NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F064993

Metagenome / Metatranscriptome Family F064993

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F064993
Family Type Metagenome / Metatranscriptome
Number of Sequences 128
Average Sequence Length 39 residues
Representative Sequence GGHPLLVQACQDAVKEWKFVPAPEETTQVVEFEFHAN
Number of Associated Samples 107
Number of Associated Scaffolds 128

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.78 %
% of genes near scaffold ends (potentially truncated) 98.44 %
% of genes from short scaffolds (< 2000 bps) 91.41 %
Associated GOLD sequencing projects 103
AlphaFold2 3D model prediction Yes
3D model pTM-score0.51

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.219 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(25.000 % of family members)
Environment Ontology (ENVO) Unclassified
(28.125 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(46.875 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 21.54%    β-sheet: 0.00%    Coil/Unstructured: 78.46%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.51
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 128 Family Scaffolds
PF00672HAMP 32.81
PF127294HB_MCP_1 3.12
PF01584CheW 3.12
PF02203TarH 0.78
PF00072Response_reg 0.78
PF01339CheB_methylest 0.78
PF03544TonB_C 0.78
PF02274ADI 0.78
PF03705CheR_N 0.78
PF02743dCache_1 0.78
PF00512HisKA 0.78
PF01627Hpt 0.78

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 128 Family Scaffolds
COG0840Methyl-accepting chemotaxis protein (MCP)Signal transduction mechanisms [T] 1.56
COG1352Methylase of chemotaxis methyl-accepting proteinsSignal transduction mechanisms [T] 1.56
COG2201Chemotaxis response regulator CheB, contains REC and protein-glutamate methylesterase domainsSignal transduction mechanisms [T] 1.56
COG0810Periplasmic protein TonB, links inner and outer membranesCell wall/membrane/envelope biogenesis [M] 0.78
COG1834N-Dimethylarginine dimethylaminohydrolaseAmino acid transport and metabolism [E] 0.78
COG2235Arginine deiminaseAmino acid transport and metabolism [E] 0.78
COG2972Sensor histidine kinase YesMSignal transduction mechanisms [T] 0.78
COG4874Uncharacterized conserved proteinFunction unknown [S] 0.78

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.22 %
UnclassifiedrootN/A0.78 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2189573001|GZR05M102GYYFDAll Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium516Open in IMG/M
3300000550|F24TB_13220468All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium587Open in IMG/M
3300001593|JGI12635J15846_10305013All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis994Open in IMG/M
3300001593|JGI12635J15846_10868969All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300001661|JGI12053J15887_10284891All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis812Open in IMG/M
3300001661|JGI12053J15887_10527879All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis563Open in IMG/M
3300002245|JGIcombinedJ26739_100156274All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2155Open in IMG/M
3300004080|Ga0062385_10145225All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1218Open in IMG/M
3300004080|Ga0062385_10235213All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1012Open in IMG/M
3300005450|Ga0066682_10351050All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter950Open in IMG/M
3300005467|Ga0070706_101906371All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium539Open in IMG/M
3300005468|Ga0070707_101567530All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter626Open in IMG/M
