Basic Information | |
---|---|
Family ID | F063950 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 129 |
Average Sequence Length | 43 residues |
Representative Sequence | MRDQAIGQPDVRSLALAEPTQHVRHRWIIGLTLASLGMWMATQ |
Number of Associated Samples | 114 |
Number of Associated Scaffolds | 129 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 79.07 % |
% of genes near scaffold ends (potentially truncated) | 99.22 % |
% of genes from short scaffolds (< 2000 bps) | 93.02 % |
Associated GOLD sequencing projects | 107 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.42 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (79.070 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (21.705 % of family members) |
Environment Ontology (ENVO) | Unclassified (17.829 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.364 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.48% β-sheet: 0.00% Coil/Unstructured: 53.52% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 129 Family Scaffolds |
---|---|---|
PF02771 | Acyl-CoA_dh_N | 44.19 |
PF00583 | Acetyltransf_1 | 13.18 |
PF13581 | HATPase_c_2 | 2.33 |
PF03551 | PadR | 1.55 |
PF13673 | Acetyltransf_10 | 1.55 |
PF03109 | ABC1 | 1.55 |
PF04030 | ALO | 0.78 |
PF13635 | DUF4143 | 0.78 |
PF05223 | MecA_N | 0.78 |
PF08281 | Sigma70_r4_2 | 0.78 |
PF12323 | HTH_OrfB_IS605 | 0.78 |
PF01717 | Meth_synt_2 | 0.78 |
PF00005 | ABC_tran | 0.78 |
PF12679 | ABC2_membrane_2 | 0.78 |
PF00296 | Bac_luciferase | 0.78 |
PF00082 | Peptidase_S8 | 0.78 |
PF00905 | Transpeptidase | 0.78 |
PF02687 | FtsX | 0.78 |
PF03029 | ATP_bind_1 | 0.78 |
COG ID | Name | Functional Category | % Frequency in 129 Family Scaffolds |
---|---|---|---|
COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 44.19 |
COG0661 | Predicted protein kinase regulating ubiquinone biosynthesis, AarF/ABC1/UbiB family | Signal transduction mechanisms [T] | 1.55 |
COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 1.55 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 1.55 |
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 1.55 |
COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.78 |
COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 0.78 |
COG1100 | GTPase SAR1 family domain | General function prediction only [R] | 0.78 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.78 |
COG2229 | Signal recognition particle receptor subunit beta, a GTPase | Intracellular trafficking, secretion, and vesicular transport [U] | 0.78 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 79.07 % |
Unclassified | root | N/A | 20.93 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2199352025|deepsgr__Contig_143734 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
3300000567|JGI12270J11330_10254485 | Not Available | 564 | Open in IMG/M |
3300000955|JGI1027J12803_106872147 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
3300001356|JGI12269J14319_10293614 | Not Available | 588 | Open in IMG/M |
3300003505|JGIcombinedJ51221_10019639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2354 | Open in IMG/M |
3300004091|Ga0062387_100300372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1034 | Open in IMG/M |
3300004092|Ga0062389_100371733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1536 | Open in IMG/M |
3300004092|Ga0062389_104456977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 527 | Open in IMG/M |
3300004152|Ga0062386_101040730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 679 | Open in IMG/M |
3300004635|Ga0062388_102426024 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300005445|Ga0070708_101993797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 537 | Open in IMG/M |
