NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F064944

Metagenome / Metatranscriptome Family F064944

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F064944
Family Type Metagenome / Metatranscriptome
Number of Sequences 128
Average Sequence Length 43 residues
Representative Sequence QLPARRQWFVEASRFAGVEPREPARKGDPMSLEKFIAAGMR
Number of Associated Samples 120
Number of Associated Scaffolds 128

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.78 %
% of genes near scaffold ends (potentially truncated) 99.22 %
% of genes from short scaffolds (< 2000 bps) 90.62 %
Associated GOLD sequencing projects 117
AlphaFold2 3D model prediction Yes
3D model pTM-score0.43

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (90.625 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(15.625 % of family members)
Environment Ontology (ENVO) Unclassified
(19.531 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(51.562 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 21.74%    β-sheet: 0.00%    Coil/Unstructured: 78.26%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.43
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 128 Family Scaffolds
PF03401TctC 37.50
PF00378ECH_1 17.19
PF02611CDH 11.72
PF00528BPD_transp_1 3.91
PF01590GAF 3.12
PF00501AMP-binding 1.56
PF04392ABC_sub_bind 1.56
PF03741TerC 1.56
PF01977UbiD 1.56
PF00497SBP_bac_3 0.78
PF13458Peripla_BP_6 0.78
PF01145Band_7 0.78
PF01734Patatin 0.78
PF13336AcetylCoA_hyd_C 0.78
PF13578Methyltransf_24 0.78
PF00903Glyoxalase 0.78
PF07992Pyr_redox_2 0.78
PF08450SGL 0.78
PF12706Lactamase_B_2 0.78
PF00005ABC_tran 0.78
PF01875Memo 0.78

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 128 Family Scaffolds
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 37.50
COG2134CDP-diacylglycerol pyrophosphataseLipid transport and metabolism [I] 11.72
COG00433-polyprenyl-4-hydroxybenzoate decarboxylaseCoenzyme transport and metabolism [H] 1.56
COG0861Tellurite resistance membrane protein TerCInorganic ion transport and metabolism [P] 1.56
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 1.56
COG1355Predicted class III extradiol dioxygenase, MEMO1 familyGeneral function prediction only [R] 0.78
COG1752Predicted acylesterase/phospholipase RssA, containd patatin domainGeneral function prediction only [R] 0.78
COG3386Sugar lactone lactonase YvrECarbohydrate transport and metabolism [G] 0.78
COG3391DNA-binding beta-propeller fold protein YncEGeneral function prediction only [R] 0.78
COG3621Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotRGeneral function prediction only [R] 0.78
COG4667Predicted phospholipase, patatin/cPLA2 familyLipid transport and metabolism [I] 0.78

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms90.62 %
UnclassifiedrootN/A9.38 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000597|AF_2010_repII_A1DRAFT_10020718All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1804Open in IMG/M
3300000655|AF_2010_repII_A100DRAFT_1002208All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales3615Open in IMG/M
3300000793|AF_2010_repII_A001DRAFT_10066945All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium780Open in IMG/M
3300000955|JGI1027J12803_102173024Not Available1130Open in IMG/M
3300002917|JGI25616J43925_10088631All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii1288Open in IMG/M
3300004081|Ga0063454_101892902All Organisms → cellular organisms → Bacteria → Proteobacteria525Open in IMG/M
3300004156|Ga0062589_102583396All Organisms → cellular organisms → Bacteria → Proteobacteria527Open in IMG/M
3300004633|Ga0066395_10029566All Organisms → cellular organisms → Bacteria → Proteobacteria2271Open in IMG/M
3300005184|Ga0066671_10324613All Organisms → cellular organisms → Bacteria971Open in IMG/M
