Basic Information | |
---|---|
Family ID | F064892 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 128 |
Average Sequence Length | 40 residues |
Representative Sequence | GFADGPAAAKHPAHDNLDAMHEWPGDPIAAQHNLWPPVLL |
Number of Associated Samples | 105 |
Number of Associated Scaffolds | 128 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 2.34 % |
% of genes near scaffold ends (potentially truncated) | 96.88 % |
% of genes from short scaffolds (< 2000 bps) | 89.84 % |
Associated GOLD sequencing projects | 102 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.19 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (65.625 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (25.781 % of family members) |
Environment Ontology (ENVO) | Unclassified (24.219 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.219 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 11.76% β-sheet: 0.00% Coil/Unstructured: 88.24% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.19 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 128 Family Scaffolds |
---|---|---|
PF04185 | Phosphoesterase | 10.94 |
PF00294 | PfkB | 5.47 |
PF08450 | SGL | 5.47 |
PF02771 | Acyl-CoA_dh_N | 4.69 |
PF03372 | Exo_endo_phos | 4.69 |
PF01259 | SAICAR_synt | 3.12 |
PF04542 | Sigma70_r2 | 2.34 |
PF02481 | DNA_processg_A | 2.34 |
PF13231 | PMT_2 | 1.56 |
PF06114 | Peptidase_M78 | 1.56 |
PF13368 | Toprim_C_rpt | 0.78 |
PF03795 | YCII | 0.78 |
PF08281 | Sigma70_r4_2 | 0.78 |
PF05977 | MFS_3 | 0.78 |
PF01040 | UbiA | 0.78 |
PF01494 | FAD_binding_3 | 0.78 |
PF00230 | MIP | 0.78 |
PF12770 | CHAT | 0.78 |
PF00005 | ABC_tran | 0.78 |
PF01554 | MatE | 0.78 |
PF13522 | GATase_6 | 0.78 |
PF00248 | Aldo_ket_red | 0.78 |
PF13560 | HTH_31 | 0.78 |
PF00082 | Peptidase_S8 | 0.78 |
PF03704 | BTAD | 0.78 |
PF13936 | HTH_38 | 0.78 |
PF13649 | Methyltransf_25 | 0.78 |
PF08241 | Methyltransf_11 | 0.78 |
COG ID | Name | Functional Category | % Frequency in 128 Family Scaffolds |
---|---|---|---|
COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 10.94 |
COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 5.47 |
COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 5.47 |
COG0758 | Predicted Rossmann fold nucleotide-binding protein DprA/Smf involved in DNA uptake | Replication, recombination and repair [L] | 4.69 |
COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 4.69 |
COG0152 | Phosphoribosylaminoimidazole-succinocarboxamide synthase | Nucleotide transport and metabolism [F] | 3.12 |
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 2.34 |
COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 2.34 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 2.34 |
COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 2.34 |
COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.56 |
COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.78 |
COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 0.78 |
COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.78 |
COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.78 |
COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.78 |
COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.78 |
COG3629 | DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domain | Transcription [K] | 0.78 |
COG3947 | Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domains | Transcription [K] | 0.78 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 65.62 % |
Unclassified | root | N/A | 34.38 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001403|JGI20205J14842_1008070 | All Organisms → cellular organisms → Bacteria | 1358 | Open in IMG/M |
3300005332|Ga0066388_108088683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 525 | Open in IMG/M |
