NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F065093

Metagenome Family F065093

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F065093
Family Type Metagenome
Number of Sequences 128
Average Sequence Length 44 residues
Representative Sequence LAYAQELMKRNGIGSVAVVGKTGELVGFLQSGKFKRTKRKK
Number of Associated Samples 105
Number of Associated Scaffolds 128

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.56 %
% of genes near scaffold ends (potentially truncated) 97.66 %
% of genes from short scaffolds (< 2000 bps) 91.41 %
Associated GOLD sequencing projects 99
AlphaFold2 3D model prediction Yes
3D model pTM-score0.49

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere
(7.812 % of family members)
Environment Ontology (ENVO) Unclassified
(50.781 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(68.750 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 14.49%    β-sheet: 21.74%    Coil/Unstructured: 63.77%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.49
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 128 Family Scaffolds
PF01545Cation_efflux 73.44
PF02457DAC 8.59
PF00571CBS 6.25
PF00072Response_reg 0.78
PF02880PGM_PMM_III 0.78
PF01293PEPCK_ATP 0.78
PF07949YbbR 0.78
PF16916ZT_dimer 0.78

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 128 Family Scaffolds
COG0053Divalent metal cation (Fe/Co/Zn/Cd) efflux pumpInorganic ion transport and metabolism [P] 73.44
COG1230Co/Zn/Cd efflux system componentInorganic ion transport and metabolism [P] 73.44
COG3965Predicted Co/Zn/Cd cation transporter, cation efflux familyInorganic ion transport and metabolism [P] 73.44
COG0033Phosphoglucomutase/phosphomannomutaseCarbohydrate transport and metabolism [G] 0.78
COG1109PhosphomannomutaseCarbohydrate transport and metabolism [G] 0.78
COG1866Phosphoenolpyruvate carboxykinase, ATP-dependentEnergy production and conversion [C] 0.78
COG4856Cyclic di-AMP synthase regulator CdaR, YbbR domainSignal transduction mechanisms [T] 0.78

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2228664021|ICCgaii200_c0852694All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300000953|JGI11615J12901_10257046All Organisms → cellular organisms → Bacteria1322Open in IMG/M
3300000953|JGI11615J12901_10560893All Organisms → cellular organisms → Bacteria2325Open in IMG/M
3300003203|JGI25406J46586_10115334All Organisms → cellular organisms → Bacteria793Open in IMG/M
3300003324|soilH2_10142438All Organisms → cellular organisms → Bacteria1216Open in IMG/M
3300004480|Ga0062592_101801744All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300004480|Ga0062592_102114683All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300005093|Ga0062594_101688590All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300005093|Ga0062594_103071777All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium522Open in IMG/M
3300005290|Ga0065712_10394254All Organisms → cellular organisms → Bacteria738Open in IMG/M
3300005293|Ga0065715_10767566All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300005294|Ga0065705_10263346All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium1154Open in IMG/M
3300005336|Ga0070680_101546696All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300005340|Ga0070689_100308121All Organisms → cellular organisms → Bacteria1320Open in IMG/M
3300005340|Ga0070689_100679400All Organisms → cellular organisms → Bacteria898Open in IMG/M
3300005344|Ga0070661_101698903All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300005345|Ga0070692_11361322All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300005441|Ga0070700_100108199All Organisms → cellular organisms → Bacteria1843Open in IMG/M
