NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F064564

Metagenome / Metatranscriptome Family F064564

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F064564
Family Type Metagenome / Metatranscriptome
Number of Sequences 128
Average Sequence Length 42 residues
Representative Sequence LGLVPFTSPAPNSPIRANPRRNAAYFFAEGFKVPVTWLFNR
Number of Associated Samples 111
Number of Associated Scaffolds 128

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.56 %
% of genes near scaffold ends (potentially truncated) 97.66 %
% of genes from short scaffolds (< 2000 bps) 86.72 %
Associated GOLD sequencing projects 108
AlphaFold2 3D model prediction Yes
3D model pTM-score0.35

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (53.906 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil
(16.406 % of family members)
Environment Ontology (ENVO) Unclassified
(46.094 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(55.469 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 31.88%    β-sheet: 0.00%    Coil/Unstructured: 68.12%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.35
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 128 Family Scaffolds
PF00293NUDIX 77.34
PF08281Sigma70_r4_2 9.38
PF04542Sigma70_r2 4.69
PF05188MutS_II 1.56
PF01541GIY-YIG 0.78
PF03544TonB_C 0.78
PF02698DUF218 0.78
PF13432TPR_16 0.78
PF05192MutS_III 0.78
PF13490zf-HC2 0.78
PF06144DNA_pol3_delta 0.78

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 128 Family Scaffolds
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 4.69
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 4.69
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 4.69
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 4.69
COG0249DNA mismatch repair ATPase MutSReplication, recombination and repair [L] 2.34
COG0810Periplasmic protein TonB, links inner and outer membranesCell wall/membrane/envelope biogenesis [M] 0.78
COG1434Lipid carrier protein ElyC involved in cell wall biogenesis, DUF218 familyCell wall/membrane/envelope biogenesis [M] 0.78
COG1466DNA polymerase III, delta subunitReplication, recombination and repair [L] 0.78
COG2812DNA polymerase III, gamma/tau subunitsReplication, recombination and repair [L] 0.78
COG2949Uncharacterized periplasmic protein SanA, affects membrane permeability for vancomycinCell wall/membrane/envelope biogenesis [M] 0.78

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms53.91 %
UnclassifiedrootN/A46.09 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001086|JGI12709J13192_1000867All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca5000Open in IMG/M
3300001661|JGI12053J15887_10362489Not Available700Open in IMG/M
3300002560|JGI25383J37093_10112857All Organisms → cellular organisms → Bacteria776Open in IMG/M
3300002562|JGI25382J37095_10052437All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca1566Open in IMG/M
3300002908|JGI25382J43887_10276526Not Available755Open in IMG/M
3300004780|Ga0062378_10153967All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300005172|Ga0066683_10285853All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1025Open in IMG/M
3300005177|Ga0066690_10926113All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis554Open in IMG/M
3300005187|Ga0066675_10243336All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis1282Open in IMG/M
3300005406|Ga0070703_10415687Not Available589Open in IMG/M
3300005441|Ga0070700_100688330Not Available811Open in IMG/M
3300005444|Ga0070694_100097002All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis2079Open in IMG/M