3300005540|Ga0066697_10236851All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1083Open in IMG/M
3300005554|Ga0066661_10794445All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300005568|Ga0066703_10831192All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter527Open in IMG/M
3300005586|Ga0066691_10556978All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium683Open in IMG/M
3300005586|Ga0066691_10608459All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae650Open in IMG/M
3300005944|Ga0066788_10132500All Organisms → cellular organisms → Bacteria628Open in IMG/M
3300006028|Ga0070717_10367298All Organisms → cellular organisms → Bacteria1289Open in IMG/M
3300006047|Ga0075024_100261342All Organisms → cellular organisms → Bacteria835Open in IMG/M
3300006102|Ga0075015_100280555All Organisms → cellular organisms → Bacteria911Open in IMG/M
3300006174|Ga0075014_100988289All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300006603|Ga0074064_10821807All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300006806|Ga0079220_11354849All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300006903|Ga0075426_10510287All Organisms → cellular organisms → Bacteria894Open in IMG/M
3300009143|Ga0099792_10306350All Organisms → cellular organisms → Bacteria945Open in IMG/M
3300009524|Ga0116225_1358733All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300009624|Ga0116105_1023567All Organisms → cellular organisms → Bacteria1305Open in IMG/M
3300009700|Ga0116217_11016608All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300010046|Ga0126384_10675857All Organisms → cellular organisms → Bacteria912Open in IMG/M
3300010048|Ga0126373_10909809All Organisms → cellular organisms → Bacteria944Open in IMG/M
3300010159|Ga0099796_10204144All Organisms → cellular organisms → Bacteria803Open in IMG/M
3300010325|Ga0134064_10187891All Organisms → cellular organisms → Bacteria735Open in IMG/M
3300010358|Ga0126370_10628418All Organisms → cellular organisms → Bacteria932Open in IMG/M
3300010360|Ga0126372_11855044All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300010360|Ga0126372_12548341All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300010376|Ga0126381_102615913All Organisms → cellular organisms → Bacteria722Open in IMG/M
3300011269|Ga0137392_10814526All Organisms → cellular organisms → Bacteria771Open in IMG/M
3300011270|Ga0137391_10456523All Organisms → cellular organisms → Bacteria1086Open in IMG/M
3300012096|Ga0137389_10085253All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter2478Open in IMG/M
3300012189|Ga0137388_10014151All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis5776Open in IMG/M
3300012199|Ga0137383_11354827All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300012202|Ga0137363_11480440All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300012205|Ga0137362_10315870All Organisms → cellular organisms → Bacteria1353Open in IMG/M
3300012205|Ga0137362_11261306All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300012210|Ga0137378_10619244All Organisms → cellular organisms → Bacteria993Open in IMG/M
3300012351|Ga0137386_10394062Not Available997Open in IMG/M
3300012362|Ga0137361_10646481All Organisms → cellular organisms → Bacteria968Open in IMG/M
3300012582|Ga0137358_10370331All Organisms → cellular organisms → Bacteria970Open in IMG/M
3300012582|Ga0137358_10470914All Organisms → cellular organisms → Bacteria847Open in IMG/M
3300012918|Ga0137396_10728559All Organisms → cellular organisms → Bacteria731Open in IMG/M
