NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F064581

Metagenome / Metatranscriptome Family F064581

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F064581
Family Type Metagenome / Metatranscriptome
Number of Sequences 128
Average Sequence Length 47 residues
Representative Sequence VNRRRWVIAILAAWALSLGWLVKREVFRPTGARLAAAALAVPP
Number of Associated Samples 113
Number of Associated Scaffolds 128

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 82.03 %
% of genes near scaffold ends (potentially truncated) 96.88 %
% of genes from short scaffolds (< 2000 bps) 86.72 %
Associated GOLD sequencing projects 108
AlphaFold2 3D model prediction Yes
3D model pTM-score0.48

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(20.312 % of family members)
Environment Ontology (ENVO) Unclassified
(39.844 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(46.094 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 52.11%    β-sheet: 0.00%    Coil/Unstructured: 47.89%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.48
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 128 Family Scaffolds
PF01661Macro 69.53
PF13432TPR_16 10.94
PF03091CutA1 7.03
PF13428TPR_14 2.34
PF14559TPR_19 2.34
PF13424TPR_12 2.34
PF00005ABC_tran 2.34
PF13414TPR_11 0.78

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 128 Family Scaffolds
COG2110O-acetyl-ADP-ribose deacetylase (regulator of RNase III), contains Macro domainTranslation, ribosomal structure and biogenesis [J] 69.53
COG1324Divalent cation tolerance protein CutAInorganic ion transport and metabolism [P] 7.03

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001356|JGI12269J14319_10181682All Organisms → cellular organisms → Bacteria851Open in IMG/M
3300002558|JGI25385J37094_10119661All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium752Open in IMG/M
3300002560|JGI25383J37093_10074285All Organisms → cellular organisms → Bacteria1047Open in IMG/M
3300002562|JGI25382J37095_10064515All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1378Open in IMG/M
3300002908|JGI25382J43887_10391941All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium587Open in IMG/M
3300002915|JGI25387J43893_1077350All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300005174|Ga0066680_10024804All Organisms → cellular organisms → Bacteria3327Open in IMG/M
3300005174|Ga0066680_10431237All Organisms → cellular organisms → Bacteria834Open in IMG/M
3300005175|Ga0066673_10436540All Organisms → cellular organisms → Bacteria769Open in IMG/M
3300005176|Ga0066679_10169781All Organisms → cellular organisms → Bacteria1376Open in IMG/M
3300005341|Ga0070691_10565036All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium667Open in IMG/M
3300005437|Ga0070710_11380578All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium526Open in IMG/M
3300005444|Ga0070694_101734004All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium531Open in IMG/M
3300005446|Ga0066686_10310295All Organisms → cellular organisms → Bacteria1073Open in IMG/M
3300005446|Ga0066686_10910792All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300005471|Ga0070698_100750085All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium919Open in IMG/M
3300005540|Ga0066697_10166263All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1306Open in IMG/M
3300005545|Ga0070695_100915905All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium709Open in IMG/M
3300005547|Ga0070693_100821347All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium691Open in IMG/M
3300005554|Ga0066661_10039304All Organisms → cellular organisms → Bacteria2660Open in IMG/M
3300005558|Ga0066698_10125404All Organisms → cellular organisms → Bacteria1716Open in IMG/M
3300005561|Ga0066699_10297471All Organisms → cellular organisms → Bacteria1148Open in IMG/M
3300005566|Ga0066693_10403960All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium555Open in IMG/M