3300005445|Ga0070708_100711655All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes945Open in IMG/M
3300005467|Ga0070706_100746264Not Available907Open in IMG/M
3300005552|Ga0066701_10680689All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis619Open in IMG/M
3300005560|Ga0066670_10215436All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1157Open in IMG/M
3300005561|Ga0066699_10365019Not Available1032Open in IMG/M
3300005895|Ga0075277_1068564All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis571Open in IMG/M
3300006032|Ga0066696_10065990All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium2082Open in IMG/M
3300006034|Ga0066656_10638761All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis687Open in IMG/M
3300006046|Ga0066652_102094538Not Available501Open in IMG/M
3300006794|Ga0066658_10651397All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis577Open in IMG/M
3300006796|Ga0066665_10311630All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1269Open in IMG/M
3300006800|Ga0066660_11653798Not Available509Open in IMG/M
3300006852|Ga0075433_11253239Not Available643Open in IMG/M
3300006854|Ga0075425_101599493Not Available734Open in IMG/M
3300006854|Ga0075425_103090628All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300006903|Ga0075426_11065164Not Available612Open in IMG/M
3300006914|Ga0075436_100176118All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1511Open in IMG/M
3300006914|Ga0075436_101063807Not Available608Open in IMG/M
3300006918|Ga0079216_10176446All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis1145Open in IMG/M
3300006954|Ga0079219_12115002All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis539Open in IMG/M
3300007076|Ga0075435_101015079Not Available724Open in IMG/M
3300009012|Ga0066710_100004517All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae12348Open in IMG/M
3300009012|Ga0066710_100158157All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae3164Open in IMG/M
3300009012|Ga0066710_101004857All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis1287Open in IMG/M
3300009038|Ga0099829_11201739Not Available628Open in IMG/M
3300009137|Ga0066709_100639641All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1521Open in IMG/M
3300009137|Ga0066709_100821934All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1348Open in IMG/M
3300009147|Ga0114129_10683383All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1321Open in IMG/M
3300009156|Ga0111538_13100742Not Available580Open in IMG/M
3300009809|Ga0105089_1041396Not Available689Open in IMG/M
3300010087|Ga0127492_1088017Not Available617Open in IMG/M
3300010304|Ga0134088_10155082All Organisms → cellular organisms → Bacteria1090Open in IMG/M
3300010320|Ga0134109_10413612Not Available541Open in IMG/M
3300010323|Ga0134086_10281793Not Available641Open in IMG/M
3300010329|Ga0134111_10021839All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium2164Open in IMG/M
3300010329|Ga0134111_10072692All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis1285Open in IMG/M
3300010329|Ga0134111_10375340Not Available605Open in IMG/M
3300010336|Ga0134071_10076724All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis1559Open in IMG/M
3300010336|Ga0134071_10643045Not Available557Open in IMG/M
3300010337|Ga0134062_10548824Not Available588Open in IMG/M
3300010371|Ga0134125_10971137Not Available932Open in IMG/M
3300010371|Ga0134125_12520419Not Available559Open in IMG/M
3300011270|Ga0137391_11387647Not Available549Open in IMG/M
3300011271|Ga0137393_10371263All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae1223Open in IMG/M