3300005467|Ga0070706_100167706 | All Organisms → cellular organisms → Bacteria | 2050 | Open in IMG/M |
3300005560|Ga0066670_10749181 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 592 | Open in IMG/M |
3300005569|Ga0066705_10414311 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 844 | Open in IMG/M |
3300005610|Ga0070763_10049313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1997 | Open in IMG/M |
3300005842|Ga0068858_101514719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 661 | Open in IMG/M |
3300006052|Ga0075029_100776552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 651 | Open in IMG/M |
3300006174|Ga0075014_100566463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 645 | Open in IMG/M |
3300006755|Ga0079222_11130436 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 692 | Open in IMG/M |
3300006854|Ga0075425_102346197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 592 | Open in IMG/M |
3300006904|Ga0075424_101940061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 622 | Open in IMG/M |
3300009093|Ga0105240_11295434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 769 | Open in IMG/M |
3300009520|Ga0116214_1168262 | Not Available | 819 | Open in IMG/M |
3300009522|Ga0116218_1270933 | Not Available | 762 | Open in IMG/M |
3300009683|Ga0116224_10240529 | Not Available | 864 | Open in IMG/M |
3300009698|Ga0116216_10246067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 1093 | Open in IMG/M |
3300009792|Ga0126374_11039805 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
3300009824|Ga0116219_10225896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 1067 | Open in IMG/M |
3300010047|Ga0126382_11859307 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300010322|Ga0134084_10211846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 683 | Open in IMG/M |
3300010358|Ga0126370_10918689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 792 | Open in IMG/M |
3300010360|Ga0126372_11110277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 810 | Open in IMG/M |
3300010373|Ga0134128_11185186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 843 | Open in IMG/M |
3300010379|Ga0136449_100505655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2096 | Open in IMG/M |
3300010379|Ga0136449_100905172 | All Organisms → cellular organisms → Bacteria | 1437 | Open in IMG/M |
3300010379|Ga0136449_104063326 | Not Available | 545 | Open in IMG/M |
3300010876|Ga0126361_10690462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1635 | Open in IMG/M |
3300012205|Ga0137362_11548857 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
3300012210|Ga0137378_11793107 | Not Available | 518 | Open in IMG/M |
3300012356|Ga0137371_10894923 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
3300012359|Ga0137385_10582273 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 942 | Open in IMG/M |
3300012514|Ga0157330_1034951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 649 | Open in IMG/M |
3300012960|Ga0164301_10215797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1235 | Open in IMG/M |
3300015264|Ga0137403_11394673 | Not Available | 549 | Open in IMG/M |
3300015356|Ga0134073_10236697 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
3300015373|Ga0132257_104066299 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300016319|Ga0182033_11018438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 737 | Open in IMG/M |
3300016357|Ga0182032_10817425 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
3300017822|Ga0187802_10280320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 648 | Open in IMG/M |
3300017823|Ga0187818_10364735 | Not Available | 639 | Open in IMG/M |