3300005444|Ga0070694_101093714All Organisms → cellular organisms → Bacteria665Open in IMG/M
3300005530|Ga0070679_102025282All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300005539|Ga0068853_101382749All Organisms → cellular organisms → Bacteria681Open in IMG/M
3300005543|Ga0070672_100737510All Organisms → cellular organisms → Bacteria864Open in IMG/M
3300005545|Ga0070695_101656666All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300005549|Ga0070704_100098691All Organisms → cellular organisms → Bacteria2195Open in IMG/M
3300005577|Ga0068857_101430691All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300005578|Ga0068854_100063127All Organisms → cellular organisms → Bacteria2688Open in IMG/M
3300005578|Ga0068854_100990283All Organisms → cellular organisms → Bacteria744Open in IMG/M
3300005615|Ga0070702_100462475All Organisms → cellular organisms → Bacteria923Open in IMG/M
3300005616|Ga0068852_101992526All Organisms → cellular organisms → Bacteria → Proteobacteria603Open in IMG/M
3300005617|Ga0068859_101529119All Organisms → cellular organisms → Bacteria737Open in IMG/M
3300005719|Ga0068861_101035084All Organisms → cellular organisms → Bacteria786Open in IMG/M
3300005719|Ga0068861_101719248All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium621Open in IMG/M
3300005719|Ga0068861_102303163All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300005842|Ga0068858_100311718All Organisms → cellular organisms → Bacteria1503Open in IMG/M
3300005842|Ga0068858_101696973All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium624Open in IMG/M
3300005844|Ga0068862_100128375All Organisms → cellular organisms → Bacteria2240Open in IMG/M
3300005886|Ga0075286_1064598All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300005890|Ga0075285_1015263All Organisms → cellular organisms → Bacteria886Open in IMG/M
3300006169|Ga0082029_1282158All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300006173|Ga0070716_100430088All Organisms → cellular organisms → Bacteria957Open in IMG/M
3300006755|Ga0079222_10889953All Organisms → cellular organisms → Bacteria745Open in IMG/M
3300006844|Ga0075428_100569119All Organisms → cellular organisms → Bacteria1211Open in IMG/M
3300006844|Ga0075428_101202118All Organisms → cellular organisms → Bacteria799Open in IMG/M
3300006847|Ga0075431_100853039All Organisms → cellular organisms → Bacteria882Open in IMG/M
3300006876|Ga0079217_10005647All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia3733Open in IMG/M
3300006894|Ga0079215_10033535All Organisms → cellular organisms → Bacteria1859Open in IMG/M
3300006894|Ga0079215_10743114All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300006904|Ga0075424_102557169All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300006918|Ga0079216_10033183All Organisms → cellular organisms → Bacteria → Acidobacteria2089Open in IMG/M
3300007076|Ga0075435_100023232All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia4792Open in IMG/M
3300007076|Ga0075435_102057917All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300009011|Ga0105251_10432056All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium608Open in IMG/M
3300009098|Ga0105245_12372894All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300009148|Ga0105243_10926242All Organisms → cellular organisms → Bacteria869Open in IMG/M
3300009156|Ga0111538_10583122All Organisms → cellular organisms → Bacteria1418Open in IMG/M
3300009156|Ga0111538_12270131All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300009545|Ga0105237_11521277All Organisms → cellular organisms → Bacteria676Open in IMG/M