3300012199|Ga0137383_10345739All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis1089Open in IMG/M
3300012200|Ga0137382_11033991Not Available589Open in IMG/M
3300012202|Ga0137363_10970733Not Available721Open in IMG/M
3300012203|Ga0137399_10182570All Organisms → cellular organisms → Bacteria1695Open in IMG/M
3300012206|Ga0137380_10146370All Organisms → cellular organisms → Bacteria2154Open in IMG/M
3300012207|Ga0137381_10041601All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes3762Open in IMG/M
3300012207|Ga0137381_11451979Not Available578Open in IMG/M
3300012211|Ga0137377_11617673All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300012228|Ga0137459_1059454All Organisms → cellular organisms → Bacteria1090Open in IMG/M
3300012349|Ga0137387_10273192All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae1220Open in IMG/M
3300012349|Ga0137387_10479116Not Available903Open in IMG/M
3300012356|Ga0137371_10088710All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae2403Open in IMG/M
3300012392|Ga0134043_1013409All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis1130Open in IMG/M
3300012685|Ga0137397_10595128Not Available823Open in IMG/M
3300012918|Ga0137396_10642021Not Available784Open in IMG/M
3300012922|Ga0137394_11179760Not Available630Open in IMG/M
3300012977|Ga0134087_10210349Not Available875Open in IMG/M
3300014154|Ga0134075_10081602All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis1357Open in IMG/M
3300014154|Ga0134075_10265305Not Available744Open in IMG/M
3300014166|Ga0134079_10085847All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae1176Open in IMG/M
3300015053|Ga0137405_1422394Not Available2869Open in IMG/M
3300015358|Ga0134089_10524591Not Available522Open in IMG/M
3300015371|Ga0132258_11761969All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis1561Open in IMG/M
3300015372|Ga0132256_102914037All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis575Open in IMG/M
3300015373|Ga0132257_101126903Not Available991Open in IMG/M
3300017659|Ga0134083_10358295Not Available629Open in IMG/M
3300017997|Ga0184610_1198989Not Available669Open in IMG/M
3300018064|Ga0187773_11229124All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300018071|Ga0184618_10053296All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis1478Open in IMG/M
3300018431|Ga0066655_10052941All Organisms → cellular organisms → Bacteria2102Open in IMG/M
3300018431|Ga0066655_10066717All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1914Open in IMG/M
3300018433|Ga0066667_11204529Not Available659Open in IMG/M
3300018468|Ga0066662_12396555Not Available555Open in IMG/M
3300018476|Ga0190274_12710653Not Available592Open in IMG/M
3300018482|Ga0066669_11015887Not Available748Open in IMG/M
3300019882|Ga0193713_1003986All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis4733Open in IMG/M
3300020004|Ga0193755_1027775All Organisms → cellular organisms → Bacteria1873Open in IMG/M
3300020199|Ga0179592_10091177All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis1399Open in IMG/M
3300024219|Ga0247665_1003376All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis1639Open in IMG/M
3300025160|Ga0209109_10529736Not Available530Open in IMG/M
3300025324|Ga0209640_11369174Not Available519Open in IMG/M
3300025327|Ga0209751_10587597Not Available898Open in IMG/M
3300025915|Ga0207693_10867568All Organisms → cellular organisms → Bacteria694Open in IMG/M
3300026277|Ga0209350_1027601All Organisms → cellular organisms → Bacteria1712Open in IMG/M