3300005568|Ga0066703_10293456All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes984Open in IMG/M
3300005569|Ga0066705_10202386All Organisms → cellular organisms → Bacteria1243Open in IMG/M
3300005880|Ga0075298_1032641All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium534Open in IMG/M
3300006031|Ga0066651_10104599All Organisms → cellular organisms → Bacteria1430Open in IMG/M
3300006034|Ga0066656_11092511All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium513Open in IMG/M
3300006791|Ga0066653_10735221All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium513Open in IMG/M
3300006797|Ga0066659_11384853All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium587Open in IMG/M
3300006853|Ga0075420_100097396All Organisms → cellular organisms → Bacteria2596Open in IMG/M
3300006853|Ga0075420_100564079All Organisms → cellular organisms → Bacteria983Open in IMG/M
3300006871|Ga0075434_100191881All Organisms → cellular organisms → Bacteria2063Open in IMG/M
3300007255|Ga0099791_10514325All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium582Open in IMG/M
3300007258|Ga0099793_10006706All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes4259Open in IMG/M
3300007788|Ga0099795_10278719All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium729Open in IMG/M
3300009012|Ga0066710_102810580All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium688Open in IMG/M
3300009089|Ga0099828_10373916All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1284Open in IMG/M
3300009137|Ga0066709_103074546All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium611Open in IMG/M
3300009137|Ga0066709_103187021All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes598Open in IMG/M
3300009137|Ga0066709_103924092All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium540Open in IMG/M
3300009147|Ga0114129_10482918All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1621Open in IMG/M
3300009597|Ga0105259_1032680All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1124Open in IMG/M
3300010301|Ga0134070_10131563All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium888Open in IMG/M
3300010320|Ga0134109_10227928All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium696Open in IMG/M
3300010323|Ga0134086_10366927All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium572Open in IMG/M
3300010323|Ga0134086_10411487All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium545Open in IMG/M
3300010333|Ga0134080_10006813All Organisms → cellular organisms → Bacteria3980Open in IMG/M
3300010399|Ga0134127_13430991All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium519Open in IMG/M
3300011120|Ga0150983_12935883All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium617Open in IMG/M
3300011430|Ga0137423_1029318All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1685Open in IMG/M
3300012035|Ga0137445_1136068All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium503Open in IMG/M
3300012201|Ga0137365_10694712All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes744Open in IMG/M
3300012202|Ga0137363_10727938All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium840Open in IMG/M
3300012203|Ga0137399_10734057All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium831Open in IMG/M
3300012206|Ga0137380_10233485All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1661Open in IMG/M
3300012207|Ga0137381_10387748All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1218Open in IMG/M
3300012208|Ga0137376_10334785All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1314Open in IMG/M
3300012208|Ga0137376_10847690All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes786Open in IMG/M
3300012211|Ga0137377_10004816All Organisms → cellular organisms → Bacteria10683Open in IMG/M
3300012226|Ga0137447_1105332All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes562Open in IMG/M