3300017926|Ga0187807_1067752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1110 | Open in IMG/M |
3300017937|Ga0187809_10435593 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300017955|Ga0187817_10149163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1486 | Open in IMG/M |
3300017970|Ga0187783_10296974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1178 | Open in IMG/M |
3300017972|Ga0187781_11258425 | Not Available | 545 | Open in IMG/M |
3300017975|Ga0187782_10434118 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1000 | Open in IMG/M |
3300018001|Ga0187815_10210995 | Not Available | 822 | Open in IMG/M |
3300018062|Ga0187784_10656613 | Not Available | 841 | Open in IMG/M |
3300018086|Ga0187769_10465399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 953 | Open in IMG/M |
3300018468|Ga0066662_12724759 | Not Available | 523 | Open in IMG/M |
3300019787|Ga0182031_1554296 | Not Available | 1727 | Open in IMG/M |
3300020581|Ga0210399_10070565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2828 | Open in IMG/M |
3300020581|Ga0210399_10579906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 929 | Open in IMG/M |
3300020582|Ga0210395_10342942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1124 | Open in IMG/M |
3300021384|Ga0213876_10073319 | Not Available | 1808 | Open in IMG/M |
3300021401|Ga0210393_11360733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 568 | Open in IMG/M |
3300021403|Ga0210397_11577546 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 510 | Open in IMG/M |
3300021405|Ga0210387_10072454 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2821 | Open in IMG/M |
3300021405|Ga0210387_10758281 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 858 | Open in IMG/M |
3300021433|Ga0210391_10582749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 878 | Open in IMG/M |
3300021474|Ga0210390_10265529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1454 | Open in IMG/M |
3300021474|Ga0210390_11425140 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300021477|Ga0210398_10331493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium | 1241 | Open in IMG/M |
3300022532|Ga0242655_10300134 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
3300025634|Ga0208589_1110799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 641 | Open in IMG/M |
3300025928|Ga0207700_10648249 | Not Available | 941 | Open in IMG/M |
3300025929|Ga0207664_11079003 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
3300026023|Ga0207677_10880488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 806 | Open in IMG/M |
3300026142|Ga0207698_10431528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1267 | Open in IMG/M |
3300026490|Ga0257153_1076337 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
3300027604|Ga0208324_1209939 | Not Available | 514 | Open in IMG/M |
3300027857|Ga0209166_10407944 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 705 | Open in IMG/M |
3300027879|Ga0209169_10452480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 675 | Open in IMG/M |
3300027884|Ga0209275_10422046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 754 | Open in IMG/M |
3300028072|Ga0247675_1045329 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
3300028709|Ga0307279_10086441 | Not Available | 566 | Open in IMG/M |
3300030494|Ga0310037_10207643 | Not Available | 865 | Open in IMG/M |
3300030580|Ga0311355_10757209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 896 | Open in IMG/M |
3300030706|Ga0310039_10110249 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1143 | Open in IMG/M |