3300005434|Ga0070709_10047256 | All Organisms → cellular organisms → Bacteria | 2680 | Open in IMG/M |
3300005434|Ga0070709_10353526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1086 | Open in IMG/M |
3300005445|Ga0070708_100140762 | All Organisms → cellular organisms → Bacteria | 2237 | Open in IMG/M |
3300005518|Ga0070699_101716596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 575 | Open in IMG/M |
3300005569|Ga0066705_10516363 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
3300005610|Ga0070763_10126666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1314 | Open in IMG/M |
3300005618|Ga0068864_101178025 | Not Available | 764 | Open in IMG/M |
3300005952|Ga0080026_10006663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2694 | Open in IMG/M |
3300006028|Ga0070717_10098671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2477 | Open in IMG/M |
3300006028|Ga0070717_10505124 | Not Available | 1093 | Open in IMG/M |
3300006041|Ga0075023_100636396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 501 | Open in IMG/M |
3300006176|Ga0070765_102107743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 527 | Open in IMG/M |
3300006575|Ga0074053_11993264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 622 | Open in IMG/M |
3300006806|Ga0079220_10209088 | All Organisms → cellular organisms → Bacteria | 1134 | Open in IMG/M |
3300009089|Ga0099828_11322818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 637 | Open in IMG/M |
3300009177|Ga0105248_11627252 | Not Available | 732 | Open in IMG/M |
3300009792|Ga0126374_11653254 | Not Available | 531 | Open in IMG/M |
3300010048|Ga0126373_10111053 | All Organisms → cellular organisms → Bacteria | 2550 | Open in IMG/M |
3300010048|Ga0126373_13262986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 505 | Open in IMG/M |
3300010048|Ga0126373_13321551 | Not Available | 500 | Open in IMG/M |
3300010154|Ga0127503_10469518 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 1507 | Open in IMG/M |
3300010337|Ga0134062_10667477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 543 | Open in IMG/M |
3300010359|Ga0126376_10476117 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
3300010359|Ga0126376_10623521 | Not Available | 1024 | Open in IMG/M |
3300010360|Ga0126372_12376894 | Not Available | 580 | Open in IMG/M |
3300010360|Ga0126372_12856180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 535 | Open in IMG/M |
3300010361|Ga0126378_10098805 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2875 | Open in IMG/M |
3300010361|Ga0126378_11128093 | Not Available | 884 | Open in IMG/M |
3300010366|Ga0126379_11195164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 867 | Open in IMG/M |
3300010376|Ga0126381_100680771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1470 | Open in IMG/M |
3300010376|Ga0126381_103137328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 654 | Open in IMG/M |
3300012096|Ga0137389_11531073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 563 | Open in IMG/M |
3300012096|Ga0137389_11715779 | Not Available | 524 | Open in IMG/M |
3300012189|Ga0137388_10204353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1781 | Open in IMG/M |
3300012201|Ga0137365_11287419 | Not Available | 519 | Open in IMG/M |
3300012204|Ga0137374_10953198 | Not Available | 625 | Open in IMG/M |
3300012207|Ga0137381_10631086 | Not Available | 933 | Open in IMG/M |
3300012210|Ga0137378_10189290 | Not Available | 1915 | Open in IMG/M |
3300012361|Ga0137360_11277501 | Not Available | 634 | Open in IMG/M |
3300012971|Ga0126369_10064175 | All Organisms → cellular organisms → Bacteria | 3194 | Open in IMG/M |
3300012986|Ga0164304_11365162 | Not Available | 580 | Open in IMG/M |