3300026295|Ga0209234_1060296All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis1443Open in IMG/M
3300026296|Ga0209235_1167329Not Available838Open in IMG/M
3300026297|Ga0209237_1023417All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae3482Open in IMG/M
3300026298|Ga0209236_1026663All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae3144Open in IMG/M
3300026300|Ga0209027_1093736All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis1085Open in IMG/M
3300026301|Ga0209238_1261053Not Available517Open in IMG/M
3300026305|Ga0209688_1022985All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis1208Open in IMG/M
3300026318|Ga0209471_1249943Not Available610Open in IMG/M
3300026334|Ga0209377_1003873All Organisms → cellular organisms → Bacteria9518Open in IMG/M
3300026334|Ga0209377_1227560Not Available614Open in IMG/M
3300026536|Ga0209058_1302658Not Available550Open in IMG/M
3300026540|Ga0209376_1092362All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis1575Open in IMG/M
3300026548|Ga0209161_10008693All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis7776Open in IMG/M
3300026548|Ga0209161_10011690All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis6584Open in IMG/M
3300026548|Ga0209161_10414968Not Available591Open in IMG/M
3300026551|Ga0209648_10640956Not Available582Open in IMG/M
3300026557|Ga0179587_10812096Not Available617Open in IMG/M
3300027725|Ga0209178_1286052Not Available604Open in IMG/M
3300027821|Ga0209811_10207538All Organisms → cellular organisms → Bacteria741Open in IMG/M
3300027875|Ga0209283_10947239All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis517Open in IMG/M
3300028719|Ga0307301_10080135All Organisms → cellular organisms → Bacteria1024Open in IMG/M
3300028792|Ga0307504_10183177Not Available732Open in IMG/M
3300031820|Ga0307473_10802788Not Available671Open in IMG/M
3300032180|Ga0307471_100407258All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae1489Open in IMG/M
3300032180|Ga0307471_100573338All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis1285Open in IMG/M
3300032205|Ga0307472_101923025Not Available591Open in IMG/M
3300033407|Ga0214472_10650005Not Available963Open in IMG/M
3300033432|Ga0326729_1071347All Organisms → cellular organisms → Bacteria530Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil16.41%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil16.41%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil16.41%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil13.28%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere7.03%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.91%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.12%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.34%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.56%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.56%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.56%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil1.56%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.56%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.78%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.78%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.78%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.78%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.78%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.78%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.78%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.78%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001086Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3EnvironmentalOpen in IMG/M