3300012922|Ga0137394_10885220All Organisms → cellular organisms → Bacteria746Open in IMG/M
3300012923|Ga0137359_11360782All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300012925|Ga0137419_11022377All Organisms → cellular organisms → Bacteria685Open in IMG/M
3300012925|Ga0137419_11456161All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300012925|Ga0137419_11614170All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300012927|Ga0137416_10731272All Organisms → cellular organisms → Bacteria871Open in IMG/M
3300012927|Ga0137416_11926506All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300012930|Ga0137407_10987347All Organisms → cellular organisms → Bacteria797Open in IMG/M
3300012944|Ga0137410_10162640All Organisms → cellular organisms → Bacteria1708Open in IMG/M
3300014169|Ga0181531_10398868All Organisms → cellular organisms → Bacteria846Open in IMG/M
3300014495|Ga0182015_10056799All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2832Open in IMG/M
3300014501|Ga0182024_10004875All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae30481Open in IMG/M
3300015052|Ga0137411_1298676All Organisms → cellular organisms → Bacteria1795Open in IMG/M
3300015054|Ga0137420_1290334All Organisms → cellular organisms → Bacteria921Open in IMG/M
3300015054|Ga0137420_1371728All Organisms → cellular organisms → Bacteria1242Open in IMG/M
3300015168|Ga0167631_1060917All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300015372|Ga0132256_100117615All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2618Open in IMG/M
3300016371|Ga0182034_10537020All Organisms → cellular organisms → Bacteria980Open in IMG/M
3300016422|Ga0182039_11413050All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300017822|Ga0187802_10146494All Organisms → cellular organisms → Bacteria901Open in IMG/M
3300017927|Ga0187824_10118486All Organisms → cellular organisms → Bacteria861Open in IMG/M
3300018012|Ga0187810_10421995All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300018086|Ga0187769_10199257All Organisms → cellular organisms → Bacteria1481Open in IMG/M
3300020061|Ga0193716_1242331All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300020170|Ga0179594_10288608All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300020579|Ga0210407_10527597All Organisms → cellular organisms → Bacteria922Open in IMG/M
3300020581|Ga0210399_10191168All Organisms → cellular organisms → Bacteria1701Open in IMG/M
3300020581|Ga0210399_10826327All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300020581|Ga0210399_10969999All Organisms → cellular organisms → Bacteria686Open in IMG/M
3300020582|Ga0210395_10324862All Organisms → cellular organisms → Bacteria1157Open in IMG/M
3300021086|Ga0179596_10719319All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300021088|Ga0210404_10065572All Organisms → cellular organisms → Bacteria1751Open in IMG/M
3300021088|Ga0210404_10602878All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300021168|Ga0210406_10694257All Organisms → cellular organisms → Bacteria785Open in IMG/M
3300021168|Ga0210406_10940899All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300021178|Ga0210408_10015775All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis6112Open in IMG/M
3300021178|Ga0210408_10795092All Organisms → cellular organisms → Bacteria741Open in IMG/M
3300021180|Ga0210396_10182664All Organisms → cellular organisms → Bacteria1877Open in IMG/M
3300021401|Ga0210393_11597059All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium517Open in IMG/M