3300012989|Ga0164305_11798554 | Not Available | 553 | Open in IMG/M |
3300014655|Ga0181516_10317500 | Not Available | 793 | Open in IMG/M |
3300016445|Ga0182038_10151221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1772 | Open in IMG/M |
3300017926|Ga0187807_1035228 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1550 | Open in IMG/M |
3300017928|Ga0187806_1106905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 897 | Open in IMG/M |
3300017932|Ga0187814_10154661 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
3300017959|Ga0187779_10738772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 668 | Open in IMG/M |
3300017970|Ga0187783_11261067 | Not Available | 532 | Open in IMG/M |
3300017973|Ga0187780_10467009 | Not Available | 899 | Open in IMG/M |
3300017999|Ga0187767_10127404 | Not Available | 738 | Open in IMG/M |
3300018007|Ga0187805_10294852 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 746 | Open in IMG/M |
3300018007|Ga0187805_10494602 | Not Available | 573 | Open in IMG/M |
3300018044|Ga0187890_10487610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 693 | Open in IMG/M |
3300018060|Ga0187765_11138180 | Not Available | 544 | Open in IMG/M |
3300018482|Ga0066669_10651370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 926 | Open in IMG/M |
3300020199|Ga0179592_10103339 | All Organisms → cellular organisms → Bacteria | 1309 | Open in IMG/M |
3300021403|Ga0210397_10233431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1328 | Open in IMG/M |
3300021403|Ga0210397_11479580 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 527 | Open in IMG/M |
3300021404|Ga0210389_11517032 | Not Available | 509 | Open in IMG/M |
3300021405|Ga0210387_11462372 | Not Available | 586 | Open in IMG/M |
3300021407|Ga0210383_11044701 | Not Available | 691 | Open in IMG/M |
3300021420|Ga0210394_10665110 | Not Available | 914 | Open in IMG/M |
3300021433|Ga0210391_11099701 | Not Available | 617 | Open in IMG/M |
3300021474|Ga0210390_10671547 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
3300021477|Ga0210398_10655961 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 850 | Open in IMG/M |
3300021478|Ga0210402_10208236 | Not Available | 1798 | Open in IMG/M |
3300021560|Ga0126371_11726960 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 749 | Open in IMG/M |
3300024271|Ga0224564_1020270 | Not Available | 1202 | Open in IMG/M |
3300025474|Ga0208479_1103875 | Not Available | 515 | Open in IMG/M |
3300025627|Ga0208220_1022951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1984 | Open in IMG/M |
3300025922|Ga0207646_10635216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 957 | Open in IMG/M |
3300025922|Ga0207646_10944005 | Not Available | 764 | Open in IMG/M |
3300025929|Ga0207664_10015470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5539 | Open in IMG/M |
3300025929|Ga0207664_10089979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2514 | Open in IMG/M |
3300027567|Ga0209115_1134598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 556 | Open in IMG/M |
3300027874|Ga0209465_10601688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 544 | Open in IMG/M |
3300028906|Ga0308309_10467995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1087 | Open in IMG/M |
3300028906|Ga0308309_11493290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 577 | Open in IMG/M |
3300029999|Ga0311339_10413095 | Not Available | 1403 | Open in IMG/M |
3300030524|Ga0311357_10802511 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 845 | Open in IMG/M |
3300030626|Ga0210291_11194499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1101 | Open in IMG/M |
3300030706|Ga0310039_10380645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 522 | Open in IMG/M |