3300009551|Ga0105238_11479121All Organisms → cellular organisms → Bacteria708Open in IMG/M
3300009553|Ga0105249_12744337All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300010037|Ga0126304_10630345All Organisms → cellular organisms → Bacteria723Open in IMG/M
3300010038|Ga0126315_10147281All Organisms → cellular organisms → Bacteria1392Open in IMG/M
3300010045|Ga0126311_10116668All Organisms → cellular organisms → Bacteria1857Open in IMG/M
3300010371|Ga0134125_11592628All Organisms → cellular organisms → Bacteria711Open in IMG/M
3300010397|Ga0134124_10013496All Organisms → cellular organisms → Bacteria6619Open in IMG/M
3300010397|Ga0134124_13041808All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300010399|Ga0134127_12294197All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300010399|Ga0134127_13672746All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300010403|Ga0134123_10535395All Organisms → cellular organisms → Bacteria1111Open in IMG/M
3300011119|Ga0105246_11693383All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium601Open in IMG/M
3300012202|Ga0137363_10902039All Organisms → cellular organisms → Bacteria750Open in IMG/M
3300012212|Ga0150985_113326633All Organisms → cellular organisms → Bacteria754Open in IMG/M
3300012359|Ga0137385_10723477All Organisms → cellular organisms → Bacteria830Open in IMG/M
3300012922|Ga0137394_10210187All Organisms → cellular organisms → Bacteria1663Open in IMG/M
3300013102|Ga0157371_11295270All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300013297|Ga0157378_12170029All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300013306|Ga0163162_11292276All Organisms → cellular organisms → Bacteria829Open in IMG/M
3300013306|Ga0163162_12753200All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300013307|Ga0157372_11939269All Organisms → cellular organisms → Bacteria677Open in IMG/M
3300013308|Ga0157375_13317179All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium536Open in IMG/M
3300014267|Ga0075313_1211298All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300014326|Ga0157380_10024015All Organisms → cellular organisms → Bacteria4608Open in IMG/M
3300014745|Ga0157377_10323675All Organisms → cellular organisms → Bacteria1025Open in IMG/M
3300014878|Ga0180065_1134612All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300015264|Ga0137403_10136678All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp. GAS2312429Open in IMG/M
3300015372|Ga0132256_101305901All Organisms → cellular organisms → Bacteria838Open in IMG/M
3300015374|Ga0132255_103647011All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300017792|Ga0163161_10071194All Organisms → cellular organisms → Bacteria2544Open in IMG/M
3300018465|Ga0190269_11408719All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium566Open in IMG/M
3300018466|Ga0190268_10558410All Organisms → cellular organisms → Bacteria797Open in IMG/M
3300018466|Ga0190268_10924819All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300018476|Ga0190274_11072605All Organisms → cellular organisms → Bacteria884Open in IMG/M
3300025885|Ga0207653_10088890All Organisms → cellular organisms → Bacteria1080Open in IMG/M
3300025893|Ga0207682_10358137All Organisms → cellular organisms → Bacteria688Open in IMG/M
3300025901|Ga0207688_10410409All Organisms → cellular organisms → Bacteria841Open in IMG/M
3300025907|Ga0207645_11093258All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300025908|Ga0207643_10246840All Organisms → cellular organisms → Bacteria1099Open in IMG/M