3300001661Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)EnvironmentalOpen in IMG/M
3300002560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cmEnvironmentalOpen in IMG/M
3300002562Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cmEnvironmentalOpen in IMG/M
3300002908Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cmEnvironmentalOpen in IMG/M
3300004780Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare1FreshEnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005895Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_101EnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009809Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_30_40EnvironmentalOpen in IMG/M
3300010087Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_0_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012228Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT700_2EnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012392Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014154Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015EnvironmentalOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300015053Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015358Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017659Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019882Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2EnvironmentalOpen in IMG/M
3300020004Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2EnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300024219Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK06EnvironmentalOpen in IMG/M
3300025160Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2EnvironmentalOpen in IMG/M
3300025324Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025327Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026277Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026295Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026296Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026297Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026298Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026300Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026305Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes)EnvironmentalOpen in IMG/M
3300026318Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes)EnvironmentalOpen in IMG/M
3300026334Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes)EnvironmentalOpen in IMG/M
3300026536Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes)EnvironmentalOpen in IMG/M
3300026540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes)EnvironmentalOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028719Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182EnvironmentalOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300033407Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175EnvironmentalOpen in IMG/M
3300033432Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF6AY SIP fractionEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12709J13192_100086713300001086Forest SoilLIIAQRLGLVPYTSPATGSPIHSNVRRNTGYLFAEGFKVPFTWLFQH*
JGI12053J15887_1036248923300001661Forest SoilPFTSPAPNSPIRSNPRRNAAYFLAEGFKVPVTWVFNR*
JGI25383J37093_1011285723300002560Grasslands SoilMQLASKRLQIIASRLGLMPFTSPAPGSPIHANARRNTGYLFAEGFKVPFTWLFQR*
JGI25382J37095_1005243733300002562Grasslands SoilRLQIIASRLGLMPFTSPAPGSPIHANARRNTGYXFAEGFKVPFTWLFQR*
JGI25382J43887_1027652623300002908Grasslands SoilIIARRLGLTPYTSPATGSPIHANVRRNAGYLFAEGFKVPFTWLFQR*
