Basic Information | |
---|---|
Family ID | F065719 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 127 |
Average Sequence Length | 42 residues |
Representative Sequence | MSLYIVIAVFIVVSIAFVVVFNRQNKALKNVRKVSGRGGDFQE |
Number of Associated Samples | 106 |
Number of Associated Scaffolds | 127 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 82.68 % |
% of genes near scaffold ends (potentially truncated) | 40.94 % |
% of genes from short scaffolds (< 2000 bps) | 83.46 % |
Associated GOLD sequencing projects | 99 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (71.654 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (19.685 % of family members) |
Environment Ontology (ENVO) | Unclassified (66.142 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (65.354 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 69.77% β-sheet: 0.00% Coil/Unstructured: 30.23% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 127 Family Scaffolds |
---|---|---|
PF07995 | GSDH | 14.96 |
PF05726 | Pirin_C | 11.81 |
PF00860 | Xan_ur_permease | 7.09 |
PF05656 | DUF805 | 5.51 |
PF01408 | GFO_IDH_MocA | 5.51 |
PF02894 | GFO_IDH_MocA_C | 3.94 |
PF07553 | Lipoprotein_Ltp | 1.57 |
PF02653 | BPD_transp_2 | 1.57 |
PF05016 | ParE_toxin | 1.57 |
PF07719 | TPR_2 | 1.57 |
PF13414 | TPR_11 | 0.79 |
PF01145 | Band_7 | 0.79 |
PF03576 | Peptidase_S58 | 0.79 |
COG ID | Name | Functional Category | % Frequency in 127 Family Scaffolds |
---|---|---|---|
COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 14.96 |
COG1741 | Redox-sensitive bicupin YhaK, pirin superfamily | General function prediction only [R] | 11.81 |
COG3152 | Uncharacterized membrane protein YhaH, DUF805 family | Function unknown [S] | 5.51 |
COG0673 | Predicted dehydrogenase | General function prediction only [R] | 3.94 |
COG3191 | L-aminopeptidase/D-esterase | Amino acid transport and metabolism [E] | 1.57 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 71.65 % |
All Organisms | root | All Organisms | 28.35 % |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 19.68% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 18.11% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 8.66% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 7.87% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 7.09% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 7.09% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 5.51% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.15% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 3.94% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.36% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.36% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.36% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.36% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.57% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.57% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.57% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.79% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.79% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.79% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.79% |
Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 0.79% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.79% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2199352004 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
3300002276 | Freshwater microbial communities from Lake Mendota, WI - 09JUN2009 deep hole epilimnion ns | Environmental | Open in IMG/M |
3300002351 | Freshwater microbial communities from Lake Mendota, WI - 05MAY2012 deep hole epilimnion | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
3300003413 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD | Environmental | Open in IMG/M |
3300004762 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004787 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004796 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005417 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
3300007165 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 | Environmental | Open in IMG/M |
