFLNHVFEQAASHGIIVGDQNAGSHGFPRALLLSVSNRGTLADAD*
Ga0182024_1252685723300014501PermafrostAARHRIVIGNQNAGSHGIPRTLQLSVSNRGTLADAD*
Ga0135122_10472623300014587Indoor Hospital AirVDNGGFIAAFLHHVFNQATLYGVIVGDQNGGSHGTPRTLQLSVPNRGTVADAD*
Ga0167647_115211323300015199Glacier Forefield SoilFDQPALYGVVIDDQDAGSHGVPRTLQLSVSNRGTLADAD*
Ga0137403_1014801933300015264Vadose Zone SoilFNQTALYGVVVGNQNGGSHGFPRTLRLSVSNRGTLADAD*
Ga0137403_1030530613300015264Vadose Zone SoilFNQTALYGVVVGNQNGGSHGFPRTLQLSVSNRGTLADAD*
Ga0132256_10370868813300015372Arabidopsis RhizosphereAALDHQGLIAALLHHDFNQTALYGVIIGNQNGGDHGFPRALRLFVSNRGTFADAD*
Ga0132255_10428455723300015374Arabidopsis RhizosphereALYGVIIGNQNGGDHGFPRALRLFVSNRGTLADAD*
Ga0182037_1190087023300016404SoilVLEQPPGYSVVVGDQNTGSHGVPRTLLLFVSNRGTLAEAD
Ga0190266_1026229723300017965SoilFDQTPRYRIVIGNQNGRSHGFPRTLQLSVSNRGTLADAD
Ga0066667_1167041423300018433Grasslands SoilQTALYRVVVGNQNGGSHGFPRTLRLSVSNRGTLADAD
Ga0193693_102777213300019996SoilTALYGVVIGNQNGGSHGFPRTLQLSVSNRGTLADAD
Ga0210380_1005858323300021082Groundwater SedimentVFNQTALYGVVVGNQNGGSHGFPHTLQLSVSNRGTLADAD
Ga0210396_1055290623300021180SoilFLHHIFNQAALHRIVVGDQNGSSHGVPHTQQLSVSNRGTLADAD
Ga0210389_1039265713300021404SoilLDETTLYWIVVNDQNGGSHGFLPALILSVSNRGTLADAD
Ga0210387_1072210413300021405SoilQAARHGIVIGNQNAGSHGFPRALQLSVSNRGTLAEAD
Ga0210386_1156201823300021406SoilQATLHRVVVGDQNPGSHGVPHSLQLSVSNRGTLADAD
Ga0210394_1042617823300021420SoilHHILYQAALHGIVVGDQNGGRHGVPHTQQLSVSNRGTLADVD
Ga0210394_1101357323300021420SoilVLDQAALDRVVIDNQNGRRHGFPRTLQLFVSNRGTLADAD
Ga0210392_1089698813300021475SoilALYGVIVGDQNAGSHGFPRNATLSVPNRGTLADAD
Ga0210402_1083594823300021478SoilFNQAALYGVVVGDQNAGSHGVPRTLQLSVSNRGTVADAD
Ga0242668_113473713300022529SoilAALHGIVVGDQNGGRHGVPHTQQLSVSNRGTLADVD
Ga0247783_121350223300022911Plant LitterNQATLYGVVVGNQNGGSHGIPRTLQLFVPNRGTVADAD
Ga0224554_111308713300023068SoilLHHILDEAPLYGIVVGNQNGRNHGIPRNSGLSQQHVSNRGTLADAD
Ga0207682_1022512723300025893Miscanthus RhizosphereTLYGVVVGNQNGGSHGIPRTLQLFVPNRGTVADAD
Ga0207680_1043947113300025903Switchgrass RhizosphereKAALNGVVVGNQNGRSHGVPRTSQLSVSNRGTLADAD
Ga0207685_1043985423300025905Corn, Switchgrass And Miscanthus RhizosphereVLNQAALYGVVVGDQNAGSHGFPRALLLSVSNRGTVADAD
Ga0207685_1085663323300025905Corn, Switchgrass And Miscanthus RhizosphereEAALYGVVVGDQNAGNHGFPCNATLSVPNRGTLADAD
Ga0207671_1035516113300025914Corn RhizosphereDQPAGYSVVVGDQNTGSHGVPRTLLLSVSNRVTLAEAD
Ga0207671_1058917823300025914Corn RhizosphereHQTARYGIVVGDQNAGSHGFPRNATLFVPNRGTFADAA
Ga0207664_1159905413300025929Agricultural SoilLHHVFDKAALNRIVVRNQNGGSHGFPRALQLSVSNRGTLADAD
Ga0207704_1033558833300025938Miscanthus RhizosphereALYGVVVGNQNGGSHGFPHTLQLSVSNRGTLADAD
