NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F064150

Metagenome / Metatranscriptome Family F064150

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F064150
Family Type Metagenome / Metatranscriptome
Number of Sequences 129
Average Sequence Length 47 residues
Representative Sequence GELSFAMVLREAEHALGIHKDITSYGGWHAYRAAALSEAPDKRRPPL
Number of Associated Samples 110
Number of Associated Scaffolds 129

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.78 %
% of genes near scaffold ends (potentially truncated) 99.22 %
% of genes from short scaffolds (< 2000 bps) 96.90 %
Associated GOLD sequencing projects 106
AlphaFold2 3D model prediction Yes
3D model pTM-score0.45

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (79.070 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(31.783 % of family members)
Environment Ontology (ENVO) Unclassified
(27.132 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(37.209 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 32.00%    β-sheet: 0.00%    Coil/Unstructured: 68.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.45
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 129 Family Scaffolds
PF01979Amidohydro_1 79.84
PF13478XdhC_C 5.43
PF00805Pentapeptide 0.78

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 129 Family Scaffolds
COG1357Uncharacterized conserved protein YjbI, contains pentapeptide repeatsFunction unknown [S] 0.78

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms79.07 %
UnclassifiedrootN/A20.93 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001867|JGI12627J18819_10113414All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1116Open in IMG/M
3300003505|JGIcombinedJ51221_10425217All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia538Open in IMG/M
3300005105|Ga0066812_1012071All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia628Open in IMG/M
3300005337|Ga0070682_101711186Not Available546Open in IMG/M
3300005435|Ga0070714_101648342All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia626Open in IMG/M
3300005436|Ga0070713_101000651All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia806Open in IMG/M
3300005444|Ga0070694_101287278All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales614Open in IMG/M
3300005546|Ga0070696_100284069All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1262Open in IMG/M
3300005556|Ga0066707_10960083All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300005560|Ga0066670_10049959All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2163Open in IMG/M
3300005615|Ga0070702_101130277All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia628Open in IMG/M
3300005719|Ga0068861_101713651All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales622Open in IMG/M
3300005841|Ga0068863_101567906All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia667Open in IMG/M
3300006028|Ga0070717_10571418All Organisms → cellular organisms → Bacteria1025Open in IMG/M
3300006028|Ga0070717_11950473All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Embleya → Embleya scabrispora529Open in IMG/M
3300006163|Ga0070715_10400604All Organisms → cellular organisms → Bacteria763Open in IMG/M
3300006854|Ga0075425_101572416All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia742Open in IMG/M
3300006854|Ga0075425_102411718All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia583Open in IMG/M
3300006871|Ga0075434_101772072All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300009098|Ga0105245_10477407All Organisms → cellular organisms → Bacteria1259Open in IMG/M