3300005332|Ga0066388_101780486All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1094Open in IMG/M
3300005332|Ga0066388_106740989Not Available578Open in IMG/M
3300005437|Ga0070710_10105151All Organisms → cellular organisms → Bacteria → Proteobacteria1687Open in IMG/M
3300005467|Ga0070706_100537155All Organisms → cellular organisms → Bacteria → Proteobacteria1088Open in IMG/M
3300005471|Ga0070698_100983111All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales791Open in IMG/M
3300005529|Ga0070741_11133778All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales663Open in IMG/M
3300005543|Ga0070672_100088581All Organisms → cellular organisms → Bacteria → Proteobacteria2492Open in IMG/M
3300005552|Ga0066701_10244645All Organisms → cellular organisms → Bacteria → Proteobacteria1109Open in IMG/M
3300005555|Ga0066692_10690218All Organisms → cellular organisms → Bacteria → Proteobacteria634Open in IMG/M
3300005591|Ga0070761_10637325All Organisms → cellular organisms → Bacteria665Open in IMG/M
3300005713|Ga0066905_100186117All Organisms → cellular organisms → Bacteria → Proteobacteria1537Open in IMG/M
3300005719|Ga0068861_100753702All Organisms → cellular organisms → Bacteria → Proteobacteria910Open in IMG/M
3300005764|Ga0066903_104654812All Organisms → cellular organisms → Bacteria → Proteobacteria731Open in IMG/M
3300005764|Ga0066903_105721734All Organisms → cellular organisms → Bacteria → Proteobacteria653Open in IMG/M
3300005843|Ga0068860_100723996All Organisms → cellular organisms → Bacteria → Proteobacteria1005Open in IMG/M
3300005921|Ga0070766_11023301All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300005937|Ga0081455_10034501All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria4532Open in IMG/M
3300006028|Ga0070717_10846133All Organisms → cellular organisms → Bacteria832Open in IMG/M
3300006176|Ga0070765_100043741All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Thalassobaculaceae → Oceanibaculum → Oceanibaculum indicum3604Open in IMG/M
3300006176|Ga0070765_101197042All Organisms → cellular organisms → Bacteria717Open in IMG/M
3300006176|Ga0070765_101776572All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300006580|Ga0074049_13194354All Organisms → cellular organisms → Bacteria → Proteobacteria636Open in IMG/M
3300006794|Ga0066658_10833545All Organisms → cellular organisms → Bacteria → Proteobacteria523Open in IMG/M
3300006853|Ga0075420_101783602All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium526Open in IMG/M
3300006893|Ga0073928_10199956All Organisms → cellular organisms → Bacteria1566Open in IMG/M
3300009090|Ga0099827_10970159All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria737Open in IMG/M
3300009094|Ga0111539_12149950All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium647Open in IMG/M
3300009137|Ga0066709_104254783All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium522Open in IMG/M
3300009162|Ga0075423_10719759All Organisms → cellular organisms → Bacteria → Proteobacteria1054Open in IMG/M
3300009525|Ga0116220_10268966Not Available746Open in IMG/M
3300009553|Ga0105249_11217698All Organisms → cellular organisms → Bacteria → Proteobacteria824Open in IMG/M
3300009698|Ga0116216_10781541All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300009700|Ga0116217_10323543All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria988Open in IMG/M
3300010036|Ga0126305_10605535All Organisms → cellular organisms → Bacteria737Open in IMG/M
3300010045|Ga0126311_10741342All Organisms → cellular organisms → Bacteria → Proteobacteria788Open in IMG/M
3300010048|Ga0126373_11283554All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium798Open in IMG/M
3300010048|Ga0126373_12103526All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium626Open in IMG/M
3300010335|Ga0134063_10609580Not Available556Open in IMG/M