3300031184|Ga0307499_10171726 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
3300031234|Ga0302325_12836932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 566 | Open in IMG/M |
3300031564|Ga0318573_10594139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 596 | Open in IMG/M |
3300031572|Ga0318515_10725330 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300031708|Ga0310686_102415804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1572 | Open in IMG/M |
3300031708|Ga0310686_114209852 | Not Available | 923 | Open in IMG/M |
3300031708|Ga0310686_114969352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1134 | Open in IMG/M |
3300031715|Ga0307476_11391245 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 511 | Open in IMG/M |
3300031724|Ga0318500_10322970 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 759 | Open in IMG/M |
3300031744|Ga0306918_11251853 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 572 | Open in IMG/M |
3300031747|Ga0318502_10401491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 815 | Open in IMG/M |
3300031747|Ga0318502_10910990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 535 | Open in IMG/M |
3300031753|Ga0307477_10452479 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 876 | Open in IMG/M |
3300031765|Ga0318554_10202512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1130 | Open in IMG/M |
3300031768|Ga0318509_10182625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1164 | Open in IMG/M |
3300031769|Ga0318526_10173547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 879 | Open in IMG/M |
3300031805|Ga0318497_10544921 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 650 | Open in IMG/M |
3300031805|Ga0318497_10848768 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300031846|Ga0318512_10587118 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 568 | Open in IMG/M |
3300031859|Ga0318527_10302590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 681 | Open in IMG/M |
3300031879|Ga0306919_10189603 | Not Available | 1522 | Open in IMG/M |
3300031890|Ga0306925_11678671 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300031910|Ga0306923_10114147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3058 | Open in IMG/M |
3300031910|Ga0306923_10943473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 942 | Open in IMG/M |
3300031938|Ga0308175_100722029 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1084 | Open in IMG/M |
3300032059|Ga0318533_10540228 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 855 | Open in IMG/M |
3300032076|Ga0306924_10005379 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 12605 | Open in IMG/M |
3300032160|Ga0311301_10793794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1303 | Open in IMG/M |
3300032261|Ga0306920_100496854 | Not Available | 1810 | Open in IMG/M |
3300032770|Ga0335085_11759244 | Not Available | 636 | Open in IMG/M |
3300032770|Ga0335085_12341089 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300032805|Ga0335078_12731033 | Not Available | 502 | Open in IMG/M |
3300032828|Ga0335080_10689762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1065 | Open in IMG/M |
3300032828|Ga0335080_12124010 | Not Available | 541 | Open in IMG/M |
3300032892|Ga0335081_10117709 | All Organisms → cellular organisms → Bacteria | 3893 | Open in IMG/M |
3300032892|Ga0335081_11206141 | Not Available | 862 | Open in IMG/M |
3300032892|Ga0335081_11293620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 823 | Open in IMG/M |
3300033134|Ga0335073_12097579 | Not Available | 512 | Open in IMG/M |
3300033158|Ga0335077_10058661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4647 | Open in IMG/M |