Ga0062378_1015396713300004780Wetland SedimentLRIIAQRLGLVPFTSPAPGSPIHANVRRNAGYLLAEGFKVPFTWLFQR*
Ga0066683_1028585313300005172SoilRIIATRLGLVPFTSPATNSPIRSNPRRNAAYFLAEGFKVPVTWLFNR*
Ga0066690_1092611323300005177SoilGLLPFTSPAPNSPIRSNPRRNAAYFLAEGFKVPVTWLFNH*
Ga0066675_1024333633300005187SoilIIATHLGLIPFTSPAPNSPIRSNPRRNAAYFLAEGFKVPVTWVFNR*
Ga0070703_1041568723300005406Corn, Switchgrass And Miscanthus RhizosphereATRLGLVPYTSPAPGSPIRANPRRNAAYFLAEGLKVPVTWLFNH*
Ga0070700_10068833013300005441Corn, Switchgrass And Miscanthus RhizosphereQIIAKRQGLVPYTSPATGSPIHASLRRNTGYLFAEGFKVPFTWLFQL*
Ga0070694_10009700213300005444Corn, Switchgrass And Miscanthus RhizosphereRVGLAPFTSPTPSSPIRSNPRLNASYLLVEGFKVPVTWLFQH*
Ga0070708_10071165533300005445Corn, Switchgrass And Miscanthus RhizosphereLAPFTSPAPNSPIRSNPRRNAAYYFAEGFKVPITWIFNR*
Ga0070706_10074626413300005467Corn, Switchgrass And Miscanthus RhizosphereHRGLIAYTSPAPGSPIRANPRRNAAYTLSEGFKVPITWLLDR*
Ga0066701_1068068923300005552SoilRLGLVPFTSPAPNSPIRSNPRRNAAYFLAEGFKVPLTWAFNR*
Ga0066670_1021543633300005560SoilFTSPAPNSPIRANPRRNAAYFFAEGYKVPVTWLFNR*
Ga0066699_1036501933300005561SoilMLRLQIIATHLGLAPFTSPAPNSPIHANPRRNAAYFFAEGFKVPVTWLFNR*
Ga0075277_106856413300005895Rice Paddy SoilRLGLVAFTSPAPNSPIRSNPRRNAAYFLAEGLKVPVTWVFNR*
Ga0066696_1006599043300006032SoilARRLGLTPYTSPATGSPIHASFRRNTGYLFAEGFKVPFTWLFQR*
Ga0066656_1063876113300006034SoilQIIASRLGLVPFTSPTPNSPIHANPRLNAGYLFAEGVKVPLTWLFQH*
Ga0066652_10209453823300006046SoilSPAPNSPIHANPRRNAAYFFAEGFKVPVTSLFNR*
Ga0066658_1065139723300006794SoilLGLVPFTSPAPGSPIRSNPRRNAAYFLAEGLKVPVTWLFNH*
Ga0066665_1031163033300006796SoilFTSPAPNSPIHANPRRNAAYFFAEGFKVPVTWLFNR*
Ga0066660_1165379823300006800SoilVPFTSPAPNSPIRANPRRNAAYFFAEGFKVPVTWLFNH*
Ga0075433_1125323923300006852Populus RhizosphereLTSPAADSPIRASSRRNLAYVVAEGFKVPFTWLFHR*
Ga0075425_10159949313300006854Populus RhizosphereLTPYTSPAAGSPIHANVRRNTGYLFAEGFKVPFTWLFQR*
Ga0075425_10309062823300006854Populus RhizospherePYTSPAAGSPIHANVRRNTGYLFAEGFKVPFTWLFQR*
Ga0075426_1106516413300006903Populus RhizosphereSPATGSPIHANVRRNTGYLFAEGFKVPFTWLFQR*
Ga0075436_10017611833300006914Populus RhizosphereFHLLRLKILADHRGLIAYTSPAPGSPIRANPRRNAAYTLSEGFKVPITWLLDR*
Ga0075436_10106380723300006914Populus RhizosphereFTSPAPGSPIRASPRRNAGFILAEGVKVPIAWLFQH*
Ga0079216_1017644633300006918Agricultural SoilPFTSPSPSSPIHSNPRRNTGYLFAEGFKVPFTWLFQH*
Ga0079219_1211500223300006954Agricultural SoilLRLRILATRHGLLPFTSPAPGSPIRSNPRRNAAYFLAEGFKVPITWLFNR*
Ga0075435_10101507913300007076Populus RhizosphereYTSPAAGSPIHANVRRNTGYLFAEGFKVPFTWLFQR*
Ga0066710_10000451713300009012Grasslands SoilPYTSPAAGSPIHANVRRNTGYLFAEGFKVPFTWLFQH
Ga0066710_10015815753300009012Grasslands SoilFTSPATGSPIHANVRRNTGYLFAEGFKVPFTWLFQH
Ga0066710_10100485733300009012Grasslands SoilFTSPAPNSPIHANPRRNAAYFFAEGFKVPVTWLFNR
Ga0099829_1120173913300009038Vadose Zone SoilIATRLGLLPFTSPAPNSPIRSNPRRNAAYFLAEGFKVPVTWVFNR*
Ga0066709_10063964133300009137Grasslands SoilTPYTSPAAGSPIHANVRRNAAYLFAEGFKVPFTWLFQR*
Ga0066709_10082193413300009137Grasslands SoilGLVPFTSPAPGSPIRSNPRRNAAYFLAEGLKVPVTWLFNH*
Ga0114129_1068338333300009147Populus RhizosphereSPAPGSPIRASRRRYLTYLAAEGVKVPFSWIFQR*
Ga0111538_1310074223300009156Populus RhizosphereGLVPFTSPAPGSPIRGSLRRNTAYHLAEGFKVPLTWLFQH*
Ga0105089_104139613300009809Groundwater SandTSPAPGSPIRSNPRLNTGYFLAEGIKVPVTWLFNR*
Ga0127492_108801713300010087Grasslands SoilIIATRLGLQPFTSPAPNSPIRSNPRRNAAYFLAEGFKVPVTWVFNR*
Ga0134088_1015508213300010304Grasslands SoilLGLVPYTSPASGSPIHANARRNTGYLFAEGFKVPFTWLFQR*
Ga0134109_1041361213300010320Grasslands SoilTSPAPGSPIRASPRRNAGYLLAEGIKVPLAWLFQH*
Ga0134086_1028179313300010323Grasslands SoilLRIIAERLDLTPYTSPAPGSPIHANVRRNTGYLFAEGFKVPITWLFQR*