3300012285|Ga0137370_10007552All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes5054Open in IMG/M
3300012349|Ga0137387_10009349All Organisms → cellular organisms → Bacteria5688Open in IMG/M
3300012357|Ga0137384_10033175All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes4246Open in IMG/M
3300012358|Ga0137368_10222560All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1324Open in IMG/M
3300012363|Ga0137390_11286578All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium677Open in IMG/M
3300012532|Ga0137373_11285824All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium510Open in IMG/M
3300012918|Ga0137396_10401582All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1016Open in IMG/M
3300012929|Ga0137404_10639776All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes959Open in IMG/M
3300012976|Ga0134076_10324972All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium671Open in IMG/M
3300014326|Ga0157380_11338178All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium765Open in IMG/M
3300015254|Ga0180089_1033291All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium979Open in IMG/M
3300015356|Ga0134073_10014405All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1815Open in IMG/M
3300017656|Ga0134112_10466631All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium530Open in IMG/M
3300017659|Ga0134083_10382422All Organisms → cellular organisms → Bacteria611Open in IMG/M
3300017997|Ga0184610_1186589All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium690Open in IMG/M
3300018056|Ga0184623_10356387All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium654Open in IMG/M
3300018071|Ga0184618_10046031All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1568Open in IMG/M
3300018076|Ga0184609_10578850All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium505Open in IMG/M
3300018077|Ga0184633_10104241All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1466Open in IMG/M
3300018081|Ga0184625_10411888All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium696Open in IMG/M
3300018433|Ga0066667_10031088All Organisms → cellular organisms → Bacteria3001Open in IMG/M
3300018433|Ga0066667_10411193All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1096Open in IMG/M
3300018482|Ga0066669_10659007All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium921Open in IMG/M
3300019882|Ga0193713_1021042All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1935Open in IMG/M
3300021073|Ga0210378_10321623All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium579Open in IMG/M
3300021080|Ga0210382_10009648All Organisms → cellular organisms → Bacteria3247Open in IMG/M
3300021086|Ga0179596_10443538All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium656Open in IMG/M
3300024330|Ga0137417_1082193All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium903Open in IMG/M
3300024330|Ga0137417_1295464All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium675Open in IMG/M
3300025885|Ga0207653_10042202All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1500Open in IMG/M
3300025910|Ga0207684_10637427All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes908Open in IMG/M
3300025910|Ga0207684_11682369All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium512Open in IMG/M
3300025921|Ga0207652_11008282All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium732Open in IMG/M
3300026285|Ga0209438_1122188All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium725Open in IMG/M
3300026297|Ga0209237_1042584All Organisms → cellular organisms → Bacteria2361Open in IMG/M
3300026297|Ga0209237_1128005All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1049Open in IMG/M
3300026308|Ga0209265_1033786All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1582Open in IMG/M
3300026317|Ga0209154_1304578All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium524Open in IMG/M
3300026327|Ga0209266_1173378All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium832Open in IMG/M