3300033290|Ga0318519_10952011 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 21.71% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 10.85% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 7.75% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.43% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.65% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.10% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.88% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.88% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.33% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.33% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.33% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.55% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.55% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.55% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.55% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.55% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.78% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.78% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.78% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.78% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.78% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.78% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.78% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.78% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.78% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.78% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.78% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.78% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.78% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.78% |
Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.78% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.78% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.78% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012514 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.1.old.130510 | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300025634 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300028072 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK16 | Environmental | Open in IMG/M |
3300028709 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_118 | Environmental | Open in IMG/M |
3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
deepsgr_02348120 | 2199352025 | Soil | MRDQTVGPADALSLALAEPDRHVRHRWILGLTLASLGMW |
JGI12270J11330_102544851 | 3300000567 | Peatlands Soil | MRDQAIGQPDVSSLALAEPTRHVRHRWIVGLTLASLGMWMAN |
JGI1027J12803_1068721472 | 3300000955 | Soil | MRDQTVGPADALSLALAEPDQHVRRRWILGLTLASLG |
JGI12269J14319_102936142 | 3300001356 | Peatlands Soil | MRDQAIGQPDVSSLALAEPTRHVRHRWIVGLTLASLGMWMA |
JGIcombinedJ51221_100196394 | 3300003505 | Forest Soil | MRHDPAMADQVIGQPDVQSLALAEPTQQVRIRWIVTLTLASLG |
Ga0062387_1003003723 | 3300004091 | Bog Forest Soil | MDQAIGQTQPQSLALAEPTQHVRVRWIITLTLASLGMWMANQTPSQV |
Ga0062389_1003717331 | 3300004092 | Bog Forest Soil | MDQAISQPEVQSLALAEPTQHVRIRWIITLTLASLGMWMANQ |
Ga0062389_1044569772 | 3300004092 | Bog Forest Soil | MADQAISQPDVQSLALAEPTQHVRVRWIVVLTLASLGMWMANQTPSQVLLAL |
Ga0062386_1010407302 | 3300004152 | Bog Forest Soil | MRDQVIGQPDVHSPALAEPTQHVRSRWITGLALASLGMWM |
Ga0062388_1024260242 | 3300004635 | Bog Forest Soil | MRDQAIGQPGVGSLALAEPTQYVRYRWITGLALASLGMWMATQT |
Ga0070708_1019937971 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MIHVMRDLTIGQADALSLALAEPDQHVRHRWILGLTLASLGMWMATQTPLQVM |
Ga0070706_1001677063 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MADQVIGQPDVQSLALAEPTQHVRVRWLFGLTLASLGMWMA |