3300025913|Ga0207695_11137915All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300025917|Ga0207660_11682260All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300025920|Ga0207649_11133402All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300025933|Ga0207706_10234062All Organisms → cellular organisms → Bacteria1606Open in IMG/M
3300025935|Ga0207709_11441572All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300025935|Ga0207709_11474609All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300025939|Ga0207665_10275794All Organisms → cellular organisms → Bacteria1250Open in IMG/M
3300025939|Ga0207665_10643444All Organisms → cellular organisms → Bacteria831Open in IMG/M
3300025941|Ga0207711_10791590All Organisms → cellular organisms → Bacteria883Open in IMG/M
3300025960|Ga0207651_11564996All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300025981|Ga0207640_10689253All Organisms → cellular organisms → Bacteria875Open in IMG/M
3300026067|Ga0207678_11749109All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300026071|Ga0208537_1006326All Organisms → cellular organisms → Bacteria1576Open in IMG/M
3300026078|Ga0207702_11523630All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300026088|Ga0207641_11261931All Organisms → cellular organisms → Bacteria739Open in IMG/M
3300026116|Ga0207674_11348435All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300026116|Ga0207674_11466791All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300026116|Ga0207674_11716965All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300026322|Ga0209687_1044361All Organisms → cellular organisms → Bacteria1444Open in IMG/M
3300027725|Ga0209178_1235095All Organisms → cellular organisms → Bacteria658Open in IMG/M
3300027725|Ga0209178_1391944All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300027880|Ga0209481_10049397All Organisms → cellular organisms → Bacteria1946Open in IMG/M
3300028381|Ga0268264_11860418All Organisms → cellular organisms → Bacteria612Open in IMG/M
3300031716|Ga0310813_10681394All Organisms → cellular organisms → Bacteria916Open in IMG/M
3300031716|Ga0310813_11561172All Organisms → cellular organisms → Bacteria616Open in IMG/M
3300031716|Ga0310813_11769185All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium580Open in IMG/M
3300031847|Ga0310907_10229465All Organisms → cellular organisms → Bacteria903Open in IMG/M
3300031908|Ga0310900_10150923All Organisms → cellular organisms → Bacteria1573Open in IMG/M
3300032003|Ga0310897_10564465All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300032126|Ga0307415_100140541All Organisms → cellular organisms → Bacteria1843Open in IMG/M
3300033412|Ga0310810_11364969All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300033513|Ga0316628_102418066All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium694Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.81%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere7.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere7.03%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere7.03%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.25%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil5.47%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil4.69%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.91%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.12%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.12%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.12%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere3.12%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil2.34%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.34%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.34%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.34%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.34%