3300010360|Ga0126372_12539521All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300010397|Ga0134124_13215632All Organisms → cellular organisms → Bacteria → Proteobacteria501Open in IMG/M
3300010398|Ga0126383_13697696All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium500Open in IMG/M
3300010401|Ga0134121_11650538All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium662Open in IMG/M
3300012189|Ga0137388_11176533All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium704Open in IMG/M
3300012208|Ga0137376_11453692All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium576Open in IMG/M
3300012351|Ga0137386_10829124All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium664Open in IMG/M
3300012357|Ga0137384_10071068All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp.2891Open in IMG/M
3300012362|Ga0137361_11690435All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium553Open in IMG/M
3300012515|Ga0157338_1063037All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium561Open in IMG/M
3300012922|Ga0137394_11055419All Organisms → cellular organisms → Bacteria → Proteobacteria674Open in IMG/M
3300012948|Ga0126375_10212182All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1281Open in IMG/M
3300012971|Ga0126369_12084598All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300013096|Ga0157307_1088566All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium641Open in IMG/M
3300014654|Ga0181525_10428421Not Available728Open in IMG/M
3300014968|Ga0157379_11775649All Organisms → cellular organisms → Bacteria → Proteobacteria606Open in IMG/M
3300015372|Ga0132256_102100565All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium670Open in IMG/M
3300015374|Ga0132255_105938236All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales517Open in IMG/M
3300016341|Ga0182035_10037791All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium3182Open in IMG/M
3300016422|Ga0182039_10080453All Organisms → cellular organisms → Bacteria → Proteobacteria2339Open in IMG/M
3300016445|Ga0182038_11649676All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria577Open in IMG/M
3300017792|Ga0163161_10114249All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae2022Open in IMG/M
3300017965|Ga0190266_11213761All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium523Open in IMG/M
3300017970|Ga0187783_10291076All Organisms → cellular organisms → Bacteria1192Open in IMG/M
3300018028|Ga0184608_10083116All Organisms → cellular organisms → Bacteria → Proteobacteria1315Open in IMG/M
3300018086|Ga0187769_10721720All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria753Open in IMG/M
3300019361|Ga0173482_10275612All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium728Open in IMG/M
3300021475|Ga0210392_10295271All Organisms → cellular organisms → Bacteria → Proteobacteria1160Open in IMG/M
3300021559|Ga0210409_10973090Not Available723Open in IMG/M
3300022731|Ga0224563_1025348All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300022881|Ga0224545_1023106All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales895Open in IMG/M
3300024288|Ga0179589_10597533All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium517Open in IMG/M
3300025916|Ga0207663_10970089All Organisms → cellular organisms → Bacteria → Proteobacteria681Open in IMG/M
3300025919|Ga0207657_11062115All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium620Open in IMG/M
3300025932|Ga0207690_11122885All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium655Open in IMG/M
3300025937|Ga0207669_10734036All Organisms → cellular organisms → Bacteria → Proteobacteria814Open in IMG/M
3300025944|Ga0207661_10092236All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales2525Open in IMG/M