Ga0066670_107491811 | 3300005560 | Soil | MRDQTVGPADALSLALAEPDQHVRRRWILGLTLASLGMWMATQTPLQ |
Ga0066705_104143111 | 3300005569 | Soil | MRETIGQADALSLALAEPDQHVRHRWILGLTLASLGMWMATQTPLQVMLA |
Ga0070763_100493131 | 3300005610 | Soil | VRDQAIGQPDAASLALAEPTKFVRNRWVIGLTLASLGMWMA |
Ga0068858_1015147191 | 3300005842 | Switchgrass Rhizosphere | MRDQTVGPADALSLALAEPDQHVRRRWILGLTLASL |
Ga0075029_1007765521 | 3300006052 | Watersheds | MRDQAIGQPDVSSLALAEPTRHVRHRWIVGLTLASLGMWMANQT |
Ga0075014_1005664632 | 3300006174 | Watersheds | MADQAIGQPQVQSLALAEPDQHVRIRWIVYLTLASLGMWMANQTPS |
Ga0079222_111304362 | 3300006755 | Agricultural Soil | MRETIGQADALSLALAEPDQHVRHRWILGLTLASLGMWMATQTPLQVMLALQLQD |
Ga0075425_1023461972 | 3300006854 | Populus Rhizosphere | MTDQTIGQPDVQSLALAEPTEHVRRRWVFGLTLASLGMWMATQTP |
Ga0075424_1019400612 | 3300006904 | Populus Rhizosphere | MRDQTIGQADALSRALAEPTEHVRRRWVFGLALASLGMWMATQTP |
Ga0105240_112954342 | 3300009093 | Corn Rhizosphere | MRDQTVGPADALSLALAEPDQHVRRRWILGLTLASLGMW |
Ga0116214_11682622 | 3300009520 | Peatlands Soil | MRDEAIGRPDVGSLALAEPTVHVRPRWIVGLTLAMLG |
Ga0116218_12709331 | 3300009522 | Peatlands Soil | MRDQAIGQPDVSSLALAEPTRHVRHRWIVGLTLASLGMWLANQTP |
Ga0116224_102405291 | 3300009683 | Peatlands Soil | MRDQAIGQPDVSSLALAEPTRHVRRRWIVGLTLASLGMWM |
Ga0116216_102460672 | 3300009698 | Peatlands Soil | MRDQAIGQPDVSSLALAEPTRHVRRRWIVGLTLASLG |
Ga0126374_110398051 | 3300009792 | Tropical Forest Soil | MTDQTIGQPDVLSLALAEPTQHVRRGWIVGLTLASLGMWMA |
Ga0116219_102258961 | 3300009824 | Peatlands Soil | MRDQAIGQPDVSSLALAEPTRHVRRRWIVGLTLASLGMWMANQT |
Ga0126382_118593071 | 3300010047 | Tropical Forest Soil | MSDQVIGPPDVQSPALAEPTQHVRYRWIVGLTLASLGMWM |
Ga0134084_102118461 | 3300010322 | Grasslands Soil | MRETIGQADALSLALAEPDQHVRHRWILGLTLASL |
Ga0126370_109186891 | 3300010358 | Tropical Forest Soil | MRDQTVGPADALSLALAEPDQHVRHRWILGLTLASLGMWMAMQ |
Ga0126372_111102772 | 3300010360 | Tropical Forest Soil | MRHDLGDEGVMRDQTVGPADALSLALAEPDQHVRHRWILGLTLASLGMWMA |
Ga0134128_111851862 | 3300010373 | Terrestrial Soil | MRDQTIGPPDVQSLALAEPTEHVRHRWVYGLTLASLGMWMATQTPQ |
Ga0136449_1005056551 | 3300010379 | Peatlands Soil | MRDQAIGQPDVSSLALAEPTRHVRHRWIVGLTLAS |
Ga0136449_1009051721 | 3300010379 | Peatlands Soil | MRDQAIGQPEVSSLALAEPTRHVRRRWIVGLTLASLGMWMANQT |
Ga0136449_1040633262 | 3300010379 | Peatlands Soil | MRDQAIGQPDLSLALAEPTQHVRRRWIIGLTLASLGMWMATQTP |
Ga0126361_106904623 | 3300010876 | Boreal Forest Soil | MADQVIGQPDVQSLALAEPTQQVRVRWIVTLTLASLGMWMANQTPSQVLLALQL |
Ga0137362_115488571 | 3300012205 | Vadose Zone Soil | MRHHPAMADQVIGQPDVQSLALAEPTQHVRIRWIIGLTLASL |
Ga0137378_117931072 | 3300012210 | Vadose Zone Soil | MRDQTIGQADALSLALAEPDQHVRHRWILGLTLASLGMWMA |
Ga0137371_108949232 | 3300012356 | Vadose Zone Soil | MRDQTTGQADALSLALAEPDQHVRHRWILGLTLASLGMWMATQTPLQV |
Ga0137385_105822731 | 3300012359 | Vadose Zone Soil | MRDQVIGQPDVSSLALAEPIQHVRHRWVIGLTLASLG |
Ga0157330_10349512 | 3300012514 | Soil | MRDQAVGPADALSLALAEPDQHVRHRWILGLTLASLG |
Ga0164301_102157971 | 3300012960 | Soil | MRDQTVGQADALSLALAEPDQHVRRRWILGLTLASLGMWMA |
Ga0137403_113946731 | 3300015264 | Vadose Zone Soil | MGDQTIGQPGVQSLALAEPTEHVRRRWIFGLALASL |
Ga0134073_102366971 | 3300015356 | Grasslands Soil | MRDQTVGPADALSLALAEPDQHVRRRWILGLTLASLGM |
Ga0132257_1040662991 | 3300015373 | Arabidopsis Rhizosphere | MSDQAIGQQDVQSLARAEPTQHVRYRWIVGLTLASLGMWMATQT |
Ga0182033_110184382 | 3300016319 | Soil | MSDQAIGQPDVQSLALAEPTQHVRYRWIVGLTLASLGMWMATQTP |
Ga0182032_108174252 | 3300016357 | Soil | MSDQVIGQPDVQSLALAEPTRHVRYRWIVGLTLASLGMWMATQ |
Ga0187802_102803202 | 3300017822 | Freshwater Sediment | VADQVVGQPKVQSLALAEPSQHVRIRWIIWLTLASLGMWMA |
Ga0187818_103647352 | 3300017823 | Freshwater Sediment | MRDQAIGQPDVSSLALAEPTRHVRHRWIVGLTLASLGMWM |