3300009101|Ga0105247_11786981All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia511Open in IMG/M
3300009545|Ga0105237_11437729Not Available696Open in IMG/M
3300010301|Ga0134070_10193141All Organisms → cellular organisms → Bacteria744Open in IMG/M
3300010373|Ga0134128_11821085Not Available670Open in IMG/M
3300010880|Ga0126350_10068809All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300012200|Ga0137382_10544450All Organisms → cellular organisms → Bacteria826Open in IMG/M
3300012202|Ga0137363_10700788All Organisms → cellular organisms → Bacteria857Open in IMG/M
3300012210|Ga0137378_11238667All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300012359|Ga0137385_10602041All Organisms → cellular organisms → Bacteria924Open in IMG/M
3300012359|Ga0137385_10610353All Organisms → cellular organisms → Bacteria916Open in IMG/M
3300012478|Ga0157328_1016309All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300012487|Ga0157321_1030966Not Available545Open in IMG/M
3300012951|Ga0164300_10008362All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella3138Open in IMG/M
3300013102|Ga0157371_10128155All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella → Nakamurella multipartita1805Open in IMG/M
3300013307|Ga0157372_10903580All Organisms → cellular organisms → Bacteria1025Open in IMG/M
3300013307|Ga0157372_11689566All Organisms → cellular organisms → Bacteria728Open in IMG/M
3300013307|Ga0157372_12214849Not Available631Open in IMG/M
3300014325|Ga0163163_10731658Not Available1053Open in IMG/M
3300014325|Ga0163163_12973211All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300014968|Ga0157379_11611112Not Available634Open in IMG/M
3300014969|Ga0157376_13016650All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300015358|Ga0134089_10481597Not Available541Open in IMG/M
3300016319|Ga0182033_10847238All Organisms → cellular organisms → Bacteria807Open in IMG/M
3300016445|Ga0182038_10599846Not Available950Open in IMG/M
3300017934|Ga0187803_10384759All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300020579|Ga0210407_10733797All Organisms → cellular organisms → Bacteria765Open in IMG/M
3300020583|Ga0210401_10213245All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella → Nakamurella multipartita1788Open in IMG/M
3300021405|Ga0210387_11324288All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300021406|Ga0210386_10897784All Organisms → cellular organisms → Bacteria759Open in IMG/M
3300021406|Ga0210386_11723593All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300021407|Ga0210383_10107068All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella → Nakamurella multipartita2355Open in IMG/M
3300021479|Ga0210410_10308645Not Available1419Open in IMG/M
3300021479|Ga0210410_11185604All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300021560|Ga0126371_12292505All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300024254|Ga0247661_1029243All Organisms → cellular organisms → Bacteria983Open in IMG/M
3300025320|Ga0209171_10250859Not Available968Open in IMG/M
3300025885|Ga0207653_10297940All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300025905|Ga0207685_10227089All Organisms → cellular organisms → Bacteria891Open in IMG/M
3300025909|Ga0207705_10339516All Organisms → cellular organisms → Bacteria1156Open in IMG/M
3300025910|Ga0207684_10079315All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella2793Open in IMG/M