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.34%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.34%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.34%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.56%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil1.56%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.56%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere1.56%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.56%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.78%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.78%
Termite NestEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest0.78%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.78%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.78%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.78%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.78%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.78%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.78%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.78%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.78%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2228664021Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000953Soil microbial communities from Great Prairies - Kansas Corn soilEnvironmentalOpen in IMG/M
3300003203Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2Host-AssociatedOpen in IMG/M
3300003324Sugarcane bulk soil Sample H2EnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005290Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005886Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205EnvironmentalOpen in IMG/M
3300005890Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_104EnvironmentalOpen in IMG/M
3300006169Termite nest microbial communities from Madurai, IndiaEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009011Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaGHost-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014267Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1EnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014878Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200A_16_10DEnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025893Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026071Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_TuleA_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes)EnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300032003Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1EnvironmentalOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
ICCgaii200_085269422228664021SoilNGIGSLAVVGKNGELVGFLQSGKFRRKKQRAKRAAS
JGI11615J12901_1025704633300000953SoilEPNATLDYAQELMRRNGIGSVAVVGRTGELVGFLQSGKFKRKKRK*
JGI11615J12901_1056089343300000953SoilRELMKRNGIGSLAVVGKNGELVGFLQSGKFKRKKQRVKRAVS*
JGI25406J46586_1011533423300003203Tabebuia Heterophylla RhizosphereARELMKRNGIGSLAVVGKNGELVGFLQSGKFKRKKRAKQSA*
soilH2_1014243823300003324Sugarcane Root And Bulk SoilAPRFFVEPNATLAYAQELMRRNGIGSVAVVGKTGELVGFLQTGKFKRIKRSAKASR*
Ga0062592_10180174413300004480SoilTLVYAQELMKRNGIGSVAVVGKTGELVGFLQSGKFKRKKRSRTSR*
Ga0062592_10211468323300004480SoilDLMSKNGIGSVAVVGKNGELVGFLQNGTFKRKKVRRTKTSS*
Ga0062594_10168859023300005093SoilKELMKRNGIGSVAVVGKTGELVGFLQTGRFKRTKRSKTSRQ*
Ga0062594_10307177723300005093SoilNTTLDYAQELMKRNGIGSVAVVGKGGELVGFLQSGKFKRKKR*
Ga0065712_1039425413300005290Miscanthus RhizosphereRELMKRNGIGSVAVVGKTGELVGFLQTGTFKRRKRARAST*
Ga0065715_1076756623300005293Miscanthus RhizosphereLDFARELMKRNGVGSLAVVGKNGELVGFLQSGEFVRKKL*
Ga0065705_1026334623300005294Switchgrass RhizosphereNATLDFAKELMSRNGVNSLAVVGKDGELVGFLQNGKFKRQRRREKQTRSVA*