3300030740|Ga0265460_10005323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 2378 | Open in IMG/M |
3300031231|Ga0170824_115645902 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 727 | Open in IMG/M |
3300031446|Ga0170820_10959773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1588 | Open in IMG/M |
3300031543|Ga0318516_10669175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 590 | Open in IMG/M |
3300031545|Ga0318541_10148607 | All Organisms → cellular organisms → Bacteria | 1285 | Open in IMG/M |
3300031549|Ga0318571_10209193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 701 | Open in IMG/M |
3300031668|Ga0318542_10455408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 663 | Open in IMG/M |
3300031668|Ga0318542_10570190 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
3300031680|Ga0318574_10610076 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 640 | Open in IMG/M |
3300031708|Ga0310686_114453266 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 558 | Open in IMG/M |
3300031719|Ga0306917_10355006 | All Organisms → cellular organisms → Bacteria | 1140 | Open in IMG/M |
3300031719|Ga0306917_10604208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 862 | Open in IMG/M |
3300031724|Ga0318500_10746492 | Not Available | 500 | Open in IMG/M |
3300031744|Ga0306918_10123713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1878 | Open in IMG/M |
3300031744|Ga0306918_10970727 | Not Available | 661 | Open in IMG/M |
3300031770|Ga0318521_10607474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 661 | Open in IMG/M |
3300031781|Ga0318547_10791603 | Not Available | 590 | Open in IMG/M |
3300031782|Ga0318552_10369700 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
3300031795|Ga0318557_10149099 | Not Available | 1056 | Open in IMG/M |
3300031798|Ga0318523_10396492 | Not Available | 686 | Open in IMG/M |
3300031910|Ga0306923_10080038 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3660 | Open in IMG/M |
3300031910|Ga0306923_11691952 | Not Available | 654 | Open in IMG/M |
3300032059|Ga0318533_11041173 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 600 | Open in IMG/M |
3300032060|Ga0318505_10606924 | Not Available | 514 | Open in IMG/M |
3300032063|Ga0318504_10463089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 606 | Open in IMG/M |
3300032067|Ga0318524_10179188 | Not Available | 1079 | Open in IMG/M |
3300032076|Ga0306924_10309801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1811 | Open in IMG/M |
3300032094|Ga0318540_10610629 | Not Available | 525 | Open in IMG/M |
3300032261|Ga0306920_101377949 | Not Available | 1011 | Open in IMG/M |
3300032261|Ga0306920_101997700 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
3300032770|Ga0335085_10817789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1024 | Open in IMG/M |
3300032895|Ga0335074_10055763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5419 | Open in IMG/M |
3300032896|Ga0335075_10699559 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → Patulibacter americanus | 975 | Open in IMG/M |
3300032896|Ga0335075_11643586 | Not Available | 526 | Open in IMG/M |
3300032898|Ga0335072_10380646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1526 | Open in IMG/M |
3300033134|Ga0335073_10023642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 8523 | Open in IMG/M |
3300033134|Ga0335073_10988027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 873 | Open in IMG/M |
3300033158|Ga0335077_11969761 | Not Available | 543 | Open in IMG/M |
3300033289|Ga0310914_10942756 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
3300033290|Ga0318519_10104689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1528 | Open in IMG/M |