Ga0207661_1041472313300025944Corn RhizosphereQPACYGIVVGDQNTGSHGVPRTLLLSVSNRGTLAEAD
Ga0207667_1124038223300025949Corn RhizosphereTALHCVVIGNQNGGSHGFPRTLRLFVSNRGTLADAD
Ga0207702_1073684913300026078Corn RhizosphereDQTARYGIVVGDQNAGSHGFPRNATLFVPNRGTFADAA
Ga0207641_1230085223300026088Switchgrass RhizosphereQPALDRIIISNQNTGSHGFPCTLRLSVSNRGTLADAD
Ga0209888_105321423300026274Permafrost SoilFDQPALYGVVIDNQDAGSHGVPRTLQLSVSNRGTLADAD
Ga0209350_109703913300026277Grasslands SoilDQAPCHSVVIDNQNAGSHGFPRTLQLSVLNRGTLADAD
Ga0209468_112883823300026306SoilVVEQPALDRVVVGYQNAGSHGFPRALQLSVSNRGTLADAD
Ga0257158_106910913300026515SoilNEAALYGVVVGDQNAGSHGVPRTLQLSVSNRGTVADAD
Ga0209059_117961413300026527SoilALYGIVVGDQNAGSHGVPRTQQLSVSNRGTLADAD
Ga0179587_1113773413300026557Vadose Zone SoilTLHRVVIGDQNAGSHGVPHSLQLSVSNRGTLADAD
Ga0209529_101963523300027334Forest SoilLYQAALHCIVVGDQNGGRHGVPHTQQLSVSNRGTLADVD
Ga0209218_106372523300027505Forest SoilQAALHSIVVGDQNGGRHGVPHTQQLSVSNRGTLADVD
Ga0209217_121549813300027651Forest SoilQAACHRIVVGNQNAGSHGVPRTLQLSVSNRGTVADAD
Ga0209333_113384613300027676Forest SoilYHILYQAALHCIVVGDQNGGRHGVPHTQQLSVSNRGTLADVD
Ga0209274_1029089313300027853SoilNQAALHGIVVGDQNGGRHGVPHTQQLSVSNRGTLADVD
(restricted) Ga0233415_1032495723300027861SeawaterLDQPAGYSVVVGDQNTGSHGVPRTLLLSVSNRGTLAEAD
Ga0268266_1184839913300028379Switchgrass RhizosphereFYQTTLYGVIIGDQNGGSHGFPRTLRLFVSNRGTVADAD
Ga0268265_1198989623300028380Switchgrass RhizosphereTRYRIVIGNQNGRSHGFPRTLQLSVSNRGTLADAD
Ga0307317_1017039613300028720SoilALYRIIVGDQNAGSHGFPRALQLSVSNRGTLADAD
Ga0311355_1098430223300030580PalsaILNQPALHCIVVGDQNGGGHGVPHTQQLSVSNRGTLADAD
Ga0302316_1047490623300030646PalsaHHVFDQAARHSIVIGNQNAGRHGFPRALQLSVSNRGTLADAD
Ga0302323_10257878413300031232FenQTALYRVVVDNQNGGSHGFPRTLRLSVSNRGTVADAD
Ga0265330_1001945453300031235RhizosphereDQAAGDRIVVDNQNAGSHGFPRALQLSVSNRGNLADAD
Ga0265328_1006709923300031239RhizosphereQAAGDRIVVDNQNAGSHGFPRALQLSVSNRGNLADAD
Ga0170820_1276478013300031446Forest SoilQAARHRVVVGNQNAGSHGFPRALQLSVSNRGTLADAD
Ga0170820_1478334823300031446Forest SoilSLHHILDQATLHCIVVGDQNAGSHGIPHALQLSVSNRGTLADAD
Ga0311364_1233370513300031521FenQAAGHRVVVGDQNAGSHGVPRALQLSVSNRGTLADAD
Ga0307476_1084438223300031715Hardwood Forest SoilHIFYQAALHRIVVGDQNGGSHGVPHMQQLSVSNRGTLADAD
Ga0302321_10167071123300031726FenDQAARHRVVIGDQNAGSHGVPRALQLSVSNRGTLADAD
Ga0310917_1095320213300031833SoilLDEAALHGIIISDQNCGGHGFPPAMRLCVSNRGTLADEA
Ga0308175_10238800323300031938SoilLHHVLDQAPRYGIIVGDQNTGSHGVPRTLLLFVSNRGTLAEAD
Ga0306924_1104289513300032076SoilTALYGVIVGDQNAGSHGFPRNATLFVSNRGTLADAD
Ga0335071_1027123713300032897SoilLYQPALHGIVVGDQNAGSHGFTPHATLCVSNRGNVADTD

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.