3300025913|Ga0207695_11200023Not Available639Open in IMG/M
3300025915|Ga0207693_11486654All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300025927|Ga0207687_10982692Not Available724Open in IMG/M
3300025928|Ga0207700_11812622All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300025929|Ga0207664_10782652All Organisms → cellular organisms → Bacteria858Open in IMG/M
3300025929|Ga0207664_11711403All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300025949|Ga0207667_10671464All Organisms → cellular organisms → Bacteria1040Open in IMG/M
3300026023|Ga0207677_12116898Not Available523Open in IMG/M
3300026078|Ga0207702_11656159All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300026089|Ga0207648_10290353Not Available1464Open in IMG/M
3300026095|Ga0207676_12341684All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300026308|Ga0209265_1131105All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300026310|Ga0209239_1102945Not Available1209Open in IMG/M
3300026316|Ga0209155_1203001Not Available624Open in IMG/M
3300026322|Ga0209687_1123753All Organisms → cellular organisms → Bacteria832Open in IMG/M
3300026552|Ga0209577_10239697Not Available1373Open in IMG/M
3300027064|Ga0208724_1020810All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300027070|Ga0208365_1051158Not Available554Open in IMG/M
3300027110|Ga0208488_1064255All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300027288|Ga0208525_1008611All Organisms → cellular organisms → Bacteria1099Open in IMG/M
3300027725|Ga0209178_1155431All Organisms → cellular organisms → Bacteria792Open in IMG/M
3300027775|Ga0209177_10075619All Organisms → cellular organisms → Bacteria1017Open in IMG/M
3300027775|Ga0209177_10154490All Organisms → cellular organisms → Bacteria782Open in IMG/M
3300027821|Ga0209811_10434410All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300028379|Ga0268266_11032575All Organisms → cellular organisms → Bacteria795Open in IMG/M
3300030531|Ga0210274_1107026All Organisms → cellular organisms → Bacteria602Open in IMG/M
3300030738|Ga0265462_10432123All Organisms → cellular organisms → Bacteria914Open in IMG/M
3300031226|Ga0307497_10497757All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300031543|Ga0318516_10107148Not Available1583Open in IMG/M
3300031543|Ga0318516_10235649Not Available1058Open in IMG/M
3300031572|Ga0318515_10194481All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1086Open in IMG/M
3300031572|Ga0318515_10347054Not Available796Open in IMG/M
3300031573|Ga0310915_10275551Not Available1186Open in IMG/M
3300031573|Ga0310915_10366460Not Available1022Open in IMG/M
3300031573|Ga0310915_10572555All Organisms → cellular organisms → Bacteria801Open in IMG/M
3300031573|Ga0310915_10971142All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300031640|Ga0318555_10302519All Organisms → cellular organisms → Bacteria865Open in IMG/M
3300031668|Ga0318542_10096997Not Available1418Open in IMG/M
3300031679|Ga0318561_10203417Not Available1074Open in IMG/M
3300031679|Ga0318561_10316606All Organisms → cellular organisms → Bacteria854Open in IMG/M
3300031679|Ga0318561_10766153All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria530Open in IMG/M
3300031682|Ga0318560_10641525All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300031682|Ga0318560_10774732All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria518Open in IMG/M
3300031708|Ga0310686_119130348All Organisms → cellular organisms → Bacteria676Open in IMG/M