3300033290|Ga0318519_10423364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 795 | Open in IMG/M |
3300033290|Ga0318519_10483765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 744 | Open in IMG/M |
3300033829|Ga0334854_037916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides panacis | 1157 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 25.78% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.72% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.81% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.81% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 6.25% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.25% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.91% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.91% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.12% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.12% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 2.34% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.56% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.56% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.56% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.56% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.78% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.78% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.78% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.78% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.78% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.78% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.78% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.78% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.78% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.78% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.78% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.78% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.78% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.78% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.78% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001403 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-2 shallow-092012 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006575 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300014655 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaG | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
3300025474 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-3 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025627 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027567 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300030626 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO410-VDE110SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
3300030740 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assembly | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
3300033829 | Peat soil microbial communities from Stordalen Mire, Sweden - 715 P2 1-5 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI20205J14842_10080702 | 3300001403 | Arctic Peat Soil | VNLLHGFADGPAAAKYPAHDNLDSMHEWPGDPIAGQHNLWPPTVL* |
Ga0066388_1080886832 | 3300005332 | Tropical Forest Soil | AFADGPAAAGHPAHDNLAAMHEWAGDPIAAHHDLWPPVVL* |
Ga0070709_100472563 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | LLGFAGGPAAASHPATDNLDAMHEWPGDPIAAQQNLWPPIRL* |
Ga0070709_103535261 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | RAFADGPAASRHPARDNLQVTHEWAGDPIAAGHDLWPPVQP* |
Ga0070708_1001407621 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | LLHGFADGPAASKYRAQDNLDAMQEWSGDPIAAQHSLWPPVVL* |
Ga0070699_1017165962 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | ANLLHAFAHGPAAGKYPAHDNLAATREWPGDPIAAQHDLWPPVVL* |