3300026089|Ga0207648_12088940All Organisms → cellular organisms → Bacteria → Proteobacteria527Open in IMG/M
3300026325|Ga0209152_10500744All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium501Open in IMG/M
3300026538|Ga0209056_10138968All Organisms → cellular organisms → Bacteria → Proteobacteria1888Open in IMG/M
3300027061|Ga0209729_1050561All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia530Open in IMG/M
3300027882|Ga0209590_10521656All Organisms → cellular organisms → Bacteria → Proteobacteria767Open in IMG/M
3300027908|Ga0209006_10358984All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1233Open in IMG/M
3300027909|Ga0209382_10399457All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1531Open in IMG/M
3300028023|Ga0265357_1000069All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae3733Open in IMG/M
3300028708|Ga0307295_10037931All Organisms → cellular organisms → Bacteria → Proteobacteria1222Open in IMG/M
3300028712|Ga0307285_10185288All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300028712|Ga0307285_10221376All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales533Open in IMG/M
3300028784|Ga0307282_10070881All Organisms → cellular organisms → Bacteria1584Open in IMG/M
3300028796|Ga0307287_10284017All Organisms → cellular organisms → Bacteria → Proteobacteria626Open in IMG/M
3300028819|Ga0307296_10526822All Organisms → cellular organisms → Bacteria → Proteobacteria646Open in IMG/M
3300028881|Ga0307277_10115803All Organisms → cellular organisms → Bacteria → Proteobacteria1146Open in IMG/M
3300031226|Ga0307497_10527791All Organisms → cellular organisms → Bacteria → Proteobacteria586Open in IMG/M
3300031525|Ga0302326_12490515Not Available650Open in IMG/M
3300031546|Ga0318538_10092662All Organisms → cellular organisms → Bacteria → Proteobacteria1549Open in IMG/M
3300031546|Ga0318538_10562385Not Available618Open in IMG/M
3300031564|Ga0318573_10292541All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium871Open in IMG/M
3300031680|Ga0318574_10295891All Organisms → cellular organisms → Bacteria → Proteobacteria940Open in IMG/M
3300031747|Ga0318502_10148531All Organisms → cellular organisms → Bacteria1336Open in IMG/M
3300031763|Ga0318537_10307203All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium587Open in IMG/M
3300031764|Ga0318535_10001334All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales6787Open in IMG/M
3300031792|Ga0318529_10291706All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium759Open in IMG/M
3300031793|Ga0318548_10622136All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales525Open in IMG/M
3300031794|Ga0318503_10285896All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium535Open in IMG/M
3300031805|Ga0318497_10160011All Organisms → cellular organisms → Bacteria1235Open in IMG/M
3300031845|Ga0318511_10117096All Organisms → cellular organisms → Bacteria1145Open in IMG/M
3300031893|Ga0318536_10252987All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium895Open in IMG/M
3300031897|Ga0318520_11071705All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300031910|Ga0306923_11844267Not Available619Open in IMG/M
3300031912|Ga0306921_11183018All Organisms → cellular organisms → Bacteria → Proteobacteria852Open in IMG/M
3300031913|Ga0310891_10356697All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium526Open in IMG/M
3300031945|Ga0310913_11230622All Organisms → cellular organisms → Bacteria → Proteobacteria520Open in IMG/M
3300031954|Ga0306926_10775056All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1158Open in IMG/M
3300032039|Ga0318559_10138105All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae1102Open in IMG/M
3300032044|Ga0318558_10552014Not Available575Open in IMG/M
3300032160|Ga0311301_12451385Not Available586Open in IMG/M