3300031718|Ga0307474_11622870All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300031723|Ga0318493_10318830All Organisms → cellular organisms → Bacteria841Open in IMG/M
3300031723|Ga0318493_10652156All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300031747|Ga0318502_10823848All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300031748|Ga0318492_10800348All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300031751|Ga0318494_10175985Not Available1212Open in IMG/M
3300031795|Ga0318557_10520271All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300031821|Ga0318567_10742795All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300031831|Ga0318564_10318357All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria685Open in IMG/M
3300031890|Ga0306925_11782712All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria590Open in IMG/M
3300031897|Ga0318520_10462350All Organisms → cellular organisms → Bacteria781Open in IMG/M
3300032001|Ga0306922_12143465All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300032008|Ga0318562_10882919All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300032009|Ga0318563_10594891All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria596Open in IMG/M
3300032054|Ga0318570_10421296All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300032055|Ga0318575_10349572All Organisms → cellular organisms → Bacteria749Open in IMG/M
3300032060|Ga0318505_10441517All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300032063|Ga0318504_10383755All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300032076|Ga0306924_10310051All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1810Open in IMG/M
3300032180|Ga0307471_102755770All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300032782|Ga0335082_10219095All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella → Nakamurella multipartita1796Open in IMG/M
3300032805|Ga0335078_10480485All Organisms → cellular organisms → Bacteria1603Open in IMG/M
3300032896|Ga0335075_10308648All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1761Open in IMG/M
3300032898|Ga0335072_10940519All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales803Open in IMG/M
3300033134|Ga0335073_11392658All Organisms → cellular organisms → Bacteria685Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil31.78%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere9.30%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere3.10%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.88%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.88%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.33%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.33%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil2.33%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.33%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.55%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.55%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.55%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.55%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.55%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere1.55%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere1.55%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.55%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.55%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.78%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.78%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.78%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.78%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.78%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.78%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.78%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.78%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.78%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.78%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300005105Soil