Ga0070680_10154669623300005336Corn RhizosphereTLDYARELMKRNGIGSLAVVGKNGELVGFLQSGKFRRKKQRAKRATS*
Ga0070689_10030812123300005340Switchgrass RhizosphereELMKRNGIGSLAVVAKNGELVGFLQSGRFKRKKQRLTRASS*
Ga0070689_10067940023300005340Switchgrass RhizosphereRFFVEPNATLAYAQELMKRNGIGSVAVVGKTGELVGFLQSGKFKRTKRKK*
Ga0070661_10169890323300005344Corn RhizosphereTLAYAQELMKRNGIGSVAVVGKTGELVGFLQTGKFKRIKRSQKPLAKSV*
Ga0070692_1136132223300005345Corn, Switchgrass And Miscanthus RhizospherePTATIDYARELMKRNGIGSLAVVGKNGELVGFLQSGKFKRKKRVKQSA*
Ga0070700_10010819933300005441Corn, Switchgrass And Miscanthus RhizosphereLAYAQELMKRNGIGSVAVVGKTGELVGFLQSGKFKRTKRKK*
Ga0070694_10109371413300005444Corn, Switchgrass And Miscanthus RhizosphereNATLDYARELMKRNGIGSVAVVGKTGELVGFLQTGTFKRRKRARAST*
Ga0070679_10202528213300005530Corn RhizosphereDYARELMKRNGIGSLAVVGKNGELVGFLQSGRFRRKKQRLKRASS*
Ga0068853_10138274913300005539Corn RhizosphereTLAYAQELMRRNGIGSVAVVGKTGELVGFLQSGKFKRVKRK*
Ga0070672_10073751023300005543Miscanthus RhizosphereLDYAQELMRRNGIGSVAVVGSTGELVGFLQSGKFKRKKRK*
Ga0070695_10165666623300005545Corn, Switchgrass And Miscanthus RhizosphereEPNATLGYAQELMKRNGIGSVAVVGKTGELVGFLQSGKFKRTKRKK*
Ga0070704_10009869113300005549Corn, Switchgrass And Miscanthus RhizosphereLMERNGIGSVAVVGKTGELVGFLQTGRFKRGRRSQKSTN*
Ga0068857_10143069113300005577Corn RhizosphereTLDYAQELMKRNGIGSLAVVGKSGELVGFLQSGKFKRKKRSKGN*
Ga0068854_10006312723300005578Corn RhizosphereMKRNGIGSVAVVGKTGELVGFLQSGKFKRIKRKK*
Ga0068854_10099028323300005578Corn RhizosphereTLDYARELMKRNGIGSLAVVGKNGELVGFLQSGKFKRKRAQKPPVTSNKPTSGLLK*
Ga0070702_10046247523300005615Corn, Switchgrass And Miscanthus RhizosphereNATLAYAQELMRRNGIGSVAVVGKTGELVGFLQTGKFKRTKRSQKPLAKSV*
Ga0068852_10199252613300005616Corn RhizospherePNATLAYAQELMRRNGIGSVAVVGKTGELVGFLQSGKFKRIKRKK*
Ga0068859_10152911913300005617Switchgrass RhizosphereNATLAYAQELMKRNGIGSVAVVGKTGELVGFLQSGKFKRTKRK*
Ga0068861_10103508413300005719Switchgrass RhizospherePIAPRFFVEPNATLGYAQELMKRNGIGSVAVVGKTGELIGFLQTGKFKRVKRAQNSR*
Ga0068861_10171924813300005719Switchgrass RhizosphereLAYAQELMKRNGIGSVAVVGKTGELVGFLQTGKFKRIKRSQKPLAKSV*
Ga0068861_10230316323300005719Switchgrass RhizosphereAPRFFVEPNATLDYAQELMKRNGIGSVAVVGKTGELIGFLQTGRFKRTKRSKASQ*
Ga0068858_10031171833300005842Switchgrass RhizospherePRFFVEPNTTLDYAQELMKRNGIGSVAVVGKGGELVGFLQSGKFKRKKR*
Ga0068858_10169697323300005842Switchgrass RhizosphereTLAYAQELMKRNGIGSVAVVGKTGELVGFLQSGKFKRIKRSQKPLAKSV*
Ga0068862_10012837533300005844Switchgrass RhizosphereEPNATLDYARELMKRNGIGSLAVVGKNGELVGFLQNGTFKRKKRSRVENALHP*
Ga0075286_106459813300005886Rice Paddy SoilAQELMRRNGIGSVAVVGKSGELVGFLQSGKFKRTKRKK*
Ga0075285_101526323300005890Rice Paddy SoilQELMRRNGIGSVAVVGKTGELVGFLQSGKFKRKKRARASR*
Ga0082029_128215813300006169Termite NestTLAYAQELMKRNGIGSVAVVGKTGELVGFLQSGKFKRIKRSAKSPVKSV*
Ga0070716_10043008813300006173Corn, Switchgrass And Miscanthus RhizosphereLDYARELMKRNGIGSLAVVGKDGELVGFLQSGKFKRKRRAKESR*
Ga0079222_1088995313300006755Agricultural SoilATLGYARELMKVNGIGSLAVVGKNGELVGFLQSGKFKRKRR*
Ga0075428_10056911913300006844Populus RhizosphereEPNATLDYAQELMKRNGIGSVAVVGKTGELVGFLQSGKFKRKKRK*
Ga0075428_10120211823300006844Populus RhizosphereELMKRNGIGSLAVVGKNGELVGFLQSGRFKRKKRSKRAAS*
Ga0075431_10085303923300006847Populus RhizosphereTLDYAQELMKRNGIGSVAVVGKGGELVGFLQSGKFKRTKKRAT*
Ga0079217_1000564713300006876Agricultural SoilNGIGSLAVVGKNGELVGFLQSGKFKRKKQRANRAPS*
Ga0079215_1003353513300006894Agricultural SoilTAKLDYARELMKRNGIGSLAVVGKNGELVGFLQTGKFKRKRRAKDSR*
Ga0079215_1074311413300006894Agricultural SoilMKRNGINSVAVVGKSGELVGFLQSGKFKRTKRSKDAR*
Ga0075424_10255716923300006904Populus RhizosphereTATLGYAQELMKRNGIGSVAVVGKNGDLVGFLQTGKVKRVKRASQ*
Ga0079216_1003318313300006918Agricultural SoilMKRNGIGSLAVVGKNGELVGFLQSGKFKRKRRAKDSSKNLPRFTD*