3300032205|Ga0307472_100118100All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68601867Open in IMG/M
3300032805|Ga0335078_11851543All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria653Open in IMG/M
3300032805|Ga0335078_12040365All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales612Open in IMG/M
3300033290|Ga0318519_10110232Not Available1493Open in IMG/M
3300033551|Ga0247830_10177253All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1577Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil15.62%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil9.38%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.03%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.47%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.69%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil4.69%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.91%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.91%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.12%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.12%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil2.34%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.56%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.56%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.56%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.56%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.56%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.56%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.56%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.56%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.56%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.56%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.78%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.78%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.78%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.78%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.78%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.78%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.78%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.78%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.78%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.78%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.78%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.78%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.78%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.78%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.78%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000597Forest soil microbial communities from Amazon forest - 2010 replicate II A1EnvironmentalOpen in IMG/M
3300000655Forest soil microbial communities from Amazon forest - 2010 replicate II A100EnvironmentalOpen in IMG/M
3300000793Forest soil microbial communities from Amazon forest - 2010 replicate II A001EnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300002917Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cmEnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006580Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012515Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610Host-AssociatedOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013096Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2EnvironmentalOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300022731Soil microbial communities from Bohemian Forest, Czech Republic ? CSU4EnvironmentalOpen in IMG/M
3300022881Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 20-24EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300027061Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028023Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5Host-AssociatedOpen in IMG/M
3300028708Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152EnvironmentalOpen in IMG/M