and rhizosphere microbial communities from Laval, Canada - mgHPCEnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300010301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012478Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610Host-AssociatedOpen in IMG/M
3300012487Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510Host-AssociatedOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015358Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017934Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300024254Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02EnvironmentalOpen in IMG/M
3300025320Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025909Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026308Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes)EnvironmentalOpen in IMG/M
3300026310Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026316Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes)EnvironmentalOpen in IMG/M
3300026322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027064Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF003 (SPAdes)EnvironmentalOpen in IMG/M
3300027070Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF004 (SPAdes)EnvironmentalOpen in IMG/M
3300027110Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF001 (SPAdes)EnvironmentalOpen in IMG/M
3300027288Soil and rhizosphere microbial communities from Laval, Canada - mgHMC (SPAdes)EnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300030531Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO143-VCO038SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030738Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assemblyEnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032896Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12627J18819_1011341423300001867Forest SoilVELDGGELSFAMVLRETEHASGLHTDITSYGGWHAYRAAQLSERGPARSRIGP*
JGIcombinedJ51221_1042521713300003505Forest SoilGDLSFGMVLRDAEHARGIHKDITSYGGWRAYRAASLSEEPDPRRP*
Ga0066812_101207113300005105SoilELELSIIELEGGELSFAMLLREAEHARGVHKDITSYGGWHAYRAAALSEAPDKRRPPL*
Ga0070682_10171118613300005337Corn RhizosphereLELSIIELEGGELSFAMVLREAEHALGIHKDITSYGGWHAYRAAALSEAPDKRRPPL*
Ga0070714_10164834223300005435Agricultural SoilLSIIELEGGELSFAMVLREAEHALGIHKDITSYGGWHAYRAAALSEAPDKRRPQLLGL*
Ga0070713_10100065113300005436Corn, Switchgrass And Miscanthus RhizosphereLELSIIELEGGELSFAMVLREAEHALGIHKDITSYGGWHAYRAAALSEAPDKRRPQL*
Ga0070694_10128727813300005444Corn, Switchgrass And Miscanthus RhizosphereTEPTELELSIIELEGGELSFAMVLREAEHALGIHKDITSYGGWHAYRAAALSEAPDKRRPPL*
Ga0070696_10028406933300005546Corn, Switchgrass And Miscanthus RhizosphereTELELSIIELEGGELSFAMVLREAEHALGIHKDITSYGGWHAYRAAALSEAPDKRRPPL*
Ga0066707_1096008313300005556SoilAEHELGIHKDITSYGGWHAYRAAALSEGPDKRRSPL*
Ga0066670_1004995933300005560SoilREAEHELGIHKDITSHGGWRAYRAAALSEAPEKRRTQL*
Ga0070702_10113027713300005615Corn, Switchgrass And Miscanthus RhizosphereTELELSIIELEGGELSFAMVLREAEHALGIHKDITSYGGWHAYRAAALSEAPDKRRSPL*
Ga0068861_10171365133300005719Switchgrass RhizosphereIIELEGGELSFAMVLREAEHALGIHKDITSYGGWHAYRTAALSEAPDKRRPPL*