Ga0075435_10002323213300007076Populus RhizosphereRNGIGSVAVVGKNGDLVGFLQTGKFKRRRRASSAR*
Ga0075435_10205791713300007076Populus RhizosphereRELMKRNGIGSLAVVGKDGELVGFLQSGKFKRKKR*
Ga0105251_1043205623300009011Switchgrass RhizosphereLAYAQELMKRNGIGSVAVVGKTGELVGFLQTGKFKRTKRKK*
Ga0105245_1237289413300009098Miscanthus RhizosphereNATLDYAQELMKRNGIGSVAVVGRTGELVGFLQSGKFKRKKRK*
Ga0105243_1092624213300009148Miscanthus RhizosphereRELMKRNGIGSLAVVGKNGELVGFLQTGRIKRKKRRVNRASS*
Ga0111538_1058312233300009156Populus RhizosphereLMKRNGIGSVAVVGKTGELVGFLQSGKFKRTKRKK*
Ga0111538_1227013113300009156Populus RhizospherePNATLDYAQELMKRNGIGSVAVVGSTGELVGFLQTGKIKRKKRS*
Ga0105237_1152127713300009545Corn RhizosphereNATLAYAQELMKRNGIGSVAVVGKTGELVGFLQSGKFKRTKRKK*
Ga0105238_1147912113300009551Corn RhizosphereFFVEPNATLAYAQELMKRNGIGSVAVVGKTGELVGFLQSGKFKRIKRKK*
Ga0105249_1274433713300009553Switchgrass RhizosphereELMKRNGIGSLAVVGKNGELVGFLQSGEFVRKKR*
Ga0126304_1063034523300010037Serpentine SoilPRFFVEPNASLDYAQELMKRNGIGSVAVVGKNGDLVGFLQSGKFKRRKRK*
Ga0126315_1014728133300010038Serpentine SoilATLDYAQELMKRNGIGSVAVVGKTGELVGFLQAGKFKRTKRSGKVSR*
Ga0126311_1011666833300010045Serpentine SoilEPNATLAYAQELMRRNGIGSVAVVGKSGELVGFLQTGKFKRIKRKK*
Ga0134125_1159262823300010371Terrestrial SoilVEPNATLDYAQALMKQNGIGSVAVVGKRGELVGFLQTGKLKRRKKVHRSTKAANR*
Ga0134124_1001349663300010397Terrestrial SoilAPRFFVEPNTTLDYAQELMKRNGIGSVAVVGKGGELVGFLQSGKFKRKKR*
Ga0134124_1304180813300010397Terrestrial SoilTLDYAQELMKRNGIGSVAVVGKTGELVGFLQSGKFKRKKRSRTSR*
Ga0134127_1229419713300010399Terrestrial SoilIAPRFFVEPNATLGYAQELMKRNGIGSVAVVGKTGELIGFLQTGKFKRAKRAQNSR*
Ga0134127_1367274623300010399Terrestrial SoilQELMKRNGIGSVAVVGKTGELVGFLQSGKFKRTKRKK*
Ga0134123_1053539513300010403Terrestrial SoilTLDYAQELMKRNGIGSVAVVGKGGELVGFLQSGKFKRTKKRAK*
Ga0105246_1169338323300011119Miscanthus RhizosphereKRNGIGSVAVVGKNGELVGFLQSGKFKRTRRAKESR*
Ga0137363_1090203913300012202Vadose Zone SoilATLDYARELMKRNGIGSLAVVGKNGELVGFLQNGRLKRRKR*
Ga0150985_11332663313300012212Avena Fatua RhizosphereNATLAYAQELMRRNGIGSVAVVGKTGELVGFLQSGKFKRTKRK*
Ga0137385_1072347713300012359Vadose Zone SoilNGIGSLAVVGKNGELVGFLQNGTLKRRKRSNERRESPA*
Ga0137394_1021018733300012922Vadose Zone SoilEPTATLDYARELMKSNGVSSLAVVGKSGELVGFLQSGTFKRQRRTKEARKTS*
Ga0157371_1129527013300013102Corn RhizosphereNATLAYAQELKKRNGIGSVAVVGKTGELVGFLQSGKFKRTKRKK*
Ga0157378_1217002913300013297Miscanthus RhizospherePRFFVEPNATLAYAQELMKRNGIGSVAVVGKTGELVGFLQSGKFKRIKRSQKPLAKSV*
Ga0163162_1129227613300013306Switchgrass RhizosphereTLDYAQELMRRNGIGSVAVVGRTGELVGFLQSGKFKRKKRK*
Ga0163162_1275320023300013306Switchgrass RhizosphereYAQELMKRNGIGSVAVVGKTVELVGFLQSGKFKRKKRSRTSR*
Ga0157372_1193926913300013307Corn RhizosphereLEYARELMKRNGIGSLAVVGKNGELVGFLQSGKFKRK*
Ga0157375_1331717913300013308Miscanthus RhizosphereTLDYARELMKRNGIGSLAVVGKNGELVGFLQNGTFKRKKRSRVENALHP*
Ga0075313_121129813300014267Natural And Restored WetlandsLDYARELMKRNGIGSLAVVGKNGELVGFLQSGRFKRKKRSKSASS*
Ga0157380_1002401513300014326Switchgrass RhizosphereNSGLDYARELMKRNGIGSLAVVGKNGELVGFLQSGRFKRKKQRLKRASS*
Ga0157377_1032367523300014745Miscanthus RhizosphereIGSLAVVAKNGELVGFLQSGRFKRKKQRLTRASS*
Ga0180065_113461223300014878SoilIGSLAVVGKNGELVGFLQNGKLKRKKRSNDVRRQPA*
Ga0137403_1013667833300015264Vadose Zone SoilEPTATLDYARELMKRNGISSLAVVGKSGELVGFLQSGTFKRQRRTKEARQTS*
Ga0132256_10130590133300015372Arabidopsis RhizosphereELMKRNGIGSVAVVGKSGELIGFLQTGTFKRTKRRA*
Ga0132255_10364701113300015374Arabidopsis RhizosphereHARELMKRNGVGSLAVVGKNGELVGFLQNGTFKRKRG*
Ga0163161_1007119413300017792Switchgrass RhizosphereTIDFAKDLMSRNGIGSLAVVGKNGELVGFLQNGTFKRKKRSKAARS
Ga0190269_1140871913300018465SoilIAPRFFVEPNATIDYAQELMKRNGIGSVAVVGKNGDLVGFLQSGSFKRKKRSKT