3300021405|Ga0210387_11629593All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300021432|Ga0210384_10589064All Organisms → cellular organisms → Bacteria999Open in IMG/M
3300021475|Ga0210392_10013596All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis4443Open in IMG/M
3300021475|Ga0210392_10870875All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300021559|Ga0210409_10017458All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis7040Open in IMG/M
3300022533|Ga0242662_10309598All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300022722|Ga0242657_1168046All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300023056|Ga0233357_1017206All Organisms → cellular organisms → Bacteria838Open in IMG/M
3300025939|Ga0207665_10834486All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300026557|Ga0179587_10124284All Organisms → cellular organisms → Bacteria1586Open in IMG/M
3300026927|Ga0207744_1005948All Organisms → cellular organisms → Bacteria → Proteobacteria1268Open in IMG/M
3300027371|Ga0209418_1105111All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300027528|Ga0208985_1008939All Organisms → cellular organisms → Bacteria1881Open in IMG/M
3300027643|Ga0209076_1042013All Organisms → cellular organisms → Bacteria1289Open in IMG/M
3300027667|Ga0209009_1114295All Organisms → cellular organisms → Bacteria685Open in IMG/M
3300027765|Ga0209073_10344386All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300027895|Ga0209624_10970925All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300028800|Ga0265338_10664985All Organisms → cellular organisms → Bacteria721Open in IMG/M
3300030923|Ga0138296_1142272All Organisms → cellular organisms → Bacteria780Open in IMG/M
3300031057|Ga0170834_103079746All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium688Open in IMG/M
3300031233|Ga0302307_10639571All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300031572|Ga0318515_10111375All Organisms → cellular organisms → Bacteria1442Open in IMG/M
3300031715|Ga0307476_10530078All Organisms → cellular organisms → Bacteria873Open in IMG/M
3300031718|Ga0307474_10916907All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300031753|Ga0307477_10586602All Organisms → cellular organisms → Bacteria752Open in IMG/M
3300031753|Ga0307477_11048271All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300031833|Ga0310917_10244327All Organisms → cellular organisms → Bacteria1207Open in IMG/M
3300031833|Ga0310917_10244534All Organisms → cellular organisms → Bacteria1206Open in IMG/M
3300031879|Ga0306919_10111610All Organisms → cellular organisms → Bacteria1942Open in IMG/M
3300031941|Ga0310912_10479937All Organisms → cellular organisms → Bacteria969Open in IMG/M
3300031945|Ga0310913_10058614All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2531Open in IMG/M
3300031962|Ga0307479_10043625All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis4304Open in IMG/M
3300031962|Ga0307479_10639152All Organisms → cellular organisms → Bacteria1045Open in IMG/M
3300032174|Ga0307470_10377212All Organisms → cellular organisms → Bacteria994Open in IMG/M
3300032174|Ga0307470_10409711All Organisms → cellular organisms → Bacteria961Open in IMG/M