Ga0068863_10156790613300005841Switchgrass RhizosphereELEGGELSFAMVLREAEHALGIHKDITSYGGWHAYRAAALSEAPDKRRPPL*
Ga0070717_1057141823300006028Corn, Switchgrass And Miscanthus RhizosphereENGELSFAMVLREAEHALGVHKDITSYGGWHAYRAASLSEGPDRRRSAL*
Ga0070717_1195047313300006028Corn, Switchgrass And Miscanthus RhizosphereAELELSIIELEGGELSFAMVLREAEHALGIHKDITSYGGWHAYRAAALSEAPDKRRPQL*
Ga0070715_1040060413300006163Corn, Switchgrass And Miscanthus RhizosphereLREAEHALGIHKDITSYGGWHAYRAAALSEAPDKRRPQL*
Ga0075425_10157241613300006854Populus RhizosphereLSFAMVLREAEHALGIHKDITSYGGWHAYRAAALSEAPDKRRPQL*
Ga0075425_10241171823300006854Populus RhizospherePTELELSIIELEGGDLSFAMVLREAEHELGIHKDITSYGGWHAYRAAALSEAPDKRRPPL
Ga0075434_10177207233300006871Populus RhizosphereATEPTELELSIIELEGGELSFAMVLREAEHALGIHKDITSYGGWHAYRAAALSEAPDKRRPPL*
Ga0105245_1047740723300009098Miscanthus RhizosphereVLREAEHALGIHKDITSYGGWHAYRAAALSEAPDKRRPPL*
Ga0105247_1178698123300009101Switchgrass RhizosphereMVLRAAEHVLGIHKDITSYGGWHAYRAAALSEAPDKRRPQL*
Ga0105237_1143772923300009545Corn RhizosphereAMVLREAEHALGIHKDITSYGGWHAYRAAALSEAPDKRRPPL*
Ga0134070_1019314113300010301Grasslands SoilREAEHELGIHKDITSYGGWHAYRAAALSEAPDKRRPPL*
Ga0134128_1182108523300010373Terrestrial SoilFAMVLREAEHALGIHKDITSYGGWHAYRAAALSEAPDKRRPPL*
Ga0126350_1006880923300010880Boreal Forest SoilAMVLRDAEHARGIHQDITSYGGWRAYRTAELSEEPDPRRP*
Ga0137382_1054445013300012200Vadose Zone SoilELEGGELSFAMVLRQAEHERGIHQDITSYGGWHAYRAAALSEAPDKRRPPL*
Ga0137363_1070078823300012202Vadose Zone SoilSIIELEDGELSFAMVLREAEHKIGIHKDITSYGGWHAYRAAALSEAPDKRRPQL*
Ga0137378_1123866713300012210Vadose Zone SoilAELELSIVELEGGELSFAMVLREAEHELGIHKDITSYGGWHAYRAAALSEGPDKRRSPL*
Ga0137385_1060204123300012359Vadose Zone SoilSIVELEDGELSFAMVLREAEHALGIHKDITSHGGWHAYRAAVLSQAPDKRRPQL*
Ga0137385_1061035323300012359Vadose Zone SoilLSFAMVLREAEHALGIHKDITSHGGWHAYRAAALSEAPDKRRPQL*
Ga0157328_101630913300012478Arabidopsis RhizosphereLSFAMVLREAEHALGIHKDITSYGGWHAYRAAALSEAPDKRRPPL*
Ga0157321_103096613300012487Arabidopsis RhizosphereELSIIELEGGELSFAMVLREAEHALGIHKDITSYGGWHAYRAAALSEAPDKRRPPL*
Ga0164300_1000836243300012951SoilEGGELSFAMVLREAEHARGIHQDITGYGGWHAYRAAALSEAPDKRRPPL*
Ga0157371_1012815513300013102Corn RhizosphereMVLREAEHALGIHKDITSYGGWHAYRAAALSEAPDKRRPPL*
Ga0157372_1090358023300013307Corn RhizosphereIELEGGELSFAMVLREAEHALGIHKDITSYGGWHAYRAAALSEAPDKRRPPL*
Ga0157372_1168956613300013307Corn RhizosphereIELEGGELSFAMVLREAEHALGIHKDITSYGGWHAYRTAALSEAPDKRRPPL*
Ga0157372_1221484913300013307Corn RhizosphereAEHALGIHKDITSYGGWHAYRAAALSEAPDKRRPPL*
Ga0163163_1073165823300014325Switchgrass RhizosphereSFAMVLRESEHALGVHKDITGHGGWRAYRAAVLSEAPEP*
Ga0163163_1297321123300014325Switchgrass RhizosphereELSFAMVLREAEHALGIHKDITSYGGWRAYRAAALSEAPDKRRPPL*
Ga0157379_1161111213300014968Switchgrass RhizosphereGGELSFAMVLREAEHALGIHKDITSYGGWHAYRAAALSEAPDKRRPPL*
Ga0157376_1301665023300014969Miscanthus RhizosphereELEGGELSFAMVLREAEHALGIHKDITSYGGWHAYRAAALSEAPDKRRPQL*
Ga0134089_1048159713300015358Grasslands SoilELSVVELEGGELSFAMVLREAEHALGIHKDITSYGGWHAYRAAALSEAPEKRRPPL*
Ga0182033_1084723823300016319SoilEHALGIHQDITSYGGWHAYRAAALSEAPDQRRRPL
Ga0182038_1059984613300016445SoilELSFAMVLREAEHARRIHQDITSYGGWRAYRAASLSEGP
Ga0187803_1038475913300017934Freshwater SedimentGELSFAMLLREAEHAHGLHKDITSYGGWRAYRAASLSEGP
Ga0210407_1073379713300020579SoilELEGGDLSFAMVLRDAEHARGIHKDITSYGGWRAYRAASLSEEPDPRRP
Ga0210401_1021324513300020583SoilGGDLSFGMVLRDAEHTRGIHKDITSYGGWRAYRAASLSEEPDPRRP
Ga0210387_1132428823300021405SoilDGELSFAMVLREAEHALGIHKDITSYGGWHAYRAAALSEAPDKRRPQLLGL