Ga0066705_105163632 | 3300005569 | Soil | GPAAARHPAHDNLDATPEWPGDPIAAQHNLWPPVRL* |
Ga0070763_101266663 | 3300005610 | Soil | EGPAAAKHPAQDNLGAMHEWPGDPMGAQHNLWPPVVL* |
Ga0068864_1011780251 | 3300005618 | Switchgrass Rhizosphere | AAASHPVTDNLDAMHEWPGDPIAAQQNLWPPIRL* |
Ga0080026_100066632 | 3300005952 | Permafrost Soil | VLRAFADGPAAASTGRDNLRQLGEWAGDPIAGRHSLWT* |
Ga0070717_100986715 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | EGPAAAKYPAHDNLDSMNEWAGDPIAGQHNLWPPVVL* |
Ga0070717_105051242 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | AFADGPAAAKHPARDNLAAMQEWPGDAIAAQHNLWPPVVL* |
Ga0075023_1006363962 | 3300006041 | Watersheds | SSILHAFAGGPAAAKYPAQDNLHSMQEWAGDPIAAQHDLWPPVTL* |
Ga0070765_1021077432 | 3300006176 | Soil | FADGPAAARCPARDNLDAMREYAGDPIAAQHDLWPPVIL* |
Ga0074053_119932641 | 3300006575 | Soil | VTANLLHGFAHGPAAVEHPADDNLDAMHEWPGDPIAAEYNLWPPLRL* |
Ga0079220_102090881 | 3300006806 | Agricultural Soil | LRAFADGPAAARYPARDNLRAMREWPGDPIAAQHNLW* |
Ga0099828_113228182 | 3300009089 | Vadose Zone Soil | SDGPAAAKFPARDNLDAMKEWPGDPIAAGHDLWPPVVL* |
Ga0105248_116272522 | 3300009177 | Switchgrass Rhizosphere | LGFAGGPAAASHPVTDNLDAMHEWPGDPIAAQQNLWPPIRL* |
Ga0126374_116532541 | 3300009792 | Tropical Forest Soil | AFADGPAAAKHPARDNLAATREWPGDPLTAGHNLWPPVVL* |
Ga0126373_101110534 | 3300010048 | Tropical Forest Soil | TRNVLHAFADGPAAAKYPAHDNLAAMNEWAGDPIASHHNLWPPIHL* |
Ga0126373_132629861 | 3300010048 | Tropical Forest Soil | RAFAEGPAAAKYPAHDNLAATGEWAGDPIAAGHNLWPPIRL* |
Ga0126373_133215511 | 3300010048 | Tropical Forest Soil | PAAAKYPAHDNLAAMDEWAGDPIASRHNLWPPTHL* |
Ga0127503_104695182 | 3300010154 | Soil | AGGPAAAMHPAHDNLDAMHQWPGDPIAAQYNLWPPIRL* |
Ga0134062_106674771 | 3300010337 | Grasslands Soil | RDVTANLLRACADGPAAAKYPAHDNLAAMHEFAGDPIAAHHNLWPPQVR* |
Ga0126376_104761171 | 3300010359 | Tropical Forest Soil | GPAAAKYPAHDNLAAMNEWAGDPIASHHNLWPPIHL* |
Ga0126376_106235212 | 3300010359 | Tropical Forest Soil | LRAFADGPAAAKHPAHDNLAAMHEWAGDPIAAHHNLWPPVVL* |
Ga0126372_123768941 | 3300010360 | Tropical Forest Soil | LGFADGPAGAEHPADDNLDAMHEWPGDPIAAQYNLWPPIRL* |
Ga0126372_128561801 | 3300010360 | Tropical Forest Soil | LLHAFADGPAAAKHPARDNLGATQEWPGDPIAAQHNLWPPVVL* |
Ga0126378_100988051 | 3300010361 | Tropical Forest Soil | ADGPAAAKYPANDNLDSMQEWPGDPIAAKHSLWPPTVL* |
Ga0126378_111280931 | 3300010361 | Tropical Forest Soil | NVLRAFADGPAAHKHPARDNLDAIKPWAGNPIASGHNLW* |
Ga0126379_111951642 | 3300010366 | Tropical Forest Soil | TRNVLGAFADGPAAAKHPARDNLAATREWPGDPLTAGHNLWPPVVL* |
Ga0126381_1006807713 | 3300010376 | Tropical Forest Soil | LLRAFADGPAAAKYSAHDNLAAMHEWAGDPIAARHNLWPPVVL* |
Ga0126381_1031373282 | 3300010376 | Tropical Forest Soil | LRAFADGPAAAKYPAHDNLHAMREWPGDPIAARHDLWPPVVL* |
Ga0137389_115310732 | 3300012096 | Vadose Zone Soil | VNLLHGFAEGPAAARYPAHDNLDSMHEWPGDPIAGQHNLWPPTVL* |
Ga0137389_117157791 | 3300012096 | Vadose Zone Soil | GPAAARYPAADNLAAMREWPGDPIAARHNLWPPVVR* |
Ga0137388_102043532 | 3300012189 | Vadose Zone Soil | GPAAAKYPATDNLAAIHEWPGDPIAASHNLWPPVVR* |
Ga0137365_112874192 | 3300012201 | Vadose Zone Soil | PAAAKHPARDNLDAMHEWPGDPIAAQHNLWPPVVR* |
Ga0137374_109531982 | 3300012204 | Vadose Zone Soil | QVTANLLHGFAGGPAAAAYPAHDNLGSMHEWPGDPIAARHNLWPPAVL* |
Ga0137381_106310861 | 3300012207 | Vadose Zone Soil | LRAFADGPAAAKYPAHDNLAEMHEWPGDPIAARHNLWPPVIL* |
Ga0137378_101892903 | 3300012210 | Vadose Zone Soil | PAAAKYPAHDNLDAMHEWPGDPIAARHNLWPPVIL* |
Ga0137360_112775011 | 3300012361 | Vadose Zone Soil | AAAAYPAHDNLDSMHEWAGDPIAGQHNLWPPVVL* |
Ga0126369_100641754 | 3300012971 | Tropical Forest Soil | VLQAFADGPAAAKHPANDNLDSMQEWPGDPIAAHHDLWPPTVL* |
Ga0164304_113651621 | 3300012986 | Soil | RRTTANLLHGFADGPAAAGHPATDNLDAMHEWPGDPIAALQNLWPPIRL* |
Ga0164305_117985542 | 3300012989 | Soil | LGFAGGPAAASHPAHDNLDAMHEWRGDPIAAQYNLWPPIRL* |