3300007622 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 | Environmental | Open in IMG/M |
3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
3300008119 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NA | Environmental | Open in IMG/M |
3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
3300009051 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02 | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
3300009469 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 6m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
3300012713 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES033 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012715 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES122 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012716 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES130 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012717 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES135 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012725 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES137 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012726 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES115 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012728 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES043 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012734 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES144 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012968 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013014 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaG | Environmental | Open in IMG/M |
3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300016681 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES152 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300016690 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES019 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300018790 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_41 | Environmental | Open in IMG/M |
3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
3300020196 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015031 Kigoma Deep Cast 0m | Environmental | Open in IMG/M |
3300020481 | Freshwater microbial communities from Lake Mendota, WI - 23JUL2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020490 | Freshwater microbial communities from Lake Mendota, WI - 18JUL2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020493 | Freshwater microbial communities from Lake Mendota, WI - 14NOV2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020496 | Freshwater microbial communities from Lake Mendota, WI - 01NOV2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020497 | Freshwater microbial communities from Lake Mendota, WI - 18MAY2010 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
3300020500 | Freshwater microbial communities from Lake Mendota, WI - 9JUL2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020504 | Freshwater microbial communities from Lake Mendota, WI - 09AUG2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020508 | Freshwater microbial communities from Lake Mendota, WI - 15JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020509 | Freshwater microbial communities from Lake Mendota, WI - 14SEP2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020510 | Freshwater microbial communities from Lake Mendota, WI - 06JUL2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020522 | Freshwater microbial communities from Lake Mendota, WI - 26JUN2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020526 | Freshwater microbial communities from Lake Mendota, WI - 21JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020534 | Freshwater microbial communities from Lake Mendota, WI - 12JUL2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020538 | Freshwater microbial communities from Lake Mendota, WI - 28JUN2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020554 | Freshwater microbial communities from Lake Mendota, WI - 17AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020559 | Freshwater microbial communities from Lake Mendota, WI - 07JUL2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020562 | Freshwater microbial communities from Lake Mendota, WI - 05MAY2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020563 | Freshwater microbial communities from Lake Mendota, WI - 09JUN2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