3300026334|Ga0209377_1123814All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1033Open in IMG/M
3300026523|Ga0209808_1191658All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium697Open in IMG/M
3300026528|Ga0209378_1021350All Organisms → cellular organisms → Bacteria3600Open in IMG/M
3300026530|Ga0209807_1098788All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1263Open in IMG/M
3300026536|Ga0209058_1008898All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes7344Open in IMG/M
3300026536|Ga0209058_1144248All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1133Open in IMG/M
3300026540|Ga0209376_1131684All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1225Open in IMG/M
3300026551|Ga0209648_10252133All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1306Open in IMG/M
3300027643|Ga0209076_1211076All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium530Open in IMG/M
3300027882|Ga0209590_10024417All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes3101Open in IMG/M
3300027909|Ga0209382_11308659All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes734Open in IMG/M
3300027961|Ga0209853_1172263All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium513Open in IMG/M
(restricted) 3300028043|Ga0233417_10629912All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes512Open in IMG/M
3300028536|Ga0137415_11492499All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium501Open in IMG/M
3300028784|Ga0307282_10148438All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1109Open in IMG/M
3300028803|Ga0307281_10376500All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium540Open in IMG/M
3300028814|Ga0307302_10310153All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes776Open in IMG/M
3300028878|Ga0307278_10492736All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium535Open in IMG/M
3300031114|Ga0308187_10265049All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium630Open in IMG/M
3300031740|Ga0307468_100114592All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1642Open in IMG/M
3300031740|Ga0307468_102569364All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium500Open in IMG/M
3300031908|Ga0310900_10859964All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes737Open in IMG/M
3300032180|Ga0307471_100020791All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes4801Open in IMG/M
3300032180|Ga0307471_101249742All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes906Open in IMG/M
3300032180|Ga0307471_102300076All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium680Open in IMG/M
3300032205|Ga0307472_101914198All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium592Open in IMG/M
3300034164|Ga0364940_0128992All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium722Open in IMG/M
3300034165|Ga0364942_0047845All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1372Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil20.31%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil20.31%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil12.50%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil7.03%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.03%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment4.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.69%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil4.69%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil3.91%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.91%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.56%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment1.56%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.78%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.78%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.78%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.78%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.78%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.78%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.78%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001356Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007EnvironmentalOpen in IMG/M