Ga0187807_10677521 | 3300017926 | Freshwater Sediment | MGQAISQPDVQSLALAEPNQHVRIRWIIYLTLASLGMWMATQ |
Ga0187809_104355931 | 3300017937 | Freshwater Sediment | MSDQVIGQPGVQSPALAEPTQHVRYRWIVGLTLASL |
Ga0187817_101491634 | 3300017955 | Freshwater Sediment | MDQAISQPDVRSPALAEPTEHVRIRWILGLTLASLGMWMANQTPSQV |
Ga0187783_102969743 | 3300017970 | Tropical Peatland | MRDEAIGRPDADSRALAEPVQFVRYRWILGLSLASLGMWMANQTPSQVMLAL |
Ga0187781_112584252 | 3300017972 | Tropical Peatland | MRDQVIGQQDALTLALAEPTRHVRYRWIFGLTLASLGMWMATQTPL |
Ga0187782_104341183 | 3300017975 | Tropical Peatland | MRDQAIGEPDVRSLALAEPTRHVRYGWIIGLTLASLGMWMATQTPL |
Ga0187815_102109952 | 3300018001 | Freshwater Sediment | MRDEAIDRPDVRSLALAEPTTHVRPRWIVGLTLAMLGMWMA |
Ga0187784_106566131 | 3300018062 | Tropical Peatland | MRDEAIGRTGVRSLALAEPTNHVRNRWIVGLVLASLGMWMANQTPSQ |
Ga0187769_104653992 | 3300018086 | Tropical Peatland | MRHDPAMRDQAIGQPDVASLALAEPTRHVRYRWITGLTLASLGM |
Ga0066662_127247591 | 3300018468 | Grasslands Soil | MRETIGQADALSLALAEPDQHVRHRWILGLTLASLGMWMATQTP |
Ga0182031_15542962 | 3300019787 | Bog | MRDQARGQPDVLSLALAEPTQHVRYRWITGLSLASLGM |
Ga0210399_100705651 | 3300020581 | Soil | MADQVIGQPDVQSLALAEPTQHVRIRWIVTLTLASLGMWMANQTPSQVML |
Ga0210399_105799062 | 3300020581 | Soil | MSDQTIGQPDVQSLALAEPTQHVRYRWIVGLTLASLGMWMATQTPLQGML |
Ga0210395_103429422 | 3300020582 | Soil | MRETIGQADALSLALAEPDQHVRRRWILGLTLASLGMWMATQTP |
Ga0213876_100733192 | 3300021384 | Plant Roots | MSDQTVGQEDVQPAALAEPIQYVRYRWISGLTLASLGMWMATQTPL |
Ga0210393_113607331 | 3300021401 | Soil | MRHDPAMADQVIGQPGVQSLALAEPTQQVRIRWIV |
Ga0210397_115775462 | 3300021403 | Soil | MADQVIGQPDVQSLALAEPTQHVRIRWIVTLTLASLGMWMANQTPSQVMLALQMQ |
Ga0210387_100724541 | 3300021405 | Soil | MADQVIGQPDVQSLALAEPTQHVRIRWIVTLTLASLGMWMANQTPSQVMLALQMQAIT |
Ga0210387_107582811 | 3300021405 | Soil | MADQVIGQPGVQSLALAEPTQQVRIRWIVTLTLASL |
Ga0210391_105827492 | 3300021433 | Soil | MRDQEIGQADVGSLALAEPTQHVRIRWIVTLTLASVGMWMANQTPSQVLLALQLQDI |
Ga0210390_102655291 | 3300021474 | Soil | MRHDPAMADQAISQPDVQSLALAEPTQHVRVRWIF |
Ga0210390_114251402 | 3300021474 | Soil | MSDQTIGQEDVQSLALAEPTQHVRYRWIVGLTLASLGMWMA |
Ga0210398_103314931 | 3300021477 | Soil | MAMRDDAIGQREVVSRALAEPDQHVRYRWIIGLTLASLGMW |
Ga0242655_103001341 | 3300022532 | Soil | DALSLALAEPDQHVRHRWILGLTLASLGMWMATQTPLQVMLALNMPVPYCVY |
Ga0208589_11107991 | 3300025634 | Arctic Peat Soil | MADQVIGQPGVQSLALAEPTQHVRVRWIITLTLASLGMWMANQTPSQVMLALQLQD |
Ga0207700_106482492 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MRDQTIGPPDVQSLALAEPTEHVRHRWVFGLTLASLGMWMA |
Ga0207664_110790032 | 3300025929 | Agricultural Soil | MRDQTVGPADALSLALAEPDQHVRRRWILGLTLASLGMWMA |
Ga0207677_108804881 | 3300026023 | Miscanthus Rhizosphere | MRDQTVGPADALSLALAEPDQHVRRHWILGLTLASL |
Ga0207698_104315282 | 3300026142 | Corn Rhizosphere | MRDQTVGPADALSLALAEPDQHVRRRWILGLTLASLGMWM |
Ga0257153_10763371 | 3300026490 | Soil | MRPSYVMIWVMRDQTIGQADALSLALAEPDQHVRRRWILGLTLASLGMWMATQTPLQ |
Ga0208324_12099391 | 3300027604 | Peatlands Soil | MRDQAIGQPDVSSLALAEPTRHVRHRWIVGLTLASLGMWLANQ |
Ga0209166_104079441 | 3300027857 | Surface Soil | MADQVIGQPDVQSLALAEPTQQVRVRWIVTLTLASLGMWMANQTP |
Ga0209169_104524801 | 3300027879 | Soil | MRHDPAMADQVVGQSDVQSLALAEPTQHVRIRWIFTLTLASLGMWMANQTPSQVMLAL |
Ga0209275_104220462 | 3300027884 | Soil | MRHDPAMADQAISQPDVQSLALAEPTQHVRIRWIFGLTLAS |
Ga0247675_10453291 | 3300028072 | Soil | MRDQTVGPADALSLALAEPDQHVRRRWILGLTLASLGMWMATQ |
Ga0307279_100864411 | 3300028709 | Soil | MRDQTVGQADALSLALAEPDQHVRRRWILGLTLASLGM |
Ga0310037_102076431 | 3300030494 | Peatlands Soil | MAAMRDQAIGQPDVSSLALAEPTRHVRRRWIVGLTLAS |
Ga0311355_107572092 | 3300030580 | Palsa | VRDQAIGQADVGSLALAEPTQFVRYRWVIGLTLASLGMWMA |