Ga0210386_1089778423300021406SoilLREAEHALGLHQDITSYGGWRAYRAAALSEGPDKRRTQL
Ga0210386_1172359313300021406SoilIIELEGGELSFAMVLREAEHAPGIHKDITSYGGWHAYRAAALSEAPDKRRPQL
Ga0210383_1010706833300021407SoilEHQRGIHKDITSYGGWRAYRVASLSEAPDRRRPEL
Ga0210410_1030864513300021479SoilEGGDLSFAMVLRDAEHVRGIHQDITSYGGWRAYRAALLSEEPDPRRP
Ga0210410_1118560413300021479SoilVLREAEHALGLHQDITSYGGWRAYRAAALSEGPDKRRTQL
Ga0126371_1229250523300021560Tropical Forest SoilLREAEHALGIHKDITSYGGWHAYRAAALSEAPDQRRRPL
Ga0247661_102924313300024254SoilLSFAMVLREAEHALGIHKDITSYGGWHAYRAAALSEAPDKRRSPL
Ga0209171_1025085913300025320Iron-Sulfur Acid SpringRDAEHGSGQHKDITSYGGWRAYRAESLSEGPDLRRADL
Ga0207653_1029794023300025885Corn, Switchgrass And Miscanthus RhizosphereREAEHALGVHKDITSYGGWHAYRAASLSEGPDRRRSAL
Ga0207685_1022708913300025905Corn, Switchgrass And Miscanthus RhizosphereFAMVLREAEHALGIHKDITSYGGWHAYRAAALSEAPDKRRPQL
Ga0207705_1033951613300025909Corn RhizosphereLEGGELSFAMVLREAEHALGIHKDITSYGGWHAYRAAALSEAPDKRRPPL
Ga0207684_1007931543300025910Corn, Switchgrass And Miscanthus RhizosphereAMVLREAEHELGIHKDITSYGGWHAYRAAALSEGPDKRRSPL
Ga0207695_1120002323300025913Corn RhizosphereEHALGIHKDITSYGGWHAYRAAALSEAPDKRRPPL
Ga0207693_1148665413300025915Corn, Switchgrass And Miscanthus RhizosphereLELSIIELDGGELSFAMVLREAEHARGIHQDITSYGGWHAYRAAALSEAPDKRRPQL
Ga0207687_1098269213300025927Miscanthus RhizosphereTELELSIIELESGELSFAMVLREAEHALGIHKDITSYGGWHAYRAAALSEAPDKRRPPL
Ga0207700_1181262223300025928Corn, Switchgrass And Miscanthus RhizosphereGGELSFAMVLREAEHVLGIHKDITSYGGWHAYRAAALSEAPDKRRPPL
Ga0207664_1078265213300025929Agricultural SoilELSFAMILREAEHALGIHKDITSYGGWHAYRAAALSEAPDKRRPQL
Ga0207664_1171140323300025929Agricultural SoilLELSIIELEGGELSFAMVLREAEHALGIHKDITSYGGWHAYRAAALSEAPDKRRPPL
Ga0207667_1067146423300025949Corn RhizosphereLSIIELEGGELSFAMVLREAEHALGIHKDITSYGGWHAYRAAALSEAPDKRRPPL
Ga0207677_1211689813300026023Miscanthus RhizosphereELEDGELSFAMVLREAEHALGIHKDITSYGGWHAYRAAALSEAPDKRRPPL
Ga0207702_1165615913300026078Corn RhizosphereEDGELSFAMVLRESEHALGIHKDITGHGGWRAYRAASLSEAPEP
Ga0207648_1029035313300026089Miscanthus RhizosphereELEDGELSFAMVLREAEHAMGIHKDITSYGGWHAYRAAALSEAPDKRRPPL
Ga0207676_1234168413300026095Switchgrass RhizosphereTELELSIIELEGGELSFAMVLREAEHALGIHKDITSYGGWHAYRAAALSEAPDKRRPPL
Ga0209265_113110513300026308SoilVLREAEHELGIHKDITSHGGWHAYRAAALSEAPDKRRTQL
Ga0209239_110294523300026310Grasslands SoilAELELSIVELEGGELSFAMVLREAEHALGIHKDITSYGGWHAYRAAALSEAPDKRRTQL
Ga0209155_120300123300026316SoilSFAMVLREAEHALGIHKDITSYGGWHAYRAAALSEAPDKRRPQL
Ga0209687_112375313300026322SoilELEGGELSFAMVLREAEHALGIHKDITSYGGWHAYRAAALSEAPDKRRPPL
Ga0209577_1023969723300026552SoilGGELSFAMVLREAEHALGIHKDITSYGGWHAYRAAALSEAPDKRRPPL
Ga0208724_102081023300027064Forest SoilDLSFAMVLRDAEHAHGIHKDITSYGGWRAYRVASLSEAPDRRRPEL
Ga0208365_105115833300027070Forest SoilDGELSFAMVLREAEHALGLHKDITSYGGWRAYRVASLSEEPDPRRPEL
Ga0208488_106425523300027110Forest SoilELSFAMLLRETEHASGLHKDITSYGGWRAYRVESLSEGPDLRRADL
Ga0208525_100861123300027288SoilTPVPMVLREAEHALGIHKDITSYGGWHAYRAAALSEAPDKRRPPL
Ga0209178_115543113300027725Agricultural SoilAMVLREAEHALGIHKDITSYGGWHAYRAAALSEAPDKRRPPL
Ga0209177_1007561913300027775Agricultural SoilELSIIELEGGELSFAMVLREAEHALGIHKDITSYGGWHAYRAAALSEAPDKRRPPL
Ga0209177_1015449023300027775Agricultural SoilSFAMVLRESEHALGVHKDITGHGGWRAYRAASLSEAPEP
Ga0209811_1043441023300027821Surface SoilGELSFAMVLREAEHALGIHKDITSYGGWHAYRAAALSEAPDKRRPPL
Ga0268266_1103257523300028379Switchgrass RhizosphereLREAEHALGIHKDITSYGGWHAYRAAALSEAPDKRRPPL
Ga0210274_110702613300030531SoilFAMLLRETEHASGLHKDITSYGGWRAYRIESLSEGPDLRRADL