3300002558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cmEnvironmentalOpen in IMG/M
3300002560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cmEnvironmentalOpen in IMG/M
3300002562Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cmEnvironmentalOpen in IMG/M
3300002908Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cmEnvironmentalOpen in IMG/M
3300002915Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cmEnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005880Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_201EnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300007788Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009597Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT299EnvironmentalOpen in IMG/M
3300010301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015EnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011430Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2EnvironmentalOpen in IMG/M
3300012035Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT338_2EnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012226Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT400_2EnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300015254Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT860_16_10DEnvironmentalOpen in IMG/M
3300015356Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300017656Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015EnvironmentalOpen in IMG/M
3300017659Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018077Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019882Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2EnvironmentalOpen in IMG/M
3300021073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redoEnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021086Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300024330Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026285Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026297Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026308Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes)EnvironmentalOpen in IMG/M
3300026317Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes)EnvironmentalOpen in IMG/M
3300026327Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes)EnvironmentalOpen in IMG/M
3300026334Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes)EnvironmentalOpen in IMG/M
3300026523Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes)EnvironmentalOpen in IMG/M
3300026528Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes)EnvironmentalOpen in IMG/M
3300026530Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes)EnvironmentalOpen in IMG/M
3300026536Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes)EnvironmentalOpen in IMG/M
3300026540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes)EnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300027643Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300027961Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 (SPAdes)EnvironmentalOpen in IMG/M
3300028043 (restricted)Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0.5_MGEnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028803Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300031114Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300034164Sediment microbial communities from East River floodplain, Colorado, United States - 14_s17EnvironmentalOpen in IMG/M
3300034165Sediment microbial communities from East River floodplain, Colorado, United States - 19_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
JGI12269J14319_1018168213300001356Peatlands SoilVTRRTWATIIFVVWAGSLGWLAKRELFRSTSDRLAAAALAVPPGTDFYRLDLGGQQVGM