3300020564 | Freshwater microbial communities from Lake Mendota, WI - 30JUL2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020574 | Freshwater microbial communities from Lake Mendota, WI - 26JUN2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020575 | Freshwater microbial communities from Lake Mendota, WI - 20MAY2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300024560 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024863 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025760 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300027114 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes) | Environmental | Open in IMG/M |
3300027214 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 (SPAdes) | Environmental | Open in IMG/M |
3300027499 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 (SPAdes) | Environmental | Open in IMG/M |
3300027578 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8h | Environmental | Open in IMG/M |
3300027642 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
3300028027 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 3H_FC | Environmental | Open in IMG/M |
3300028080 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028088 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028105 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
3300031786 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
3300033978 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002 | Environmental | Open in IMG/M |
3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
3300034023 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Oct2016-rr0090 | Environmental | Open in IMG/M |
3300034095 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091 | Environmental | Open in IMG/M |
3300034096 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15Oct2015-rr0098 | Environmental | Open in IMG/M |
3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
3300034110 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Jun2009D10-rr0171 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
2200087551 | 2199352004 | Freshwater | MELGILIAVVVVVSFAFLYVFRKQNKELKGLRKVSGRGGDFQE |
B570J29586_10251572 | 3300002276 | Freshwater | MDLVLLVVVFAVVPIAFIVVFNRQNRKLKKIRKVSGRGGDFQE* |
B570J29582_10230972 | 3300002351 | Freshwater | MELVLLLVVFAVVPIAFIVVFNRQSKKLKKIRKVSGRGGDFQE* |
B570J40625_1000536996 | 3300002835 | Freshwater | MELGILIAVVVVVSFAFLYVFRKQNKELKGLRKVSGRGGDFQE* |
B570J40625_1006774612 | 3300002835 | Freshwater | MELGILIAVVVVVSFAFLYVFRKQNKELKGLQKVSGRGGDFQE* |
JGI25908J49247_100096044 | 3300003277 | Freshwater Lake | MELAFFTALFVIVLIAFIVVFTRQNKKLKKVSGRGGDFQE* |
JGI25922J50271_100179212 | 3300003413 | Freshwater Lake | MSLYLVIAVFIVVSIAFVVVFNRQNKDLKNVRKVSGRGGDFHD* |
Ga0007749_11405272 | 3300004762 | Freshwater Lake | MSLYIVIAVIIVVSIAFVAVFNRQNKDLKNVRKVSGRGGDFHD* |
Ga0007755_14902122 | 3300004787 | Freshwater Lake | MGLYLVIAVFIVVSIAFVVVFNRQNKDLKNVRKVSGRGGDFQE* |
Ga0007763_115993582 | 3300004796 | Freshwater Lake | MSLYLVIAVFIVVSIAFVVVFNRQNKALKNVRKVSGRGGDFQE* |
Ga0068884_15106912 | 3300005417 | Freshwater Lake | MELGILIAVVVVVSFAFLYVFRKQNKELKRLRKVSGRGGDFQE* |
Ga0068876_101292591 | 3300005527 | Freshwater Lake | MELVVLIAVVIVVSFAFLYVFRKQNKELKRLRKVSGRGGDFQE* |
Ga0068876_105688201 | 3300005527 | Freshwater Lake | MELGILIAVVVVVSFAFLYVFRKQNKELKRLRKVSGR |
Ga0049081_102940351 | 3300005581 | Freshwater Lentic | FIVVSIAFVVVFNRQNKALKNVRKVSGRGGDFQE* |
Ga0049080_100211144 | 3300005582 | Freshwater Lentic | MDLVLLLAVFAVVPIAFIVVFNRQSKKLKKIRKVSGRGGDFQE* |
Ga0049080_101719781 | 3300005582 | Freshwater Lentic | MTLYIVIAVFIVVSIAFVVVFNRQNKALKNVRKVSGRGGDFQE* |
Ga0079957_10153892 | 3300005805 | Lake | MELTLLIAVFVVVSIAFVVVFYRQSKKLKKTRKVSGRGGDFQE* |