Ga0190268_1055841023300018466SoilEPNATLDYAQELMKRNGIGSVAVVGKSGELVGFLQTGKFKRTKRSKVQ
Ga0190268_1092481913300018466SoilPIAPRFFVEPNATLDYAQELMKRNGIGSVAVVGKSGELLGFLQTGKFKSKKR
Ga0190274_1107260513300018476SoilELMKRNGIGSVAVVGKTGELVGFLQTGKFKRKKRK
Ga0207653_1008889013300025885Corn, Switchgrass And Miscanthus RhizosphereFFVEPNATLAYAQQLMKRNGIGSVAVVGKTGELVGFLQSGKFKRTKRKK
Ga0207682_1035813723300025893Miscanthus RhizosphereRFFVEPNATLAYAQELMKRNGIGSVAVVGKTGELVGFLQSGKFKRTKRKK
Ga0207688_1041040923300025901Corn, Switchgrass And Miscanthus RhizosphereAPRFFVEPNATLAYAQELMKRNGIGSVAVVGKTGELVGFLQSGKFKRTKRKK
Ga0207645_1109325813300025907Miscanthus RhizospherePRFFVEPNATLAYAQELMKRNGIGSVAVVGKTGELVGFLQSGKFKRTKRKK
Ga0207643_1024684023300025908Miscanthus RhizosphereDYARELMKRNGIGSVAVVGKTGELVGFLQTGTFKRRKRARAST
Ga0207695_1113791513300025913Corn RhizosphereELMRRNGIGSVAVVGKTGELVGFLQSGKFKRKKRK
Ga0207660_1168226023300025917Corn RhizosphereELMKRNGIGSVAVVGKTGELVGFLQSGKFKRTKRKK
Ga0207649_1113340213300025920Corn RhizosphereAYAQELMKRNGIGSVAVVGKTGELVGFLQSGKFKRTNKQDRAR
Ga0207706_1023406213300025933Corn RhizosphereRELMKRNGIGSLAVVGKNGELVGFLQSGRFKRKKHRLKRASS
Ga0207709_1144157213300025935Miscanthus RhizosphereMKRNGIGSVAVVGKTGELIGFLQTGKFKRAKRAQNSRVN
Ga0207709_1147460913300025935Miscanthus RhizosphereNATLAYAQELMKRNGIGSVAVVGKTGELVGFLQSGKFKRTKRKK
Ga0207665_1027579423300025939Corn, Switchgrass And Miscanthus RhizosphereAKLDYARELMKRNGIGSLAVVGKDGELVGFLQSGKFKRKRRAKESR
Ga0207665_1064344413300025939Corn, Switchgrass And Miscanthus RhizosphereRLEYARELMKVNGIGSVAVVGKNGELVGFLQTGKFKRRRRTKDSR
Ga0207711_1079159023300025941Switchgrass RhizosphereYAQELMRRNGIGSVAVVGKTGELVGFLQSGKFKRTKRK
Ga0207651_1156499623300025960Switchgrass RhizosphereLDFARELMKRNGIGSLAVVGKNGELVGFLQSGEFVRKKR
Ga0207640_1068925313300025981Corn RhizosphereNATLDYARELMKRNGVGSLAVVGKNGELVGFIQNGTVKLKKRTREAKQRTA
Ga0207678_1174910923300026067Corn RhizosphereAYAQELMKRNGIGSVAVVGKTGELVGFLQTGKFKRTKRKK
Ga0208537_100632633300026071Natural And Restored WetlandsLMKRNGIGSVAVVGSTGELVGFLQNGKFKRKKRAQ
Ga0207702_1152363013300026078Corn RhizosphereELMKRNGIASVAVVGKTGELVGFLQAGKFRRKKRK
Ga0207641_1126193113300026088Switchgrass RhizosphereNATLAYAQELMRRNGIGSVAVVGKTGELVGFLQSGKFKRTKRSAKKSSR
Ga0207674_1134843513300026116Corn RhizosphereNATLDYAQELMRRNGIGSVAVVGNTGELVGFLQSGKFKRKKRK
Ga0207674_1146679123300026116Corn RhizosphereELMKRNGIGSVAVVGKTGELIGFLQTGKFKRVKRSRKSL
Ga0207674_1171696513300026116Corn RhizosphereNATLDYAQELMRRNGIGSVAVVGNTGELVGFLQTGKFKRKRRSRNSK
Ga0209687_104436113300026322SoilYAQELMKRNGIGSVAVVGKNGDLVGFLQAGRFKRTQRARASR
Ga0209178_123509523300027725Agricultural SoilGYARELMKVNGIGSLAVVGKNGELVGFLQSGKFKRKRR
Ga0209178_139194413300027725Agricultural SoilAPRFFVEPNATLAYAQELMKRNGIGSVAVVGKTGELVGFLQTGKFKRTKRSRSSK
Ga0209481_1004939713300027880Populus RhizosphereRLDYARELMKRNGIGSLAVVGKNGELVGFLQSGRFKRKKRSKRAAS
Ga0268264_1186041823300028381Switchgrass RhizosphereQELMRRNGIGSVAVVGSTGELVGFLQSGKFKRKKRK
Ga0310813_1068139433300031716SoilEPNATLDYAQELMKRNGIGSVAVVGKTGELVGFLQSGKFKRKKRSRTSR
Ga0310813_1156117213300031716SoilQELMKRNGIGSVAVVGKTGELVGFLQSGKFKRKKRK
Ga0310813_1176918513300031716SoilQELMRRNGIGSVAVVGKTGELVGFLQSGKFKRTKRKK
Ga0310907_1022946513300031847SoilFVEPNATLAYAQELMRRNGIGSVAVVGKTGELVGFLQSGKFKRTKRKK
Ga0310900_1015092333300031908SoilVEPNATLDYAQELMKRNGIGSVAVVGKTGELVGFLQSGKFKRKKRK
Ga0310897_1056446513300032003SoilRELMKRNGIGSVAVVGKTGELVGFLQTGTFKRRKRARAST
Ga0307415_10014054133300032126RhizosphereRNGIGSVAVVGKNGELVGFLQSGTFKRTKRKAAAR
Ga0310810_1136496913300033412SoilLMKRNGIGSVAVVGKTGELVGFLQSGKFKRKKRSRTSR
Ga0316628_10241806613300033513SoilEPNTSLDYARELMNRNGVGSVAVVGKNGELVGFLQNGKFKRRKRSKDK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.