JGI25385J37094_1011966113300002558Grasslands SoilVSRRGWLVAILSAWVLSLGWLVKREVFRPTGARLAAAALAVPPGALFYRLDVGGQQMGYSSTT
JGI25383J37093_1007428533300002560Grasslands SoilVTRRGWAGTILVAWAASLGWLARREFFRSTGTRVTEAALSVP
JGI25382J37095_1006451533300002562Grasslands SoilVTRRGWATAILVXWVAALGWLVRREFFQSTGARLAEAALSVPPGAV
JGI25382J43887_1039194123300002908Grasslands SoilVNRRTWVIAVLTAWTLSLGWLVKREVFRPTGARLAAAAMAVAPGGLFYRLAVGGQ
JGI25387J43893_107735013300002915Grasslands SoilVSRRTLTAVILGAWIVSLGWLVKREVFRPTGARLAEAALRVPP
Ga0066680_1002480443300005174SoilVSRRGWLVAILSAWVLSLGWLVKREVFRPTGARLAAAALAVPPGALFYRLDVGGQ
Ga0066680_1043123713300005174SoilMTRRTWAVAILGAWAVSLGWLVKREFFRPTGARLAEAALSVPPGAV
Ga0066673_1043654033300005175SoilMTRRTWAIAILGAWAGSLGWLVKREFFRPTGTRLAEAALSVP
Ga0066679_1016978113300005176SoilVTRRGWAALILVAWAGSLGWLARRELFRSTGARLAEAALSV
Ga0070691_1056503623300005341Corn, Switchgrass And Miscanthus RhizosphereMSRRQWVVAIFIAWVLSLGWLVKREVFRSTGARLASAALAVPPGALFYRLDVGG
Ga0070710_1138057823300005437Corn, Switchgrass And Miscanthus RhizosphereMTRRTLAVAILGAWVLTLGWWVKRQVFRPAGARLAEAALSVPPGASYYR
Ga0070694_10173400423300005444Corn, Switchgrass And Miscanthus RhizosphereMSRRRWVVAILIAWVLSLGWLVKREVFRSTGARLAAAALAVPPGALFYRLDVGGQQVG
Ga0066686_1031029513300005446SoilVNRRTWVIAVLGAWALSLGWLVKREVFRSTGARLAAAAMAVAPGGLFYRLEVGGQQVG
Ga0066686_1091079213300005446SoilMTRRGWTALIFVAWAVALGWLARRELFRSMGARLAEAALSVPPG
Ga0070698_10075008523300005471Corn, Switchgrass And Miscanthus RhizosphereMTRRTLAVAILGAWVLTLGWWVKRQVFRPAGARLAEAALSVPPGASYYRL*
Ga0066697_1016626333300005540SoilMTRRSWAVAILGAWAASLGWLVKREFFRPTGTRLAEA
Ga0070695_10091590513300005545Corn, Switchgrass And Miscanthus RhizosphereVTRRHWASAVLAVWLLSLGWLVKRELFRSTGARLADAALSVPPGALFYRLDLGAQQVG
Ga0070693_10082134713300005547Corn, Switchgrass And Miscanthus RhizosphereVSRRQWVVAILIAWVLSLGWLVKREVFRPTGARLASAALAVPPGALFYRLD
Ga0066661_1003930413300005554SoilMTRRGWAALIFVAWAGSLGWLARRELFRSMGARLAE
Ga0066698_1012540413300005558SoilVSRRTLATVILGAWIVSLGWLVKREVFQPTGARLAEAALRVPPGA
Ga0066699_1029747133300005561SoilVTRRHWGIAILAAWGLSLGWLVKREMFRPTAARLAEAA
Ga0066693_1040396023300005566SoilVTRRGWTTAVMVAWAASLGWLVKREFFLTTAARLAEAARS
Ga0066703_1029345633300005568SoilVSRRTLAAVIIGAWIVSLGWLVKREVFPPTGARLAEAALRV
Ga0066705_1020238613300005569SoilVTRRGWAALIFVTWAASLGWLARRELFRSTGARLAD
Ga0075298_103264123300005880Rice Paddy SoilVTRRTWAIAIFAIWAASLGWLVKRTYFRSTGAKLAEAALSVPPGAMFYR
Ga0066651_1010459913300006031SoilMTRRTWAVAILGAWAASLGWLVKREFFRPTGTRLAEAA
Ga0066656_1109251113300006034SoilVTRRGWAAAILAAWAVSLGWLLRRELFQSTGARLAEAALSVPPGAVYYR
Ga0066653_1073522123300006791SoilVRRRGWAIAILAAWGLSLGWLIKRTYFRSTGQRLAEAALAVP
Ga0066659_1138485313300006797SoilMTRRSWAVAILGAWAASLGWLVKREFFRPTGTRLAEAALSVPPGA
Ga0075420_10009739613300006853Populus RhizosphereVTRKRWMVAILAIWALSLGWLVKREVFRTTGARLAE
Ga0075420_10056407913300006853Populus RhizosphereMTRRHWAIGVLAVWLLSLGWLAKRELFRSTSARLADAALSVPPGALFYRLDMG
Ga0075434_10019188143300006871Populus RhizosphereMSRRTWVVAILIAWALSLGWLVKREVFRPTGARLAEAALAVPP
Ga0099791_1051432523300007255Vadose Zone SoilMNRRTWVIAVLGAWALSLGWLVKREVFRSTGARLAAAAMAVAPGGLFYRLEV
Ga0099793_1000670613300007258Vadose Zone SoilVNRRRWVIAILTAWALSLGWLVKREVFRPTGARLAAAAMAVAPGGMFYRLAVGGQQVGYSST
Ga0099795_1027871933300007788Vadose Zone SoilVNRRTWVIAVLAAWALSLGWLVKREVFRPTGARLAEAAMAVAP
Ga0066710_10281058023300009012Grasslands SoilVTRRGWAVVILAAWAASLGWLVKREFFRTTGERLAEAALAVPPGTQF
Ga0099828_1037391633300009089Vadose Zone SoilVTRRGWAIAIFAVWGASLGWLVKREFFRTTGARLAEA
Ga0066709_10307454613300009137Grasslands SoilVTRRHWGIAILAAWGLSLGWLVKREIFRPTGARLAEA
Ga0066709_10318702123300009137Grasslands SoilVTRRGWVVTIFAAWAAALGWLVKREFFRTTGERLADAALAVPPGTEF*
Ga0066709_10392409223300009137Grasslands SoilVTRRGWAVAILGAWAVSLGWLVKRTYFQSTAARLADAALAVPPGATFYL
Ga0114129_1048291843300009147Populus RhizosphereVTRRHWAIAVLTAWLLSLGWLVKREVFRSTGARLADA
Ga0105259_103268013300009597SoilMSRRHWVIAIIAAWVLSLGWLVKREVFRPTGARLAAAALAVAPGGLF