Ga0134111_1002183943300010329Grasslands SoilSPATGSPIHANVRRNTGYLFAEGFKVPFTWLFQH*
Ga0134111_1007269213300010329Grasslands SoilMPFTSPAPGSPIHANARRNTGYLFAEGFKVPFTWLFQR*
Ga0134111_1037534023300010329Grasslands SoilATRLGLQPFTSPAPNSPIRSNPRRNAAYFLTEGFKVPVTWLFNR*
Ga0134071_1007672433300010336Grasslands SoilFTSPAPNSPIRSNPRRNAAYFLAEGFKVPVTWVFNR*
Ga0134071_1064304513300010336Grasslands SoilTHLGLAPFTSPAPNSPIRSNPRRNAAYYFAEGFKVPVTWIFNR*
Ga0134062_1054882413300010337Grasslands SoilTPYTSPAPGSPIHANVRRNTGYLFAEGFKVPFTWLFQR*
Ga0134125_1097113713300010371Terrestrial SoilIATRLGLLPFTSPAPNSPIRSNPRRNAAYFFAEGFKVPVTWVFNR*
Ga0134125_1252041913300010371Terrestrial SoilLGLVPFTSPAPGSPIHANARRHTGYLFAEGFKVPFTWLFQH*
Ga0137391_1138764723300011270Vadose Zone SoilATRLGLAPFTSPAPNSPIHANPRRNTTYMLAEGIKVPVAWLFQH*
Ga0137393_1037126333300011271Vadose Zone SoilLTPYTSPAAGSPIHANIRRNTGYLFAEGFKVPFTWLFQH*
Ga0137383_1034573913300012199Vadose Zone SoilQPFTSPAPNSPIRSNPRRNAAYFLTEGFKVPVTWLFNR*
Ga0137382_1103399123300012200Vadose Zone SoilARRLGLTPYTSPAAGSPIHANVRRNTGYLFAEGFKVPFTWLFQR*
Ga0137363_1097073323300012202Vadose Zone SoilLRLRIIATRLGLQPFTSPAPNSPIRSNPRRNAAYFLAEGFKVPVTWVFNR*
Ga0137399_1018257043300012203Vadose Zone SoilLRLQIIATRLGLVPFTSPAANSPIRANPRRNAAFFFAEGFKVPITWLFNR*
Ga0137380_1014637013300012206Vadose Zone SoilHLGLAPFTSPAPNSPIHANPRRNAAYFFAEGFKVPVTWLFNR*
Ga0137381_1004160113300012207Vadose Zone SoilMLRLQILATRLGLVPFTSPAPNSPIRSSPRRNASYLFAEGFKVPVTWLFNR*
Ga0137381_1145197913300012207Vadose Zone SoilLGLTPYTSPAPGSPIHANVRRNTGYLFAEGFKVPFTWLFQR*
Ga0137377_1161767333300012211Vadose Zone SoilFTSPTPTSPIHSNPRLNAGYLLAEGVKVPVTWLFQR*
Ga0137459_105945413300012228SoilRLGLVPFTSPVPNSPIRSNPRLHASYLLVEGLKVPVTWLFQH*
Ga0137387_1027319233300012349Vadose Zone SoilQIIARRLGLVPFTSPATGSPIHANVRRNTGYLFAEGFKVPFTWLFQH*
Ga0137387_1047911633300012349Vadose Zone SoilTSPAPNSPIRSNPRRNAAYYFAEGFKVPVTWIFNR*
Ga0137371_1008871013300012356Vadose Zone SoilTSPAPNSPIRSNPRRNAAYFLTEGFKVPVTWLFNR*
Ga0134043_101340913300012392Grasslands SoilATRLGLQPFTSPAPNSPIRSNPRRNAAYFLAEGFKVPVTWVFNR*
Ga0137397_1059512823300012685Vadose Zone SoilGMTPYTSPATGSPIHANVRRNTGYLFAEGFKVPFTWLFQR*
Ga0137396_1064202123300012918Vadose Zone SoilRLGLVGFTSPAPGSPIHANTRLNAGYFFAEGLKVPLAWLYRR*
Ga0137394_1117976013300012922Vadose Zone SoilLRIIATRLGLLPFTSPAPNSPIRSNPRRNAAYFFAEGFKVPVTWVFNR*
Ga0134087_1021034923300012977Grasslands SoilLQIIATHLGLAPFTSPAPNSPIHANPRRNAAYFFAEGFKVPVTWLFNR*
Ga0134075_1008160233300014154Grasslands SoilARRLGLTPYTSPAAGSPIHANVRRNTGYLFAEGFKVPFTWAFQH*
Ga0134075_1026530513300014154Grasslands SoilRIIARRLGLTPYTSPAAGSPIHANVRRNTGYLFAEGFKVPFTWMFQH*
Ga0134079_1008584733300014166Grasslands SoilRLQIIAARLGLVPFTSPAPGSPIHANVRRNTGYLFAEGFKVPFTWLFQR*
Ga0137405_142239453300015053Vadose Zone SoilLRDGWADAYTSPATGSPIHANVRRNAGYLFAEGFKVPFTWLFQR*
Ga0134089_1052459123300015358Grasslands SoilLRLQIIATHLGLAPFTSPAPNSPIRSNPRRNAAYYFAEGFKVPVTWIFNR*
Ga0132258_1176196933300015371Arabidopsis RhizosphereLQIIAARLGLAGFTSPAPNSPIRSNPRRNAAYFLAEGFKVPITWIFNR*
Ga0132256_10291403723300015372Arabidopsis RhizosphereHMLRLQIIAKRQGLVPYTSPATGSPIHASLRRNTGYLFAEGFKVPFTWLFQH*
Ga0132257_10112690333300015373Arabidopsis RhizosphereKRQGLVPYTSPATGSPIHASLRRNTGYLFAEGFKVPFTWLFQH*
Ga0134083_1035829523300017659Grasslands SoilFTSPATNSPIHANPRRNTAYMLAEGVKVPVAWLFQH
Ga0184610_119898923300017997Groundwater SedimentIIARRLGLVPYTSPATGSPIHANLRRNTGYLFAEGFKVPFTWLFQH
Ga0187773_1122912413300018064Tropical PeatlandPYTSPATDSPIHASARRNTGYLFAEGFKVPFTWLFQR
Ga0184618_1005329613300018071Groundwater SedimentRRLGLTPYTSPATGSPIHANVRRNAGYLFAEGFKVPFTWLFQR
Ga0066655_1005294143300018431Grasslands SoilFTSPAPGSPIRSNPRRNAAYFLAEGLKVPVTWLFNH