3300032205|Ga0307472_102754614All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300032893|Ga0335069_12084141All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300032955|Ga0335076_10203196All Organisms → cellular organisms → Bacteria1884Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil25.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil21.09%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil7.03%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil7.03%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.69%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.12%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.34%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.34%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.34%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.56%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.56%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.56%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.56%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.78%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.78%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.78%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.78%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.78%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.78%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.78%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.78%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.78%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.78%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.78%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.78%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.78%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.78%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.78%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.78%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2189573001Grass soil microbial communities from Rothamsted Park, UK - FD2 (NaCl 300g/L 5ml)EnvironmentalOpen in IMG/M
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300001661Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004080Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005944Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006047Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006603Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009524Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaGEnvironmentalOpen in IMG/M
3300009624Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10EnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010159Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3EnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015052Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015054Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015168Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4A, Ice margin, adjacent to proglacial lake)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017927Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4EnvironmentalOpen in IMG/M
3300018012Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5EnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300020061Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c1EnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021086Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300022533Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022722Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300023056Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS2EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300026927Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 56 (SPAdes)EnvironmentalOpen in IMG/M
3300027371Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027528Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027643Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes)EnvironmentalOpen in IMG/M
3300027667Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300030923Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031233Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FD2_032698702189573001Grass SoilHPLLVQACQDSLKEWKFFPAAEETTQIVECDFHGTN
F24TB_1322046823300000550SoilPLLVQSCQDAVKEWKFSPAPEESTQIIEFDFHGNN*
JGI12635J15846_1030501323300001593Forest SoilTRAVGGHPLLVQACLDAVKEWKFVAAPEETTQVVECEFSGNN*
JGI12635J15846_1086896923300001593Forest SoilPLLVQACQDAVKEWKFLAAPEESTQIVEFDFASSGN*
JGI12053J15887_1028489123300001661Forest SoilRVVGGHPLLVQTCQDALKEWKFAASSEETTQIVEFEFHSSK*
JGI12053J15887_1052787913300001661Forest SoilTRVVGGHPLLVQTCQDALKEWKFVAASEETTQIVEFEFHGSN*
JGIcombinedJ26739_10015627423300002245Forest SoilRPVGGHPVLVQSCLEAVKDWKFESAAEETTQIIEFDFKQQ*
Ga0062385_1014522523300004080Bog Forest SoilIGGHPLLVQACQDAVKEWKFTAAPEETTQVVEFEFSGAGS*
Ga0062385_1023521313300004080Bog Forest SoilIGGHPLLVQACQDAVKEWKFVAAPEETTQVVEFDFNASGN*
Ga0066682_1035105023300005450SoilRVIGGHPLLIRPSVLAVKEWKFFPAAAETTQMVEFEFRGTEQ*
Ga0070706_10190637123300005467Corn, Switchgrass And Miscanthus RhizosphereVRSTRVLGGHPLLVQVCQDSVKEWKFFPAPEETTQVVEFDFHGSN*
Ga0070707_10156753013300005468Corn, Switchgrass And Miscanthus RhizosphereLGGHPLLVQVCQDSVKEWKFFPAPEETTQVVEFDFHGSN*
Ga0066697_1023685113300005540SoilRVVGGHPLLVQACQDAVKEWKFAPAPEETTQIVEFEFRAAD*
Ga0066661_1079444523300005554SoilLLVQSCIDAVKEWKFASAPEETTQVVEFEFSVAS*
Ga0066703_1083119223300005568SoilGGHPLLVQACQDAVKEWKFVPAPEETTQVVEFEFHAN*
Ga0066691_1055697823300005586SoilLLVQACQDAVKEWKFFPAPEETTQIVEFDFRGNN*
Ga0066691_1060845923300005586SoilGHPLLVQACQDAVKEWKFVSAPEETTQVVEFEFHAN*
Ga0066788_1013250013300005944SoilVGGHPLLVQSCQDAVKEWKFLPAPEESTQVVEFDFTGAGN*
Ga0070717_1036729813300006028Corn, Switchgrass And Miscanthus RhizosphereGHVRSTRVLGGHPLLVQVCQDSVKEWKFFPAPEESTQVVEFDFRGSN*
Ga0075024_10026134213300006047WatershedsLVQTCQDAVKEWKFTTGNDDTTQIVEFEFHGAGN*
Ga0075015_10028055513300006102WatershedsRVVGGHPLLVQVCQDAVKEWKFTPGSEETTQIVEFEFHGMGN*
Ga0075014_10098828923300006174WatershedsGGHPLLVQSCLDAVRDWKFEPATEETTQVIEFEFKQ*
Ga0074064_1082180723300006603SoilPLLVQACQDAVKEWKFLPAPEETTQVIEFDFHNGN*
Ga0079220_1135484923300006806Agricultural SoilGHPVLVQSCQDAVKEWKFEPAPEETTQVVEFDFKQ*
Ga0075426_1051028723300006903Populus RhizosphereHPLLVQSCQDAVKEWKFFPAPEETMQIIEFDFHGSN*
Ga0099792_1030635023300009143Vadose Zone SoilVGGHPLLVQACQDAVKEWKFVPAPEETTQVVEFEFHANN*
Ga0116225_135873313300009524Peatlands SoilGGHPVLVQSCVDAIKDWKYEPAAEETTQIVEFDFKGQ*
Ga0116105_102356713300009624PeatlandHPILVQACQDAVKDWKFVTAAEETTQIVEFDFQGQQ*
Ga0116217_1101660813300009700Peatlands SoilAVGGHPLLVQSCLDAVKDWKFETAPEETTQILEFAFEYKQ*
Ga0126384_1067585713300010046Tropical Forest SoilIGGHPLLVQSCQDAVKEWKFFPAPEETTQIIEFDFHGSN*
Ga0126373_1090980923300010048Tropical Forest SoilRVIGGHPLLVQACQDAVKDWKFVPATEETTQITECEFHSAE*
Ga0099796_1020414423300010159Vadose Zone SoilLLVQACLDAVKEWKFASATEETTQVVEFEFTGSN*
Ga0134064_1018789113300010325Grasslands SoilTKALGGHPVLVQAALTAVKDWKFEAGSSESIQVIEFRFD*
Ga0126370_1062841813300010358Tropical Forest SoilPLLVQACQDSVKDWKFVAAPEETMQIVECDFHLVE*
Ga0126372_1185504423300010360Tropical Forest SoilALGGHPVLVQSCLDAVKDWKFEAAPEETTQLVEFDFR*
Ga0126372_1254834113300010360Tropical Forest SoilLLVQSCQDAVKEWKFVAAPEETTQVVEFDFHGTGN*
Ga0126381_10261591313300010376Tropical Forest SoilTAHAVGGHPLLVQSCLDVVKDWKFEAAPDETTQILEFEFKNQ*
Ga0137392_1081452623300011269Vadose Zone SoilPLLVQACQDAVKEWKFVPAPEETTQVVEFEFHAN*
Ga0137391_1045652313300011270Vadose Zone SoilRAVGGHSLLAQACQDGVKEWKFVLGPDESTQVIECEFHAN*
Ga0137389_1008525313300012096Vadose Zone SoilTPLLGQTCQDALKEWKFAPASEETTLIVEFEFHGA*
Ga0137388_1001415153300012189Vadose Zone SoilGHPVLVQSCLEAIKEWKFEPAPEETTQMVEFDFRQ*