Ga0134070_1013156333300010301Grasslands SoilVTRRGWAIAIFAAWSASLGWLVKREFFRTTGARLAEAALSVP
Ga0134109_1022792833300010320Grasslands SoilVTRRSWAAGILAAWVLSLGWLVKRELFRSTGARLA
Ga0134086_1036692723300010323Grasslands SoilVSRRGWALAILAAWILSLGWLIKRTYFRSTGQRLAEA
Ga0134086_1041148723300010323Grasslands SoilMTRRSWAVAILGAWAASLGWLVKREFFRPTGTRLAEAAL
Ga0134080_1000681313300010333Grasslands SoilVTRRGWALAILAAWILSLGWLIKRTYFRSTGQRLAEAALAVPP
Ga0134127_1343099123300010399Terrestrial SoilVTRRHWAIAVLAAWVLSLGWLVKRELFRSTGARLAEAALSV
Ga0150983_1293588323300011120Forest SoilVTRRHWAVAILIAWGVSVGLLVKREFFRTTGERLVEAALAVPPGTVFFRIDMAGHQVG
Ga0137423_102931813300011430SoilVSRRRWVVVILTAWALSVAWLVKREFFRTTGERLA
Ga0137445_113606823300012035SoilMTRRHWAIGVLAVWLLSLGWLAKRELFRSTSARLADAALSVPPGALFYRLDLGATQVGWV
Ga0137365_1069471233300012201Vadose Zone SoilVNRRRWVIAILAAWVLSLGWLVKREVFRPTGARLAAA
Ga0137363_1072793833300012202Vadose Zone SoilMTRRGWAIVIVSAWAVSLGWLFKRTYFRSTGAKLAEAALAVPPGAMFYRLAVGAQQLGYASTT
Ga0137399_1073405713300012203Vadose Zone SoilVNRRNWVIAVLAAWALSLGWLVKREVFRPTGARLAA
Ga0137380_1023348513300012206Vadose Zone SoilMTRRGWAALIFVAWAGSLGWLARRELFRSMGARLAEAALS
Ga0137381_1038774833300012207Vadose Zone SoilVTRRGWAVVILAAWAASLGWLVKREFFRTTGERLAEAALAVPP
Ga0137376_1033478533300012208Vadose Zone SoilVNRRTWVIAVLAAWVLSLGWLVKREVFRPTGARLAAAAMAVAPGGLFYRLAVGGQQVGYS
Ga0137376_1084769013300012208Vadose Zone SoilVTRRGWAIAIFAAWGASLGWLVKREFFRPTGTRLAEAALSVPPGA
Ga0137377_1000481613300012211Vadose Zone SoilVTRRGWATAILVAWVAALGWLVRREFFQSTGARLAEAAL
Ga0137447_110533223300012226SoilMTRRHWAIGVLAVWLLSLGWLAKRELFRSTSARLADAALSVPPGALFYRLDLGATQVGWVSATMDTLPDSI
Ga0137370_1000755213300012285Vadose Zone SoilMNRRRWAGAIFAVWALSLAWLVKREVFRPTGARLAEAALAVAPG
Ga0137387_1000934913300012349Vadose Zone SoilVTRRGWATAILVAWVAALGWLVRREFFQSTGARLAEAALS
Ga0137384_1003317543300012357Vadose Zone SoilVSRRGWVIAILTAWVLSLGWLVKRELFRPTGARLAEAALAVP*
Ga0137368_1022256033300012358Vadose Zone SoilVTRRYWAAGILAAWVLSVGWLVKRELFRSTGARLAEAAMSVSPGAMFYRLDLGGQQL
Ga0137390_1128657823300012363Vadose Zone SoilVSRRGWLVAILSAWVLSLGWLVKREVFRPTGARLAAAALAVPPGALFYRL
Ga0137373_1128582423300012532Vadose Zone SoilLNRRRWVIAILAAWALSLGWLVKREVFRPTGARLAAAAMAVAPGGLFYRLAVGGQQVG
Ga0137396_1040158213300012918Vadose Zone SoilVIAVLAAWAASLVWLVKREVFRPTGARLAAAAMAVAPGGLFYRLAVGGQQVGYSSTT
Ga0137404_1063977633300012929Vadose Zone SoilVNRRTWVIAVLGAWVLSLGWLVKREVFRPTGARLAAAALAVAPGGLFYRL
Ga0134076_1032497213300012976Grasslands SoilVSRRRWVIAILTAWVLSLGWLVKREVFRPTGARLAAAALAVPPGALFYRLDVGGQ*
Ga0157380_1133817813300014326Switchgrass RhizosphereMSRRRWVVAILIAWVLSVGWLVKREVFRSTGARLAAAAL
Ga0180089_103329133300015254SoilMSRRQWVIAILAAWALSLGWLVKREVFRPTGARLAAAALA
Ga0134073_1001440513300015356Grasslands SoilMTRRSWAVAILGAWAASLGWLVKREFFRPTGTRLAEAALSVP
Ga0134112_1046663123300017656Grasslands SoilVNRRTWVIAVLAAWALSLAWLVKREVFRPTGARLAAAAMAVAPGGLFYRLAVGGQQVG
Ga0134083_1038242213300017659Grasslands SoilMTRRGWAIVIVSAWAVSLGWLFKRTYFRSTGAKLAEAALAVPPGAMFYRLAVGAQQLGYASTTVDTL
Ga0184610_118658923300017997Groundwater SedimentMSRRQWVIAILAAWALSLGWLVKREVFRPTGARLAAAALAVPPGALFYRLDVGGQQVGFS
Ga0184623_1035638723300018056Groundwater SedimentVSRRQWVIAILAAWALSLGWLVKREVFRPTGARLAAAALAV
Ga0184618_1004603113300018071Groundwater SedimentVNRRRWVIAVLAAWAASLGWLVEREVFRPTGARLAAAAMAVAPGGLFY
Ga0184609_1057885023300018076Groundwater SedimentMTRRHWAIGVLAVWLLSLGWLAKRELFRSTSARLAEAALSVPPGA
Ga0184633_1010424133300018077Groundwater SedimentVSRRHWTIAILAAWALSLGWLVKREVFRSTGARLAEAALAVPPGALFYRL
Ga0184625_1041188823300018081Groundwater SedimentVTRRHWAIGILSVWLLSVGWLVKRELFRSTGARLADAALSVPPGSMFYRLDLGS
Ga0066667_1003108813300018433Grasslands SoilMTRRGWAIAILGAWAASLGWLVKREFFRPTGTRLAEA
Ga0066667_1041119333300018433Grasslands SoilMTRRGWAALIFVAWAGSLGWLARRELFRSMGARLAEAALSV
Ga0066669_1065900733300018482Grasslands SoilVSRRTWVIAILVAWALSLGWLVKREVFRPTGARLAEA
Ga0193713_102104213300019882SoilVNRRTWVIAVLGAWVLSLGWLVKREVFRPTGARLAAAAMAVAPGGL
Ga0210378_1032162323300021073Groundwater SedimentMSRRQWVIAILAAWALSLGWLVKREVFRPTGARLAAAALAVPPGALFYRLDVGG