Ga0066655_1006671713300018431Grasslands SoilRLGLVPFTSPAPNSPIRSNPRRNAAYFLAEGFKVPLTWAFNR
Ga0066667_1120452923300018433Grasslands SoilPFTSPAPNSPIRSSPRRNASYLFAEGFKVPVTWLFNR
Ga0066662_1239655513300018468Grasslands SoilLRLRIIASRLGLMPFTSPAPNSPIRSNPRRNAAYFLTEGFKVPVTWLFNR
Ga0190274_1271065323300018476SoilLGLAPFTSPVASSPIRSNPRLNASYLLVEGLKVPVTWIFQH
Ga0066669_1101588723300018482Grasslands SoilVPFTSPAPGSPIRSNPRRNAAYFLAEGLKVPVTWLFNH
Ga0193713_100398613300019882SoilTPYTSPATGSPIHANVRRNAGYLFAEGFKVPFTWLFQR
Ga0193755_102777513300020004SoilLGLVPFTSPVPNSPIRSNPRLNASYLLVEGVKVPVTWLFQR
Ga0179592_1009117713300020199Vadose Zone SoilATRLGLLPFTSPAPNSPIRSNPRRNAAYFLAEGFKVPVTWIFNR
Ga0247665_100337633300024219SoilTRLGLAPFTSPAPNSPIRSNPRRNAAYYFAEGFKVPITWIFNR
Ga0209109_1052973623300025160SoilVLAARLALEPYTSPAPESPITANRRRHVAYVAAEGIKVPLTWLFQR
Ga0209640_1136917413300025324SoilTPLTSPAPGSPIRASMRRNTAYLLAEGFKVPFTWLFQH
Ga0209751_1058759723300025327SoilPYTSPATGSPIHANLRRNTGYLFAEGFKVPFAWLFQH
Ga0207693_1086756813300025915Corn, Switchgrass And Miscanthus RhizosphereLKILATRQGLVPFTSPAPGSPIRANPRRNAAYFLAEGLKVPVTWLFNH
Ga0209350_102760113300026277Grasslands SoilLLPFTSPAPNSPIRSNPRRNAAYFLAEGFKVPVTWVFNR
Ga0209234_106029633300026295Grasslands SoilLVPFTSPAPGSPIRSNPRRNAAYFLAEGLKVPVTWLFNH
Ga0209235_116732913300026296Grasslands SoilGLLPFTSPAPNSPIRSNPRRNAAYFLAEGFKVPVTWIFNR
Ga0209237_102341763300026297Grasslands SoilPYTSPAPGSPIRASPRRNAGFILAEGIKVPIAWLFQH
Ga0209236_102666353300026298Grasslands SoilLGLAPFTSPATNSPIHANPRRNTAYMLAEGVKVPVAWLFQH
Ga0209027_109373633300026300Grasslands SoilLATRLGLVPFTSPAPGSPIRSNPRRNAAYFLAEGLKVPVTWLFNH
Ga0209238_126105313300026301Grasslands SoilMLRLQIIASRLGLMPFTSPAPGSPIHANARRNTGYLFAEGFKVPFTWLFQR
Ga0209688_102298533300026305SoilRLKIIATRLGLVPFTSPAPGSPIRSNPRRNAAYFLAEGLKVPVTWLFNH
Ga0209471_124994323300026318SoilTSPAPGSPIRSNPRRNAAYFLAEGLKVPVTWLFNH
Ga0209377_100387313300026334SoilLGLVPFTSPTPNSPIHANPRLNAGYLLAEGVKVPLTWLFQH
Ga0209377_122756013300026334SoilLGLVPFTSPAPNSPIRANPRRNAAYFFAEGFKVPVTWLFNR
Ga0209058_130265813300026536SoilLRLKIIATRLGLVPFTSPAPGSPIRSNPRRNAAYFLAEGLKVPVTWLFNH
Ga0209376_109236233300026540SoilFTSPAPGSPIHANARRNTGYLFAEGFKVPFTWLFQR
Ga0209161_1000869313300026548SoilPFTSPTPSSPIHANPRLNAAYLLAEGVKVPLTWLFQH
Ga0209161_1001169073300026548SoilLIATRLGLVPFTSPAPNSPIRANLRRNAAYFFAEGFKVPVTWLLNR
Ga0209161_1041496813300026548SoilLRLRIIATRLGLQPFTSPAPNSPIRSNPRRNAAYFLTEGFKVPVTWLFNR
Ga0209648_1064095613300026551Grasslands SoilIAYTSPAPGSPIRANPRRNAVYMLSEGFKVPITWLLDR
Ga0179587_1081209613300026557Vadose Zone SoilDHRGLIAYTSPAPGSPIRANPRRNAAYTLSEGFKVPITWLLDR
Ga0209178_128605223300027725Agricultural SoilQIIASRLGLAPFTSPAPNSPIRSNPRRNAAYYFAEGFKVPVTWIFNR
Ga0209811_1020753813300027821Surface SoilHMLRLEIIAERLGLTPYTSPATGSPIHANVRRNTGYLFAEGFKVPVTWLFQR
Ga0209283_1094723913300027875Vadose Zone SoilMLRLRIIARRLGLTPYTSPATGSPIHANVRRNAGYLFAEGFKVPFTWLFQR
Ga0307301_1008013533300028719SoilARRLGLTPYTSPATGSPIHANVRRNAGYLFAEGFKVPFTWLFQR
Ga0307504_1018317723300028792SoilLPFTSPAPNSPIRSNPRRNAAYFFAEGFKVPVTWVFNR
Ga0307473_1080278823300031820Hardwood Forest SoilRLGLLPFTSPAPNSPIRSNPRRNVTYFLAEGFKVPVTWLFNR
Ga0307471_10040725813300032180Hardwood Forest SoilAYTSPTPSSPIRSNTRLNAGYLLTEGVKVPITWLFQR
Ga0307471_10057333833300032180Hardwood Forest SoilTSPAPGSPIRANPRRNAAYFLAEGLKVPVTWLFNH
Ga0307472_10192302513300032205Hardwood Forest SoilMLRLRIIAERLDLTPYTSPAPGSPIHANVRRNTGYLFAEGFKVPITWLFQR
Ga0214472_1065000513300033407SoilLVPLTSPAPGSPIRANLRRNTTYLLAEGFKVPFTWLFQH
Ga0326729_107134713300033432Peat SoilLRLKIIAARLGLVPFTSPVPNSPIRSNLRLNASYLLVEGLKVPVTWLFQH

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.