Ga0310039_101102491 | 3300030706 | Peatlands Soil | MDQAISQPDVQSLALAEPAEHVRIRWILGLTLASLGMWMANQTPSQVML |
Ga0307499_101717262 | 3300031184 | Soil | MRDQTIGQADALSLALAEPDRHVRHRWILGLTLASLGMWMAAQ |
Ga0302325_128369321 | 3300031234 | Palsa | MADQAISQPNVQSPALAEPTQHVRVRWIVVLTLASLGM |
Ga0318573_105941391 | 3300031564 | Soil | MADQVVGQPQAQSLALAEPDQHVRVRWIGYLTLASLGMWMA |
Ga0318515_107253301 | 3300031572 | Soil | MSGQVIGQPGVQSLALAEPTKHVRHRWIVGLTLASLGMW |
Ga0310686_1024158043 | 3300031708 | Soil | MRHDPAMDQAIGQAQSLALAEPTQHVRIRWIGTLTLASLGMWMANQTPSQVMLALQMQDI |
Ga0310686_1142098521 | 3300031708 | Soil | MRDEAIGRPDVQSLALAEPTTHVRPRWIIGLTLAMLGMWMAVQAPSQVVLA |
Ga0310686_1149693522 | 3300031708 | Soil | MSDQVIGQPDVRSMALAEPTVYVRYRWIVGLTLASLGMWMANQT |
Ga0307476_113912451 | 3300031715 | Hardwood Forest Soil | MRHDPAMADQAISQPDVQSLALAEPTQHVRVRWIVVLTLASLGMWMANQ |
Ga0318500_103229702 | 3300031724 | Soil | VADQVIGQPEVQSLALAEPTRHVRIRWIIGLTLASLG |
Ga0306918_112518531 | 3300031744 | Soil | MADQVIGQPQAQSLALAEPDQHVRIRWISYLTLAS |
Ga0318502_104014912 | 3300031747 | Soil | MSDQVIGQPDVQSLALAEPTQHVRYRWIVGLTLASLG |
Ga0318502_109109902 | 3300031747 | Soil | MDQAIGQPDVQSLALAEPNQHVRIRWIIYLTLASLGMWMATQTPLQVV |
Ga0307477_104524791 | 3300031753 | Hardwood Forest Soil | MADQVVGQPQVQSLALAEPTQHVRVRWIITLTLASLGMW |
Ga0318554_102025123 | 3300031765 | Soil | MADQVIGHPELHSLALAEPTRHVRIRWIICLALASLGM |
Ga0318509_101826253 | 3300031768 | Soil | MADQVIGQPEVQSLALAEPTRHVRIRWIIGLTLAIHMPR |
Ga0318526_101735472 | 3300031769 | Soil | MADQVVGQPQAQSLALAEPDQHVRVRWIGYLTLASLGMWMAVQTPSQV |
Ga0318497_105449212 | 3300031805 | Soil | MADQVIGHPELHSLALAEPTRHVRIRWIICLALASLGMSMATQTPLQ |
Ga0318497_108487682 | 3300031805 | Soil | MRDQVVGQPGAPSLALAEPTRHVRYRWIVGLTLASLGMWMAT |
Ga0318512_105871181 | 3300031846 | Soil | MADQVIGHPELHSLALAEPTRHVRIRWIICLALASLGMSMATQT |
Ga0318527_103025902 | 3300031859 | Soil | MDQAISQPDVQSLALAEPDQHVRIRWIIYLTLASLGMWMATQTPL |
Ga0306919_101896031 | 3300031879 | Soil | MSDQVIGQPGVQSPALAEPTQHVRYRWIVGLTLAS |
Ga0306925_116786712 | 3300031890 | Soil | MSDQVIGQPGVQSPALAEPTQHVRYRWIVGLTLASLGMWMATQTP |
Ga0306923_101141475 | 3300031910 | Soil | VADQVIGQPEVQSLALAEPTRHVRIRWIIGLTLASLGMWMAT |
Ga0306923_109434731 | 3300031910 | Soil | MDQAIGQPDVQSLALAEPNQHVRIRWIIYLTLASLGMWMATQTPLQV |
Ga0308175_1007220292 | 3300031938 | Soil | MRDQTIGQPDVQSLALAEPTEHVRRRWIFGLTLASLGMWMATQ |
Ga0318533_105402282 | 3300032059 | Soil | VADQVIGQPEVQSLALAEPTRHVRIRWIICLTLASLGMWMATQTPL |
Ga0306924_100053791 | 3300032076 | Soil | MSGQVIGQPGVQSLALAEPTKHVRHRWIVGLTLASLGMWMAT |
Ga0311301_107937943 | 3300032160 | Peatlands Soil | MRAQAIGRPDVGSLALAEPTQHVRIRWIVTLTLASLGMWMANQT |
Ga0306920_1004968542 | 3300032261 | Soil | MSDQAIGQPGVQSPALAEPTQHVRYRWIVGLTLASLGMWMATQTP |
Ga0335085_117592441 | 3300032770 | Soil | MRDQAIGQPDVRSLALAEPTQHVRHRWIIGLTLASLGMWMATQ |
Ga0335085_123410891 | 3300032770 | Soil | MSDQVIGQPGVQSPALAEPTRHVRYRWIVGLTLAG |
Ga0335078_127310331 | 3300032805 | Soil | MSDQVIGQPGVQSPALAEPTRHVRHRWIVGLTLASL |
Ga0335080_106897622 | 3300032828 | Soil | MRDQAIGQPGTRSLALAEPTQHVRYRWITGLTLASLGMWMANQTP |
Ga0335080_121240102 | 3300032828 | Soil | MSDQVVGQPGLQSLALAEPTRHVRYRWIVGLTLASLGMWMATQ |
Ga0335081_101177094 | 3300032892 | Soil | MRDQAVGQPDVRSLALAEPTQHVRYRWITGLTLASLGMWMANQTPSQVMLALQLQD |
Ga0335081_112061411 | 3300032892 | Soil | MSDQAIGQQEVQSRALAEPTKHVRRRWIVGLTLASLGMWM |
Ga0335081_112936202 | 3300032892 | Soil | MSDQVVGQPGLQSLALAEPTRHVRYRWIVGLTLASLGMWMA |
Ga0335073_120975791 | 3300033134 | Soil | MSDQTIGQPDVQPAALAEPTRHVKYRWITGLTLASLGMWMANQT |
Ga0335077_100586611 | 3300033158 | Soil | MRDQAIGQPGTRSLALAEPTQHVRYRWITGLTLASLGMWMANQTPSQVM |
Ga0318519_109520112 | 3300033290 | Soil | MSDQVIGQPGVQSPALAEPTQHVRYRWIVGLTLASLGMW |
⦗Top⦘ |