3300028712Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031763Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031794Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031913Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
AF_2010_repII_A1DRAFT_1002071833300000597Forest SoilWFVEASRFAGVEPREPARKGEPMSLEKFIAAGMR*
AF_2010_repII_A100DRAFT_100220813300000655Forest SoilARRQWFVEASRFAGVEPREPARKGDPMSLEKFIAAGTR*
AF_2010_repII_A001DRAFT_1006694523300000793Forest SoilWFVEASRFAGVEPREPTRKGDPMSLEKFIAAGMR*
JGI1027J12803_10217302423300000955SoilRQQWFAEASRFAGVEPREPARQGEPVSLEKFIAAGTR*
JGI25616J43925_1008863113300002917Grasslands SoilAMQRRWQLPARRQWFVEASRFAGVAPREPTRKGEPLSLEKFIAAGMR*
Ga0063454_10189290213300004081SoilDASQSMKRRWQLPARQQWFGEASRFAGVEPREPARKGDPLSLEKFIAAGMR*
Ga0062589_10258339623300004156SoilAKRRWQLPARRQWFVEASRFSGVESREPAHKGDPMSLEKFIAAGAR*
Ga0066395_1002956633300004633Tropical Forest SoilMDIENEPVRWDASRAMQRRWQLPARAQWFVEASRFAGVAPRAPARKGEPMSLEKFIAAGMR*
Ga0066671_1032461323300005184SoilRWQLPARRQWFIEASRFVGIEPREPARPGDPLSLEKFIAAGMR*
Ga0066388_10178048633300005332Tropical Forest SoilLPARAMWFKEASRFRGVPPREPAHRREPMRLERYVAAAR*
Ga0066388_10674098913300005332Tropical Forest SoilFAGKRRWQLPARAMWFNEASRLSGVLPREPAHQREPMTLERYVAAAR*
Ga0070710_1010515133300005437Corn, Switchgrass And Miscanthus RhizosphereHAMQRRWQLPARRQWFVEASRFAGVEPRPPARKGEPMSLEKFIAAGMR*
Ga0070706_10053715523300005467Corn, Switchgrass And Miscanthus RhizospherePARRQWFVEASRFAGVEPREPARKGDPMSLEKFIAAGMR*
Ga0070698_10098311123300005471Corn, Switchgrass And Miscanthus RhizosphereDSAKRRWQLPARRQWFAEASRFAGVEPRGPAKKGTPRSLEDFLAAGMR*
Ga0070741_1113377823300005529Surface SoilVAGKRRWQLPARAMWFNEASRFVGVEPKEPPAGRAPMTLEKFVAAQ*
Ga0070672_10008858133300005543Miscanthus RhizosphereMKRRWQLPARQQWFAEASRFAGVEPREPARKGDPLSLEKFIAAGMR*
Ga0066701_1024464513300005552SoilQWFVEASRFAGVAPREPARKGEPMSLEKFLGAGIR*
Ga0066692_1069021813300005555SoilWDASHAMQRRWQLPARGQWFVEASRFAGVAPREPARKGEPMSLEKFLAAGRR*
Ga0070761_1063732523300005591SoilMWFAEASRFAGVEPREPAHKGNPMTLERYVAAAK*
Ga0066905_10018611713300005713Tropical Forest SoilPARRQWYVEASQFAGVAPREPDKKGDPMSLEKFIAMGVR*
Ga0068861_10075370213300005719Switchgrass RhizospherePARQQWFAEASPFAGVELREPARKGDPLSLEKFIAAGMR*
Ga0066903_10465481223300005764Tropical Forest SoilMKRRWQLPARLQWFTEASRFAGIEPREPAHKGDPMSLEKFLAAGMR*
Ga0066903_10572173413300005764Tropical Forest SoilLPARRQWFVEASRFAGVEPREPARKGDPMSLEKFIAAGMR*
Ga0068860_10072399613300005843Switchgrass RhizosphereQLPARQQWFAEASRFAGVEPREPARKGDPLSLEKFIAAGMR*
Ga0070766_1102330113300005921SoilAMWFAEASRFAGVEPREPAHKGNPMTLERYVAAAK*
Ga0081455_1003450153300005937Tabebuia Heterophylla RhizosphereWQLPARQQWFVEASRFADVEPREPARKGDPMSLEKFIAGGIR*
Ga0070717_1084613323300006028Corn, Switchgrass And Miscanthus RhizospherePARAQWFSQASRFAGVEPREPAGKGNPMTLERYLGAAR*
Ga0070765_10004374163300006176SoilLPARAMWFAEASRFAGVEPREPAHKGNPMTLERYVAAAK*
Ga0070765_10119704223300006176SoilWQLPARAMWFAEASRFAGVEPREPAHKGNPMTLERYVAAAK*
Ga0070765_10177657223300006176SoilWQLPARAMWFAEASRFAGVEPREPAHKGNPMTLERYVSAAR*
Ga0074049_1319435413300006580SoilQQWFAEASPFAGVELREPARKGDPMSLEKFIAAGMR*
Ga0066658_1083354513300006794SoilWDASHAMQRRWQLPARGQWFVEASRFAGVAPREPARKGEPMSLEKFLAAGIR*
Ga0075420_10178360213300006853Populus RhizosphereSLAAKRRWQLPPRRQWHVEASRFAGVEPRDPAHKGDPMNLEKFIAAGMR*
Ga0073928_1019995613300006893Iron-Sulfur Acid SpringRWQLPARAQWFNEASRFAGVEVVEPARAGSPRTLEKYVADQG*
Ga0099827_1097015923300009090Vadose Zone SoilWFDEASRFAGVAPRDPARKGDPLSLEKFIAAGMR*
Ga0111539_1214995023300009094Populus RhizosphereWFVEASRFADVEPREPARKGDPMSLEKFVAAGMR*
Ga0066709_10425478323300009137Grasslands SoilENGRVRWDASFAMQRRWQLPARQQWFVEASRFAEVEPRAPTKKGDPLSLEKFIAAGMR*
Ga0075423_1071975913300009162Populus RhizosphereQLPARRQWFVEASRFAGVEPRPPARKGEPMSLEKFIAAGMR*
Ga0116220_1026896613300009525Peatlands SoilARAMWFAEASRFAGVEPREPAHKGNPMTLERYVAAAK*