Ga0137383_1135482713300012199Vadose Zone SoilTRVVGGHPLLVQACQDAVKEWKFFPAPEETTQVIEFDFRGSN*
Ga0137363_1148044023300012202Vadose Zone SoilKSTRALGGHPLLGQTCVDAVKEWKFTPAPAESTQVTEFEFNGSN*
Ga0137362_1031587023300012205Vadose Zone SoilLLVQACQDAVKEWKFMPAPEETTQVVEFEFHANN*
Ga0137362_1126130613300012205Vadose Zone SoilVVGGHPLLVQTCQDALKEWKFVPASEETTQIVEFEFHGN*
Ga0137378_1061924423300012210Vadose Zone SoilGHPLLVQACQDAVKEWKFMPAPEETTQVVEFEFHAN*
Ga0137386_1039406223300012351Vadose Zone SoilGGHPLLIRPSVLAVKEWKFFPAAAETTQMVEFEFRGTE*
Ga0137361_1064648113300012362Vadose Zone SoilPLLVQACQDAVKEWKFVPASEETTQVVEFEFHASN*
Ga0137358_1037033123300012582Vadose Zone SoilGGHPLLVQACLDAVKEWKFVAAPEETTQVVEFDFSGSN*
Ga0137358_1047091413300012582Vadose Zone SoilTRVLGGHPLLVQACQDSLKEWKFFPAAEETTQIVECDFHGSN*
Ga0137396_1072855913300012918Vadose Zone SoilKSTRVVGGHPLLVQACQDAVKEWKFSAAPEESTQVVEFEFHAN*
Ga0137394_1088522013300012922Vadose Zone SoilRVVGGHPLLVQTCQDALKEWKFVASSEETTQIVEFEFHGSN*
Ga0137359_1136078213300012923Vadose Zone SoilVGGHPLLVQTCQDALKEWKFVPASEETTQIVEFEFHGN*
Ga0137419_1102237723300012925Vadose Zone SoilPLLVQACQDAVKEWKFVPAPEETTQVVEFEFHGN*
Ga0137419_1145616123300012925Vadose Zone SoilGGHPLLVQACQDAVKEWKFVPAPEESTQVVEFEFHAN*
Ga0137419_1161417023300012925Vadose Zone SoilRVKSTRVVGGHPLLVQACQDAVKEWKFLPAPEETTQVVEFDFHGAN*
Ga0137416_1073127223300012927Vadose Zone SoilKSTRVVGGHPLLVQACQDAVKEWKFVPAPEESTQVVEFEFHGN*
Ga0137416_1192650623300012927Vadose Zone SoilSTRVVGGHPLLVQACQDAVKEWKFVPAPEETTQVVEFEFHAN*
Ga0137407_1098734723300012930Vadose Zone SoilVGGHPLLVQSCQDALKEWKFVASSEETSQIVEFEFHGNN*
Ga0137410_1016264013300012944Vadose Zone SoilVGGHPLLVQACQDAVKEWKFVPAPEETTQVVEFEFHAN*
Ga0181531_1039886813300014169BogTRAIGGHPLLVQTCTDAVKEWKFFPAPEESTQVVEFDFTGSGSSN*
Ga0182015_1005679913300014495PalsaHPLLVQACQDAVKEWKFVPAAEETTQIVEFDFTGGN*
Ga0182024_10004875133300014501PermafrostMGGHPLLVQACTDAVKGWKFTPASEETTQIVEFEFHGSGS*
Ga0137411_129867633300015052Vadose Zone SoilVGGHPLLVQACQDAVKEWKFVAAPEETTQVVEFEFHAN*
Ga0137420_129033413300015054Vadose Zone SoilGWTPIDPLLVQACQDAVKEWKFMPAPEETTQVVEFEFHANN*
Ga0137420_137172833300015054Vadose Zone SoilGHPLLVQTCQDALKEWKFAASSEETTQIVEFEFHSSK*
Ga0167631_106091713300015168Glacier Forefield SoilSTRVVGGHPLLVQSCQDAVREWKFGAAAEETTQVVEFEFRGVAN*
Ga0132256_10011761513300015372Arabidopsis RhizospherePLLVQSCQDAVEGWKFFPAPEETTQIVEFDFHGFN*
Ga0182034_1053702013300016371SoilPLLVQACQDAVKEWRFFPAPDETTQVIEFDFHGSE
Ga0182039_1141305023300016422SoilPLLVQACQDAVKEWKFVAASEESTQIVECDFHAAGAGN
Ga0187802_1014649413300017822Freshwater SedimentGGHPVLVQSCLDAVKDWKFEAAPEETTQVIEFEFRPQ
Ga0187824_1011848623300017927Freshwater SedimentLVQACQDAVKEWKFAAAPEETTQIVEFEFNAGGGN
Ga0187810_1042199513300018012Freshwater SedimentLGGHPLLVQSSLEAVKDWKYETGPEDTTQTVEFDFKQQ
Ga0187769_1019925723300018086Tropical PeatlandGHPILVQSCLEALKDWRYEPAAAETTQIVEFEFKGQQ
Ga0193716_124233123300020061SoilIRTIGGHPLLVQACQDALKDWKFLPATEESTQIVEFDFHGAN
Ga0179594_1028860823300020170Vadose Zone SoilKSTRVVGGHPLLVQACQDAVKEWKFATAPEETTQVVEFEFHGN
Ga0210407_1052759713300020579SoilLLVQACQDAVKEWKFASASEESTQIVEFEFSASGN
Ga0210399_1019116813300020581SoilHPLLVQACQDAVKEWKFVAAPEESTQVVEFDFAAAGS
Ga0210399_1082632713300020581SoilVIGGHPLLVQACQDAVKEWKFAAAPEETTQIVEFEFNAGGGN
Ga0210399_1096999923300020581SoilKSTRVVGGHPLLVQACQDAVKEWKFVAAPEETTQIVEFDFHGAGS
Ga0210395_1032486213300020582SoilLLVQACQDAVKEWKFAAAPEESTQVLEFEFSGGTN
Ga0179596_1071931923300021086Vadose Zone SoilGGHPLLVQSCQDAVKEWKFLPAPEESTQIVEFDFTGAGN
Ga0210404_1006557223300021088SoilPLLVQACLDAVKEWRFVAAPEETTQVVECEFSGNNN
Ga0210404_1060287813300021088SoilRAIGVHPVLVQTCLDAIKEWKFEPAPEETTQVVEFDFRQ