Ga0181516_103175002 | 3300014655 | Bog | VLRAFADGPAAANYPAHDNLDSMDEWAGDPLASGHNLWPPIVL* |
Ga0182038_101512213 | 3300016445 | Soil | ADGPAAHKYPAHDNLAAMNEWPGDPIAAQHNLWPPVHL |
Ga0187807_10352281 | 3300017926 | Freshwater Sediment | PAAAKYPANDNLDAMQEWPGDPVAGQHNLWPPVVL |
Ga0187806_11069051 | 3300017928 | Freshwater Sediment | HAFADGPAAAKHPAHDNLAAMQEWAGDPIAAQHNLWPPIHL |
Ga0187814_101546612 | 3300017932 | Freshwater Sediment | AFADGPAAAKYPARDNLDAMDEWPGDPIAAQHNLWPPVHL |
Ga0187779_107387721 | 3300017959 | Tropical Peatland | DGPAAARFPAHDNLDAMHEWPGDPIAAGHNLWPPVVL |
Ga0187783_112610672 | 3300017970 | Tropical Peatland | DGQAADKHPAQDNLDAMQEWAGDPIAAQHDLWPPVVL |
Ga0187780_104670092 | 3300017973 | Tropical Peatland | AAAAKYPAHDNLDAMQEWSGDPIAAQHDLWPPVTL |
Ga0187767_101274042 | 3300017999 | Tropical Peatland | ADGPAAASHPAHDNLDSMDEWPGDPIAAQHNLWPPVVL |
Ga0187805_102948522 | 3300018007 | Freshwater Sediment | GPAAAKYPANDNLDQMQEWAGDPIAGGHNLWPPTVL |
Ga0187805_104946022 | 3300018007 | Freshwater Sediment | LHAFADGPAAARHPAHDNLAAMHEWAGDPIAAQHNLWPPVHL |
Ga0187890_104876101 | 3300018044 | Peatland | NVLRAFADGPAAAKYPAQDNLDAMSEWPGDPIAAQHDLWPPVIL |
Ga0187765_111381802 | 3300018060 | Tropical Peatland | RAFADGPAAAKYPARDNLDAMQEWAGDPIAAQHDLWPPVVL |
Ga0066669_106513701 | 3300018482 | Grasslands Soil | LLHGFARGPAAARHPAHDNLAAMHEFAGDPIAAHHNLWPPQVR |
Ga0179592_101033392 | 3300020199 | Vadose Zone Soil | LLRGFADGPAAAKHPARDNLNAVQEWPGDPIAAQHNLWPPVRR |
Ga0210397_102334313 | 3300021403 | Soil | AGGPAAAKHPAHDNLDAMHEWPGDPMAAHHDLWPPVRL |
Ga0210397_114795802 | 3300021403 | Soil | SNVLHAFADGPAAAKYPAHDNLAQMQEWAGDPIAAGHNLWPPVVL |
Ga0210389_115170321 | 3300021404 | Soil | PAAAKYPAHDNLDSMHEWAGDPIAGQHDLWPPVHL |
Ga0210387_114623721 | 3300021405 | Soil | TTNLLHGFADGPAAAKYPAHDNLGSMHEWAGDPIAGQHNLWPPVVL |
Ga0210383_110447012 | 3300021407 | Soil | PAAAKYPAHDNLDSMHEWPGDPIAGQHNLWPPVVL |
Ga0210394_106651101 | 3300021420 | Soil | LLQGFADGPAAAKHPAHDNLHAMNEWPGDPIAAQNNLWPPVVL |
Ga0210391_110997012 | 3300021433 | Soil | PAAGKHPAQDNLDAMQEWPGDPIAAQHDLWPPVVL |
Ga0210390_106715471 | 3300021474 | Soil | HGFAGGPAAARHPAHDNLDAMHEWPGDPMAAHHDLWPPVRL |
Ga0210398_106559612 | 3300021477 | Soil | LLRGFADGPAADKHPAQDNLDAMQEWSGDPIAAQHDLWPPVVL |
Ga0210402_102082361 | 3300021478 | Soil | FADGPAAAKHPAHDNLAATKEWAGDPVAAQHNLWPPVVL |
Ga0126371_117269602 | 3300021560 | Tropical Forest Soil | LQAFAQGPAAAKYPAKDNLVAMQEWPGDPIAAHHNLWPPTVL |
Ga0224564_10202701 | 3300024271 | Soil | VKRVSANLLRGFADGPAAGKHPAQDNLDAMQEWPGDPIAAQHDLWPPVVL |
Ga0208479_11038752 | 3300025474 | Arctic Peat Soil | LLHGFAGGPAAASHPAQDNLDSMHEWPGDPIAARRDLWPPVVL |
Ga0208220_10229511 | 3300025627 | Arctic Peat Soil | LLRGFAEGPAAAKFPAHDNLDSMHEWPGDPIAAQHNLWPPVVL |
Ga0207646_106352161 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | LAAAKHPAHDNLAAMHEWAGDPIAAHHNLWPPVVL |
Ga0207646_109440051 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | ARGPAAAKYPATDNLAAMHEWPGDPIAASHNLWPPVVR |
Ga0207664_100154705 | 3300025929 | Agricultural Soil | PAAARYPAHDNLAAMHEWPGDPIAAQHDLWPPVVR |
Ga0207664_100899794 | 3300025929 | Agricultural Soil | ADGPAAARYPARDNLAAMQEWPGDPIAAQHSLWPPVVR |
Ga0209115_11345981 | 3300027567 | Forest Soil | FADGPAAAKHPARDNLDAMHEWPGDPISAGHNLWPPITL |
Ga0209465_106016882 | 3300027874 | Tropical Forest Soil | LHGFADGPAAAKHPARDNLAATHEWPGDPIAAQHNLWPSVVR |
Ga0308309_104679951 | 3300028906 | Soil | FADGPAAAKYPAHDNLDSMHEWPGDPIAGQHNLWPPVVL |
Ga0308309_114932901 | 3300028906 | Soil | AFADGPAAARCPARDNLDAMREYAGDPIAAQHDLWPPVIL |
Ga0311339_104130951 | 3300029999 | Palsa | AFADGPAAASHPAQDNLDAMDEYAGDPIAAQHNLW |
Ga0311357_108025111 | 3300030524 | Palsa | DGPAAAKYPAHDNLEEMREWPGDPIAAQHDLWPPVLL |
Ga0210291_111944992 | 3300030626 | Soil | VLKAFADGPAAHQHPAHDNVEAMHAWAGDPITTGHTLW |
Ga0310039_103806451 | 3300030706 | Peatlands Soil | LRAFADGPAAARYPAQDNLDAMDEWPGDPIAAQHDLWPPVVL |