Ga0210382_1000964853300021080Groundwater SedimentMTRRHWAIGVLAVWLLSLGWLAKRELFRSTSARLADAALSV
Ga0179596_1044353813300021086Vadose Zone SoilMTRRTWAVAILGAWAASLGWLVKREFFRPTGTRLAEAALSVPP
Ga0137417_108219313300024330Vadose Zone SoilVNRRNWVIAVLAAWALSLGWLVKREVFRPTGARLAAAAMAVAPGGLF
Ga0137417_129546433300024330Vadose Zone SoilVNRRNWVIAVLAAWALSLGWLVKREVFRPTGARLAAAAMAVAPGGLFYRL
Ga0207653_1004220243300025885Corn, Switchgrass And Miscanthus RhizosphereMTRRTLAVAILGAWVLTLGWWVKRQVFRPAGARLAEAALSVPPGASYY
Ga0207684_1063742713300025910Corn, Switchgrass And Miscanthus RhizosphereVTRRRWALAIFAAWAVALGWLVKREYFRSTGAKLAEAALAV
Ga0207684_1168236923300025910Corn, Switchgrass And Miscanthus RhizosphereMTRRTLAVAILGAWVLTLGWWVKRQVFRPAGARLAEAALSVP
Ga0207652_1100828223300025921Corn RhizosphereMSRRQWVVAIFIAWVLSLGWLVKREVFRSTVARLASAALAVPPGALFYRLDV
Ga0209438_112218813300026285Grasslands SoilVTRRHWAIGILAVWLLSIGWLVKRELFRSTGARLADAALSVPPGSMFYRL
Ga0209237_104258413300026297Grasslands SoilVSRRTLTALILGAWIVSLGWLVKREVFRPTGARLAEAALR
Ga0209237_112800533300026297Grasslands SoilVTRRGWAGAILVAWAASLGWLARREFFRSTGTRVTEAALSVPPGAV
Ga0209265_103378613300026308SoilVTRRGWAALIFVTWAASLGWLARRELFRSTGARLADAALSVPP
Ga0209154_130457823300026317SoilVTRRGWAALIFVTWAASLGWLARRELFRSTGARLADAALSVPPGAV
Ga0209266_117337833300026327SoilVNRRTWVIAVLGAWALSLGWLVKREVFRSTGARLAAAA
Ga0209377_112381433300026334SoilMMRRHWMIAALGAWALSLGWLVKRQFFQSTGARLAEAALAVPPGAIFYRLDVGG
Ga0209808_119165823300026523SoilVSRRTLATVIVGAWIVSLGWLVKREVFQPTGARLAEAALRVPPGAAYYR
Ga0209378_102135013300026528SoilVTRRGWATAILVAWVAALGWLVRREFFQSTGARLAEAALSVPPGA
Ga0209807_109878813300026530SoilVTRRGWAALIFVAWAGSLGWLARRELFRSTGARLAEAALSVPPGA
Ga0209058_100889813300026536SoilVSRRGWVIAILSAWVLSLGWLVKREVFRPTGARLAAAALAVPPGALFYRLDV
Ga0209058_114424833300026536SoilVNRRTWVIAVLAAWALSLAWLVKREVFRPTGARLAAAAMAVAPGGLFYRLAVGGQQGG
Ga0209376_113168413300026540SoilVSRRGWVIAILTAWVLSLGWLVKREVFRPTGARLAEAALAVPPGT
Ga0209648_1025213333300026551Grasslands SoilVNRRRWVIAILAAWALSLGWLVKREVFRPTGARLAAAALAVPP
Ga0209076_121107613300027643Vadose Zone SoilVNRRRWVIAILTAWALSLGWLVKREVFRPTGARLAAAAMAVAPGGMFYRLAVGGQQVGY
Ga0209590_1002441743300027882Vadose Zone SoilVNRRRWVIAILAAWTLSLGWLVKREVFRPTGARLAAAALAVPPGALFYRLDVGGQQV
Ga0209382_1130865913300027909Populus RhizosphereVTRRHWAIGILAVWVLSVGWLVKRELFRSTGARLADAALS
Ga0209853_117226313300027961Groundwater SandVSRRQWVIAILAAWALSLGWLVKREVFRPTGARLAAA
(restricted) Ga0233417_1062991213300028043SedimentVTRRQWGAAIIGVWVASLAWLVKREYFRPTGARLAEAAL
Ga0137415_1149249913300028536Vadose Zone SoilVNRRTWVIAVLAAWVLSLGWLVKREVFRPTGARLAAAAMAVAPGGLFYRLAVGGQQV
Ga0307282_1014843833300028784SoilVNRRTWVIAVLGAWVLSLGWLVKREVFRPTGARLAAAAMAVAPGGLFYRLEVGGQQVGYSSTT
Ga0307281_1037650013300028803SoilVNRRRWVIAVLAAWALSLGWLVKREVFRPTGARLAEAAMAVAPGGLFYRLAVGG
Ga0307302_1031015333300028814SoilMTRRAWALAILGAWTVSLGWLVTRQLFRPAGARLAEAALSVPPGSAYYRLD
Ga0307278_1049273613300028878SoilMTRRAWALAILGAWTVSLGWLVTRQLFRPAGARLAEAALSVPPGSA
Ga0308187_1026504913300031114SoilVTRRHWAIGILAVWLLSIGWLVKRELFRSTGARLADAALSVPPGSMFYRLDLGAQQVG
Ga0307468_10011459243300031740Hardwood Forest SoilVTRRRWVAAIFAAWALCLGLLVKRVFFRTTGERLAEAARSVPPGT
Ga0307468_10256936423300031740Hardwood Forest SoilMTRRHWTLAILAVWLLSLGWLVKREVFRSTGARLAEAALAVPPGALFYR
Ga0310900_1085996413300031908SoilVSRRQWVVAILIAWVLSLGWLVKREVFRPTGARLASAALA
Ga0307471_10002079153300032180Hardwood Forest SoilVTRRSLTMAILAAWVLSLGWLVKRQVFRPAGARLAEAALSVPPG
Ga0307471_10124974213300032180Hardwood Forest SoilVSRRNWVIAILSAWVLSLGWLVKREVFRPTGARLAEA
Ga0307471_10230007613300032180Hardwood Forest SoilMSRRHWVIAILVAWVLSLGWLVKREVFRPTGARLAAAALAVAPGGLFYRLDV
Ga0307472_10191419823300032205Hardwood Forest SoilVTRKRWLIVILAIWVLSLGWLVKREVFRPTGARLAEAALAIPPGALFYR
Ga0364940_0128992_1_1533300034164SedimentMSRRQWVIAILAAWALSLGWLVKREVFRPTGARLAAAALAVPPGALFYRLD
Ga0364942_0047845_1_1563300034165SedimentMTRRDWAIGLLALWGLSLGWLVKREFFRSTGARLAEAALSVPPGALYYRLDL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.