Ga0210406_1069425713300021168SoilKSTRVVGGHPLLVQACQDAVKEWKFVPAPEESTQVVEFDFHGTGN
Ga0210406_1094089923300021168SoilRVVGGHPLLVQACQDAVKEWKFVAAPEETTQIVEFDFHGAGS
Ga0210408_1001577513300021178SoilVVGGHPLLVQACQDAVKEWKFVSAPEETTQVVEFEFHAN
Ga0210408_1079509213300021178SoilSSRAVGGHPLLVQACLDAVKEWKFVAGPEESKQIVECDFGG
Ga0210396_1018266423300021180SoilAVGGHPVLVQACLDAIKDWKFESAPEETTQMVEFDFRQ
Ga0210393_1159705923300021401SoilVRSTRVLGGHPLLVQVCQDAVKEWKFFPAPEETTQVVEFDFRGGN
Ga0210387_1162959323300021405SoilGGHPILVQACQDVVKDWKFVSASEETTQIVEFDFRE
Ga0210384_1058906413300021432SoilAVGGHPVLVQACQDAIKEWKFESAAEETTQMVEFDFRQ
Ga0210392_1001359653300021475SoilHPLLVQACQDAVKEWKFFPAPEETTQIVEFDFRSGGN
Ga0210392_1087087523300021475SoilTRVVGGHPLLVQACQDAVKDWKFMPAPEESTQIVEFDFHAN
Ga0210409_1001745813300021559SoilTRVVGGHPLLVQACQDAVKEWKFVAAPEETTQVVEFEFHAN
Ga0242662_1030959813300022533SoilSLAVGGHPVLVQACLDAIKDWKFESAPEETTQMVEFDFRQ
Ga0242657_116804613300022722SoilSTRVVGGHPLLVQACQDAVKDWKFLPAPEETTQIVEFDFHAN
Ga0233357_101720613300023056SoilHPLLVQACQDAVKEWKFAPGPEETTQIVEFSFTSSGT
Ga0207665_1083448623300025939Corn, Switchgrass And Miscanthus RhizosphereRALGGHPLLVQACVDAVKEWKFAAAPEETTQVAECEFTSGS
Ga0179587_1012428423300026557Vadose Zone SoilHVRSTRVLGGHPLLVQACQDSLKEWKFFPASEETTQIVECDFHGSN
Ga0207744_100594813300026927Tropical Forest SoilGGHPLLVQSCLECVKEWKYETAPEESIQIVEFDFKQS
Ga0209418_110511123300027371Forest SoilRAVGGHPLLVQACQDAVKEWKFLPAPEESTQVVEFDFTGSSN
Ga0208985_100893923300027528Forest SoilTRAVGGHPLLVQACQDAVKEWKFLPAPEESTQVVEFDFSGHE
Ga0209076_104201313300027643Vadose Zone SoilKSTRVVGGHPLLVQACQDAVKEWKFVPAPEESTQVVEFEFHAN
Ga0209009_111429523300027667Forest SoilGGHPLLAQACQDAVREWKFLPAPEETTQVVEFNFVVAGT
Ga0209073_1034438623300027765Agricultural SoilGHPVLVQSCQDAVKEWKFEPAPEETTQVVEFDFKQ
Ga0209624_1097092513300027895Forest SoilGHPLLVQACQDAVKEWKFLPAPEESTQVVEFDFTGSSN
Ga0265338_1066498513300028800RhizospherePDGRVKSTRVVGGHPILVQACQDAVKDWKFLSAAEETTQIVEFDFHDQ
Ga0138296_114227223300030923SoilGGHPLLVQACQDSLKEWKFFPAAEETTQIVECDFHGSN
Ga0170834_10307974623300031057Forest SoilVLGGHPLLVQSCQDSLKEWKFFPAAEETTQIVECDFHGSN
Ga0302307_1063957113300031233PalsaRVKSTRVVGGHPILVQACQDAVKDWKFAPASEESTQVIEFDFHDQ
Ga0318515_1011137523300031572SoilLGGHPLLVQACLEAVKEWRYETAPEETTQVVEFEFKQS
Ga0307476_1053007823300031715Hardwood Forest SoilGHPILVQASQDAIREWKFVPGPEETTQIVEFDFREQ
Ga0307474_1091690713300031718Hardwood Forest SoilSTRVVGGHPLLVQACQDAVKEWKFLPAPEETTQIVEFSFTNSGT
Ga0307477_1058660213300031753Hardwood Forest SoilGHPLLVQACQDAVKEWKFAPASEETTQVVEFDFHAN
Ga0307477_1104827113300031753Hardwood Forest SoilRVVGGHPLLVQACQDAVKEWKFVPAPEETTQVVEFEFRAN
Ga0310917_1024432723300031833SoilGHPLLVQSCQDAVKEWRFFPANEETTQVIEFDFRNTE
Ga0310917_1024453413300031833SoilGGHPLLVQACLEAVKEWRYETAPEETTQVVEFEFKQS
Ga0306919_1011161023300031879SoilKSVRALGGHPLLVQSCVECVKEWKYETGPEESIQIVEFDFRQS
Ga0310912_1047993723300031941SoilALGGHPLLVQACLEAVKEWRYETAPEESTQVVEFEFKQS
Ga0310913_1005861413300031945SoilGGHPLLVRSCLECVKEWKYETAQEESVQIVEFEFKQS
Ga0307479_1004362513300031962Hardwood Forest SoilMGGHPLLVHACLDAVKEWKFVAASEETTQVIEFEFSGNN
Ga0307479_1063915223300031962Hardwood Forest SoilVKSTRVVGGHPLLVQACQDAVKEWKFVPAPEETTQVVEFEFHAN
Ga0307470_1037721223300032174Hardwood Forest SoilVLGGHPLLVQVCQDAVKEWKFFPAPEETTQVVEFDFHGGN
Ga0307470_1040971113300032174Hardwood Forest SoilGGHPLLVQVCQDSVKEWKFFPAPEETTQVVEFDFHGSN
Ga0307472_10275461413300032205Hardwood Forest SoilRVVGGHPLLVQACQDALKEWKFVAASEETTQIVECEFHGN
Ga0335069_1208414123300032893SoilAVGGHPVLVQSCLDVVKDWKFEPAPEETTQMVEFDFRQ
Ga0335076_1020319623300032955SoilPLLVQACQDAVKEWKFAPAPEETTQVVEFEFTANGN

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.