Ga0265460_100053233 | 3300030740 | Soil | AFADGPAAHKHPAHDNVEALQAWPGDPISAGHNLWPPVIL |
Ga0170824_1156459021 | 3300031231 | Forest Soil | QVTTNLLHGFADGPAAAKYPAHDNLGSMHEWAGDPIAGQHNLWPPVVL |
Ga0170820_109597731 | 3300031446 | Forest Soil | PAAIRFGATDNLAAQHEWPGDPVAAHHNLWPPVVR |
Ga0318516_106691751 | 3300031543 | Soil | DGPAAAKHPAHDNLAAMHEWAGDPIAANHNLWPPVVL |
Ga0318541_101486072 | 3300031545 | Soil | RAFADGPAAAKYPAHDNLDALREWAGDPIAAQHDLWPPVTL |
Ga0318571_102091931 | 3300031549 | Soil | PAAAKHPAHDNLAAMHEWAGDPIAANHNLWPPVVL |
Ga0318542_104554082 | 3300031668 | Soil | LCWAAAKHPAHDNLDAMQEWAGDPIAAQHNLWPPVVL |
Ga0318542_105701902 | 3300031668 | Soil | FADGPAAAKHPAHDNLDAMDEWAGDPIAAQHNLWPPVHL |
Ga0318574_106100762 | 3300031680 | Soil | FADGPAAARHPAHDNLPAMQEWAGDPIAAQHNLWPPMVL |
Ga0310686_1144532661 | 3300031708 | Soil | HVTLNILRGFADGPAAAKYPAHDNLDSMHEWAGDPIAGQHSLWPPVTL |
Ga0306917_103550061 | 3300031719 | Soil | LRAFADGPAAAKYPARDNLEAMQEWAGDPIAAQHDLWPPVTL |
Ga0306917_106042081 | 3300031719 | Soil | GPAAAKHPAHDNLAAMHEWAGDPIAANHNLWPPVVL |
Ga0318500_107464922 | 3300031724 | Soil | LLRGFADGPAAAKHPARDNLDAMQEWAGDPIAAQHNLWPPVVL |
Ga0306918_101237131 | 3300031744 | Soil | LRAFADGPVAAKHPAHDNLAAMQEWAGDPIAAHHNLWPPMVL |
Ga0306918_109707271 | 3300031744 | Soil | ATTANLLRGFADGPAAAKHPAHDNLDAMQEWPGDPIAAQHNLWPPVLL |
Ga0318521_106074741 | 3300031770 | Soil | RAFADGPAAHKYPAHDNLAAMNEWPGDPIAAQHNLWPPVHL |
Ga0318547_107916032 | 3300031781 | Soil | TANLLRGFADGPAAAKHPAHDNLDAMQEWAGDPIAAQHNLWPPVVL |
Ga0318552_103697002 | 3300031782 | Soil | GPAAAKYPARDNLGALREWAGDPIAAQHDLWPPVTL |
Ga0318557_101490992 | 3300031795 | Soil | NLLRAYAGGPAAAKHPAHDNLAAMQAWPGDPIAGHHNLWPPIVL |
Ga0318523_103964921 | 3300031798 | Soil | GFADGPAAAKHPAHDNLDAMHEWPGDPIAAQHNLWPPVLL |
Ga0306923_100800381 | 3300031910 | Soil | DGPAAAKHPAHDNLAAMHEWPGDPIAAQHNLWPPVVR |
Ga0306923_116919522 | 3300031910 | Soil | KATTANLLRGFADGPAAAKHPAHDNLDAMQEWPGDPIAAQHNLWPPVVL |
Ga0318533_110411732 | 3300032059 | Soil | PAAHKYPAHDNLAAMNEWPGDPIAAQHNLWPPVHL |
Ga0318505_106069242 | 3300032060 | Soil | AATANLLRGFADGPAAAKHPAHDNLDAMQEWAGDPIAAQHNLWPPVVL |
Ga0318504_104630891 | 3300032063 | Soil | LRAYADGPAAAKHPAHDNLAAMHEWAGDPIAANHNLWPPVVL |
Ga0318524_101791882 | 3300032067 | Soil | ACMAAKHPAHDNLAAMQAWPGDPIAGHHNLWPPIVL |
Ga0306924_103098013 | 3300032076 | Soil | GPVAAKHPAHDNLAAMQEWAGDPIAAHHNLWPPMVL |
Ga0318540_106106292 | 3300032094 | Soil | STANLLRGFADGPAAAKHPAHDNLDAMQEWAGDPIAAQHNLWPPVVL |
Ga0306920_1013779491 | 3300032261 | Soil | YADGPAAAKHPAHDNLAAMHEWAGDPIAANHNLWPPVVL |
Ga0306920_1019977002 | 3300032261 | Soil | LRAFADGPAAAKYPARDNLDAMQEWAGDPIAAQHDLWPPVTR |
Ga0335085_108177892 | 3300032770 | Soil | NVLRAFAEGPAAAKHSAHDNLAAMHEWPGDPIAAKHDLWPPVVL |
Ga0335074_100557631 | 3300032895 | Soil | AFADGPAAAKYPARDNLGSMHEWPGDPIAAQHNLWPPVVL |
Ga0335075_106995592 | 3300032896 | Soil | HAFADGPAADKYPAHDNLDAMHEWAGDPMAAQHNLWPPIVL |
Ga0335075_116435862 | 3300032896 | Soil | RGFADGPAADKHPAQDNLDAMQEWSGDPIAAQHDLWPPVVL |
Ga0335072_103806461 | 3300032898 | Soil | LHAFADGPAAARYPARDNLASMHEWPGDPIAGQHNLWPPVVL |
Ga0335073_1002364210 | 3300033134 | Soil | PAADKHPAQDNLDAMQEWSGDPIAAQHDLWPPVVL |
Ga0335073_109880272 | 3300033134 | Soil | FADGPAAARYPARDNLEAMHEWPGDPLAAGHNLWPPVQL |
Ga0335077_119697612 | 3300033158 | Soil | FADGPAAARYPAHDNLAAMHEWPGDPLAAGHNLWPPVVL |
Ga0310914_109427561 | 3300033289 | Soil | DGPAAAKYPAHDNLDAMQEWAGDPIAAQHNLWPPVTL |
Ga0318519_101046891 | 3300033290 | Soil | AFADGPAAAKHPAHDNLAAMHEWPGDPIAAQHNLWPPVVR |
Ga0318519_104233641 | 3300033290 | Soil | YADGPAAAKHRAHDNLAAMHEWAGDPIAANHNLWPPVVL |
Ga0318519_104837651 | 3300033290 | Soil | ANLLRGFADGPAAAKHPAHDNLDAMQEWAGDPIAAQHNLWPPVVL |
Ga0334854_037916_26_142 | 3300033829 | Soil | VLRAFADGPAAASYPAHDNLDAMDEWPGDPIAAQHDLW |
⦗Top⦘ |