Ga0265462_1043212323300030738SoilGDLSFAMVLRDAEHVRGIHKDITSYGGWRAYRAASLSEEPDPRRP
Ga0307497_1049775723300031226SoilAEQALGIHKDITSYGGWHAYRAAALSEAPDKRRPPL
Ga0318516_1010714813300031543SoilLSFAMVLREAEHALGIHQDITSYGGWRAYRATSLSEGP
Ga0318516_1023564923300031543SoilSIIELEDGELSFAMLLREAEHALGIHQDITSYGGWHAYRAAALSEAPDQRRRPL
Ga0318515_1019448123300031572SoilIELEDGELSFAMLLREAEHVRGIHKDITSYGGWHAYRAAALSEGPDKRRTQL
Ga0318515_1034705413300031572SoilVLRETEHHRGIHKDITSFGGWRAYRAASLSESPDPRRSDL
Ga0310915_1027555113300031573SoilELSIIELEDGELSFAMLLREAEHALGIHQDITSYGGWHAYRAAALSEAPDQRRRPL
Ga0310915_1036646013300031573SoilELSFAMVLREAEHALGIHQDITSYGGWRAYRATSLSEGP
Ga0310915_1057255523300031573SoilMLLREAEHVRGIHKDITSYGGWHAYRAAALSEGPDQRRPQL
Ga0310915_1097114223300031573SoilIIELEDGELSFAMVLREAEHGRGIHQDITSYGGWHAYRAAALSEGPDRRRPSL
Ga0318555_1030251923300031640SoilAMLLREAEHALGIHKDITSHGGWRAYRAAALSEAPDQRRRPL
Ga0318542_1009699733300031668SoilAMVLRETEHARGIHQDITSYGGWHAYRAAALSEGPDKRRTQLLGL
Ga0318561_1020341723300031679SoilSFAMVLREAEHARGIHQDITSYGGWRAYRAASLSEGP
Ga0318561_1031660613300031679SoilMLLRETEHARGIHQDITSYGGWHAYRAAALSEGPDKRRTQLLGL
Ga0318561_1076615313300031679SoilSIIELEDGELSFAMLLREAEHVRGIHKDITSYGGWHAYRAAALSEGPDQRRTQL
Ga0318560_1064152513300031682SoilIELADGELSFAMVLREAEHARGLHQDITSYGGWHAYRAAALSEGSDRRRPPP
Ga0318560_1077473213300031682SoilLSIIELEDGELSFAMLLREAEHVRGIHKDITSYGGWHAYRAAALSEGPDKRRTQL
Ga0310686_11913034823300031708SoilEHALGIHKDITSYGGWRAYRAASLSEGPDPRRPEPKSL
Ga0307474_1162287023300031718Hardwood Forest SoilMVLRDAEHARGLHKDITSYGGWRAYRAAELSEEPDRRRP
Ga0318493_1031883013300031723SoilLRVAEHALGIHKDITSYGGWRAYRVASLSEEPDPRRPDL
Ga0318493_1065215613300031723SoilELSFAMLLRETEHARGIHQDITSYGGWHAYRAAALSEGPDKRRTQLLGL
Ga0318502_1082384823300031747SoilAMVLRETEHHRGIHKDITSFGGWRAYRAASLSESPDPRRSDL
Ga0318492_1080034823300031748SoilLLREAEHALGIHKEITSYGGWHAYRAAALSEAPDKRRSQL
Ga0318494_1017598523300031751SoilAEHVRGIHKDITSYGGWHAYRAAALSEGPDKRRTQL
Ga0318557_1052027113300031795SoilLREAEHVRGIHKDITSYGGWHAYRAAALSEGPDQRRTQL
Ga0318567_1074279523300031821SoilFAMVLRETEHHRGIHKDITSFGGWRAYRAASLSESPDPRRSDL
Ga0318564_1031835713300031831SoilLELSIIELEDGELSFAMLLREAEHVRGIHKDITSYGGWHAYRAAALSEGPDKRRTQL
Ga0306925_1178271223300031890SoilIIELEDGELSFAMLLREAEHVRGIHKDITSYGGWHAYRAAALSEGPDKRRTQL
Ga0318520_1046235013300031897SoilAMLLREAEHALGIHQDITSYGGWHAYRAAALSEAPDQRRRPL
Ga0306922_1214346523300032001SoilGELSFAMVLREAEHALGIHQDITSYGGWRAYRATSLSEGP
Ga0318562_1088291923300032008SoilELEDGELSFAMVLREAEHARGLHQDITSYGGWHAYRAAALSEGPDRRRPPL
Ga0318563_1059489123300032009SoilLEDGELSFAMLLREAEHVRGIHKDITSYGGWHAYRAAALSEGPDKRRTQL
Ga0318570_1042129623300032054SoilFAMLLRETEHARGIHQDITSYGGWHAYRAAALSEGPDKRRTQLLGL
Ga0318575_1034957213300032055SoilSFAMLLRETEHARGIHQDITSYGGWHAYRAAALSEGPDKRRTQLLGL
Ga0318505_1044151723300032060SoilAEHVRGIHKDITSYGGWHAYRAAALSEGPDQRRTQL
Ga0318504_1038375513300032063SoilFAMVLRETEHARGIHQDITSYGGWHAYRAAALSEGPDKRRTQL
Ga0306924_1031005113300032076SoilELSFAMVLREAEHARGIHQDITSYGGWRAYRATSLSEGP
Ga0307471_10275577013300032180Hardwood Forest SoilLELSIIELEGGELSFAMVLREAEHALGIHKDITSYGGWHAYRAAALSEAPDKRRSPL
Ga0335082_1021909533300032782SoilAELELSIIELEDGELSFAMLLREAEHALGIHQDITSYGGWHAYRAAALSEAPDKRRRPL
Ga0335078_1048048513300032805SoilELSIIELEDGELSFAMLLREAEHVLGIHTDITSYGGWHAYRAAALSEAPDKRRRPL
Ga0335075_1030864813300032896SoilAEHVRGIHQDITSYGGWHAYRAALLSEEPDPRRADL
Ga0335072_1094051923300032898SoilSFAMVLREAEHALGIHKEITSYGGWHAYRAAALSEAPDKRRTPL
Ga0335073_1139265823300033134SoilLEDGELSFAMVLRDAEHARGIHQDITRYGGWHAYRAASLSEGP

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.