Ga0105249_1121769823300009553Switchgrass RhizosphereMKRRWQLPARQQWFAEASRFAGVEPREPARKGDPLSLEKFIAAGLR*
Ga0116216_1078154113300009698Peatlands SoilLPARAMWFAEASRFAGVEPREPAHKGNPMTLERYVAAAR*
Ga0116217_1032354333300009700Peatlands SoilAMWFAEASRFAGVEPREPAHKGNPMTLERYVAAK*
Ga0126305_1060553523300010036Serpentine SoilARRQWYTEASRFAALEPREPPRKGSPMTLEKYLGLED*
Ga0126311_1074134213300010045Serpentine SoilLPARQQWFAEASPFAGVELREPARKGDPMSLEKFIAAGMR*
Ga0126373_1128355413300010048Tropical Forest SoilQWFVEASRFAGVAPRAPARKGEPMSLEKFIAAGMR*
Ga0126373_1210352613300010048Tropical Forest SoilQLPARRQWFVEASRFAGVEPREPARKGDPMSLERFIAAGMR*
Ga0134063_1060958013300010335Grasslands SoilPARRQWFVEASRFAGVEPREPARKDEPMSLEKFIAAGMR*
Ga0126372_1253952123300010360Tropical Forest SoilQRRWQLPARRQWFVEASRFAGVEPRAPARKGEPMSLEKFIAAGMR*
Ga0134124_1321563213300010397Terrestrial SoilQLPARQQWFAEASPFAGVELREPARKGDPLSLEKFIAAGMR*
Ga0126383_1369769623300010398Tropical Forest SoilDASHAMKRRWQLPARRQWFVEASRFAGVEPREPARKGDPMSLETFIAAGMR*
Ga0134121_1165053813300010401Terrestrial SoilPVRWDASQSMKRRWQLPARQQWFAEASRFAGVEPREPARKGDPLSLEKFIAAGTR*
Ga0137388_1117653323300012189Vadose Zone SoilDIENEPVRWDLSHAAKRRWQLPARRQWVLEASRFSGVAPRDPEKKGDPMSLEKFIAAGMR
Ga0137376_1145369223300012208Vadose Zone SoilRRQWFVEASRFANVEPSEPVRKGDPLSLEKFVAAGMR*
Ga0137386_1082912423300012351Vadose Zone SoilMQRRWQLPARRQWFGEASRFAGVAPREPARKGEPMSLEKFLGAGIR*
Ga0137384_1007106813300012357Vadose Zone SoilRQWFVEASRFVGVEPREPARKGDPMSLEKFIAAGMR*
Ga0137361_1169043513300012362Vadose Zone SoilLPARRQWFVEASRFANVEPSEPVRKGDPLSLEKFVAAGMR*
Ga0157338_106303723300012515Arabidopsis RhizosphereQLPARQQWFVEASRFADVEPREPARKGDPMSLERFIAAGMR*
Ga0137394_1105541923300012922Vadose Zone SoilKRRWQLPARQQWFAEASRFAGVELREPARKGDSLSLEKFVAAGMR*
Ga0126375_1021218223300012948Tropical Forest SoilDIENEPVRWDASRAMQRRWQLPARAQWFVEASRFAGVAPRAPARKGEPMSLEKFIAAGMR
Ga0126369_1208459823300012971Tropical Forest SoilWDASHAMQRRWQLPARRQWFVEASRFAGVEPRAPARKGEPMSLEKFITAGMR*
Ga0157307_108856623300013096SoilPARQQWFAEASPFAGVELREPARKGDPMSLEKFIAAGMR*
Ga0181525_1042842123300014654BogARAQWFTEASRFAGLEPRESASKRSPMTLEKYVGAK*
Ga0157379_1177564913300014968Switchgrass RhizosphereLPARQQWFAEASPFAGVELREPARKGDPLSLEKFIAAGMR*
Ga0132256_10210056523300015372Arabidopsis RhizosphereQSMKRRWQLPARQQWFAEASRFAGVEPREPARKGDPLSLEKFIAAGMR*
Ga0132255_10593823623300015374Arabidopsis RhizosphereEPVRWDVSYAAKRRWQLPARRQWFVEASRFSGVESREPAHKGDPMSLEKFIAAGAR*
Ga0182035_1003779143300016341SoilRWQLPARRQWFVEASRFAGVEPRELARKGEPMSLEKFIAAGMR
Ga0182039_1008045333300016422SoilVMDIENEPVRWDASVAMKRRWQLPARRQWFVEASRFADVEPREPARKGDPLSLEKFISEGKR
Ga0182038_1164967623300016445SoilQWFVEASRFAGVEPREPARKGDPMSLEKFIAAGMR
Ga0163161_1011424933300017792Switchgrass RhizosphereVMDIENEPMRWDASQSMKRRWQLPARQQWFAEASPFSGVELREPARKGDPLSLEKFIADGTR
Ga0190266_1121376113300017965SoilKRRWQLPPRRQWHVEASRFAGVEPRDPAHKGDPMNLEKFIAAGMR
Ga0187783_1029107613300017970Tropical PeatlandAGKRRWQLPARAMWFNEASRFRGVPPREPAHQREPMTLERYVAAAR
Ga0184608_1008311623300018028Groundwater SedimentPARQQWFAEASRFAGVELREPARKGDPLSLEKFVAAGMR
Ga0187769_1072172023300018086Tropical PeatlandAGKRRWQLPARAMWFAEASRFAGVEPKEPPAGRSPMTLERYVAAK
Ga0173482_1027561223300019361SoilQLPARQQWFAEASRFAGVEPREPARKGDPLSLEKFIAAGMR
Ga0210392_1029527113300021475SoilLPARRQWFVEASRFAGVEPRAPARKGEPMSLEKFIAAGMR
Ga0210409_1097309023300021559SoilQQWFVEASRFAGVEPREPARKGEPLSLERFIAAGMR
Ga0224563_102534823300022731SoilLPARGQWFTEASRFAGVETREPAHKGNPMTLEKYVAAK
Ga0224545_102310623300022881SoilPARAMWFAEASRFAGVEPREPAHKGNPMTLERYVAAAK
Ga0179589_1059753323300024288Vadose Zone SoilAMQRRWQLPARRQWFVEASRFAGVAPREPTRKGEPLSLEKFIAAGMR
Ga0207663_1097008913300025916Corn, Switchgrass And Miscanthus RhizosphereASHAMQRRWQLPARRQWFVEASRFAGVEPRAPARKGEPMSLEKFIADGMR
Ga0207657_1106211513300025919Corn RhizosphereRQQWFAEASPFAGVELREPARKGDPMSLEKFIAAGVR
Ga0207690_1112288523300025932Corn RhizosphereRQQWFAEASPFAGVELREPARKGDPMSLEKFIAAGMR
Ga0207669_1073403623300025937Miscanthus RhizosphereLPARQQWFAEASPFSGVELREPARKGDPLSLEKFIAAGTR
Ga0207661_1009223633300025944Corn RhizospherePARQQWFAEASRFAGVEPREPARKGDPLSLEKFIAAGMR
Ga0207648_1208894023300026089Miscanthus RhizosphereYAAKRRWQLPARRQWFVEASRFSGVESREPAHKGDPMSLEKFIAAGAR
Ga0209152_1050074413300026325SoilRRWQLPARGQWFVEASRFAGVAPREPARKGEPMSLEKFLAAGIR
Ga0209056_1013896833300026538SoilRQWFVEASRFVGVEPREPARKGDPMSLEKFIAAGMR
Ga0209729_105056113300027061Forest SoilRRQWFVEASRFAGVEPREPAHKGDPMSLEKFIAADMR
Ga0209590_1052165623300027882Vadose Zone SoilIENEPVRWDLSHAAKRRWQLPARRQWFLEASRFSGVAPRDPDKKGDPMSLEKFIAAGMR
Ga0209006_1035898433300027908Forest SoilPARAMWFAEASHFAGVEPREPAHKGNPMTLERYVAAAK
Ga0209382_1039945733300027909Populus RhizosphereAKRRWQLPPRRQWHVEASRFAGVEPRDPAHKGDPMNLEKFIAAGMR
Ga0265357_100006963300028023RhizosphereQLPARAMWFAEASRFAGVEPREPAHKGNPMTLERYVAAAK
Ga0307295_1003793113300028708SoilQSMKRRWQLPARQQWFAEASRFAGVELREPARKGDPLSLEKFVAAGMR
Ga0307285_1018528813300028712SoilPARQQWFAEASPFAGVELREPARKGDPMSLEKFIAAGMR
Ga0307285_1022137613300028712SoilASQSMKRRWQLPARQQWFAEASRFAGVALREPARKGDPLSLEKFVAAGMR
Ga0307282_1007088113300028784SoilRQWFHETSRFAGVEPRDPAKKGAPRSLEDFLAAGMR
Ga0307287_1028401723300028796SoilQSMKRRWQLPARQQWFAEASRFAGVELREPARKGDPLSLEKFIAAGMR
Ga0307296_1052682213300028819SoilWDASQSMKRRWQLPARQQWFAEASRFAGVELREPARKGDPLSLEKFIAAGMR
Ga0307277_1011580313300028881SoilQWFAEASRFAGVELREPARKGDPLSLEKFVAAGMR
Ga0307497_1052779123300031226SoilQSMKRRWQLPARQQWFAEASRFAGVALREPARKGDPLSLEKFVAAGMR
Ga0302326_1249051513300031525PalsaAGKRRWQLPARARWFNEACPFVGVEPKEPAGGRAPMTLEKYVAAQ
Ga0318538_1009266213300031546SoilLTACRRQWFVEASRFAGVEPRELARKGEPMSLEKFIAAGMR
Ga0318538_1056238513300031546SoilIVSFTACRRQWFVEASRFAGVEPREPARKGDPMSLEKFIAAGMR
Ga0318573_1029254113300031564SoilQLPARRQWFVEASRFAGVEPREPARKGDPMSLEKFIAAGMR
Ga0318574_1029589133300031680SoilPARRQWFVEASRFAGVEPREPARKGDPMSLEKFIAAGMR
Ga0318502_1014853113300031747SoilWQLPARAVWFAEASRFAGVEPREPAHKGSPMTLERYVAAR
Ga0318537_1030720323300031763SoilRQWFVEASRFAGVEPREPARKGDPMSLEKFIAAGMR
Ga0318535_1000133413300031764SoilASLAMKRRWQLPARRQWFIEASRFAGVEPRVPDRKGDPLSLEKFIAAGMR
Ga0318529_1029170623300031792SoilRWQLPVRRQWFVEASRFAGVEPRELARKGEPMSLEKFIAAGMR
Ga0318548_1062213623300031793SoilLPARAMWFAEASRFAGVEPREPAHKGNPMTLERYVAAAR
Ga0318503_1028589623300031794SoilQWFVEASRFAGVEPRELARKGEPMSLEKFIAAGMR
Ga0318497_1016001113300031805SoilRWQLPARRQWFVEASRFADVEPREPARKGDPLSLEKFISEGMR
Ga0318511_1011709623300031845SoilLPARRQWFVEASRFADVEPREPARKGDPLSLEKFISEGKR
Ga0318536_1025298723300031893SoilRQWFIEASRFAGVEPREPARKGDPMSLEKFIAAGMR
Ga0318520_1107170513300031897SoilGKRRWQLPARAMWFAEASRFAGVEPRESAHKGNPMTLERYVAAR
Ga0306923_1184426723300031910SoilEPVRWDASFAMQRRWQLPARRQWFAEASRFTGVEPCEPSRKGDPLSLEKFLAAGTR
Ga0306921_1118301813300031912SoilDIENEPVRWDASVAMKRRWQLPARRQWFVEARRFAGVETREPARKGETMSLEKFVASGAR
Ga0310891_1035669713300031913SoilQWFAEASRFAGVEPREPARKGDPLSLEKFIAAGMR
Ga0310913_1123062223300031945SoilNEPVRWDASVAMKRRWQLPARRQWFVEASRFADVEPREPARKGDPLSLEKFISEGKR
Ga0306926_1077505613300031954SoilSQAMKRRWQLPARRHWFVEASRFAGVEPREPARKGDPMSLEKFIAGGMR
Ga0318559_1013810523300032039SoilGWQLPARRQWFIEASRFAGVEPRVPDRKGDPLSLEKFIAAGMR
Ga0318558_1055201413300032044SoilRRQWFVEASRFAGVEPREPARKGDPMSLEKFIAAGMR
Ga0311301_1245138523300032160Peatlands SoilRRWQLTARAMWFAEASRFAGVEPREPAHKGNPMTLERYVAAAK
Ga0307472_10011810033300032205Hardwood Forest SoilVRWDASYAAKRRWQLPPRRQWYTEASLFAGVEPREPARRGDPFSLEKFLAVEK
Ga0335078_1185154313300032805SoilGKRRWQLPARACWFAEASRFGGVEPRAPAETRSPMTLEKYVAAK
Ga0335078_1204036523300032805SoilARAQWYTQASRFLGVEPRDPDKKGNPMTLERYLAVAH
Ga0318519_1011023213300033290SoilARRQWFVEASRFAGVEPREPARKGDPMSLEKFIAAGMR
Ga0247830_1017725333300033551SoilQLPARQQWFAEASPFAGVELREPARKGDPMSLEKFIAAGMR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.