Ga0079301_10352593 | 3300006639 | Deep Subsurface | MELVLVLAVFVVVSIAFVVIFRKQSKDLKKIRKVSGRGGDFQE* |
Ga0079301_10684683 | 3300006639 | Deep Subsurface | MTLYIVIAVFIVVSIAFVVVFKRQNKALKNVRKVRGRGGDFQE* |
Ga0079301_10961344 | 3300006639 | Deep Subsurface | MEIVILIAVFVVVSFAFLFVFRKQNKELKGLRKVSGRGGDFQE* |
Ga0079302_10358171 | 3300007165 | Deep Subsurface | MELVLVLAVFVVVSIAFVVVFRKQSKDLKKIRKVSGRGGDFQE* |
Ga0102863_10298611 | 3300007622 | Estuarine | MSLYIVIAVFIVVSIAFVAVFNRQSKDLKNVRKVSGRGGDFHD* |
Ga0105746_10219223 | 3300007973 | Estuary Water | FVVVSIAFVAVFNRQSKDLKNVRKVSGRGGDFHD* |
Ga0105746_11794881 | 3300007973 | Estuary Water | MSLYIVIAVFIVVSIAFVVVFNRQNKALKNVRKVSGRGGDFH |
Ga0114341_100690112 | 3300008108 | Freshwater, Plankton | MEIVILIAVFVVVSFAFLYVFRKQNKELKKVRKVSGRGGDFQE* |
Ga0114344_10594483 | 3300008111 | Freshwater, Plankton | MEIVILIAVIVVVSSAFLYVFRKQNKELKKVRKVSG |
Ga0114347_10185373 | 3300008114 | Freshwater, Plankton | MELGILIAVIVVVSFAFIYVFRKQNKELKRLRKVSGRGGDFQE* |
Ga0114347_11230604 | 3300008114 | Freshwater, Plankton | SRPTGKANEMELGILIAVVVVVSFAFLYVFRKQNKELKGLRKVSGRGGDFQE* |
Ga0114354_11306651 | 3300008119 | Freshwater, Plankton | MELGIQIAVVVVVSFAFLYVFRKQNKELKRLRKVSGRGGDFQE* |
Ga0114354_11804721 | 3300008119 | Freshwater, Plankton | MSLYIVIAVFIVVSIAFVVVFNRQNKALKNVRKVSGRGGDFQE* |
Ga0114841_12759832 | 3300008259 | Freshwater, Plankton | MELVLVLAVFIVVSIAFVVVFNRQNKALKNVRKVSGRGGDFQE* |
Ga0114336_11747882 | 3300008261 | Freshwater, Plankton | MTLYIVIAVFIVVSIAFVVVFRKQSKDLKKIRKVSGRGGDFQE* |
Ga0114337_10875981 | 3300008262 | Freshwater, Plankton | MELVVLIAVVIVVSFAFLYVFRKQNKEQKRLRKVSGRGGDFQE* |
Ga0114337_12466392 | 3300008262 | Freshwater, Plankton | MSLYLVIAVFIVVSIAFVVVFNRQNKALKNVRKLSGRGGDFQE* |
Ga0114337_13250541 | 3300008262 | Freshwater, Plankton | MELGILIAVVVVVSFAFLYVFRKQNKELKRLRKVSGRG |
Ga0102864_10040381 | 3300009051 | Estuarine | IVIAVFIVVSIAFVVVFNRQNKDLKNVRKVSGRGGDFHD* |
Ga0114973_101590242 | 3300009068 | Freshwater Lake | MGLYLVIAVFIVVSIAFVVVFNRQNKDLKNVRKVSGRGGDFHE* |
Ga0114968_101352913 | 3300009155 | Freshwater Lake | MGLYLVIAVFIVVSIAFVVVFNIQNKDLKNVRKVSGRGGDFHE* |
Ga0114975_101825002 | 3300009164 | Freshwater Lake | MSLYLVIAVFIVVSIAFVVVFNRQNKDLKNVRKVSGRGGDFHE* |
Ga0114982_10505031 | 3300009419 | Deep Subsurface | TRKAIEMGLYLVIAVFIVVSIAFVVVFNRQNKALKNVRKVSGRGGDFQE* |
Ga0114982_12024272 | 3300009419 | Deep Subsurface | MGLYLVIAVFIVVSIAFVVVFNRQNKDLKNVRKVSGRGGDFHD* |
Ga0127401_10881102 | 3300009469 | Meromictic Pond | MTLYIVIAVFIVVSIAFVVVFDRQNKALKNVRKVSGRGGDFQE* |
Ga0114967_102094622 | 3300010160 | Freshwater Lake | MGLYLVIAVFIVVSIAFVLVFNRQNKDLKNVRKVSGRGGDFHE* |
Ga0129333_114546481 | 3300010354 | Freshwater To Marine Saline Gradient | MEIVILIAVFVVVSFAFLYVFRKQNKELKNLRKVSGRGGDFQE* |
Ga0129336_102955312 | 3300010370 | Freshwater To Marine Saline Gradient | MELVVLIAVVVVVSFAFLYVFRKQNKELKGLRKVSGRGGDFQE* |
Ga0129336_104865672 | 3300010370 | Freshwater To Marine Saline Gradient | MEIVILIAVLVVVSFAFLYVFRKQNKELKGLRKVSGRGGDFQE* |
Ga0151620_10211543 | 3300011268 | Freshwater | MELVILIAVVVVVSFAFIYVFRKQNKELKNLRKVSGRGGDFQE* |
Ga0151620_10781574 | 3300011268 | Freshwater | MSLYIVIAVFIVVSIAFVAVFNRQNKDLKNVRKVSGRGGDFHD* |
Ga0157544_10693942 | 3300012713 | Freshwater | MSLYIVIAVIIVVSIAFVAVFNRQNKDLKNVRKVSGRG |
Ga0157599_10499392 | 3300012715 | Freshwater | MELGILIAVVVVVSFAFLYVFRKQNKELKGLRKVSGRG |
Ga0157605_10460232 | 3300012716 | Freshwater | MTLYIVIAVFIVVSIAFVVVFNRQNKALKNVRKVSGRGGDF |
Ga0157609_11370662 | 3300012717 | Freshwater | MELGILIAVVVVVSFAFLYVFRKQNKELKGLRKVSGRGGDF |
Ga0157610_12180571 | 3300012725 | Freshwater | MSLYIVIAVFIVVSIAFVAVFNRQNKDLKNVRKVSGRG |
Ga0157597_10834632 | 3300012726 | Freshwater | MELGILIAVVVVVSFAFLYVFRKQNKELKGLRKVSGR |
Ga0157552_10506671 | 3300012728 | Freshwater | MSLYIVIAVIIVVSIAFVAVFNRQNKDLKNVRKVSG |
Ga0157615_11480381 | 3300012734 | Freshwater | MTLYIVIAVFIVVSIAFVVVFNRQNKALKNVRKVSGR |
Ga0129337_12775682 | 3300012968 | Aqueous | MELGILITLIVVVSFAFLYVFRKQNKELKRLRKVSGRGGDFQE* |
Ga0164295_101800883 | 3300013014 | Freshwater | MELAFFTGLFVIVLVAFIVVFTRQNKKLKKVSGRGGDFQE* |
(restricted) Ga0172367_106409932 | 3300013126 | Freshwater | MELGTLIAVIVVVSFAFIYVFRKQNKEVKRLRKVSGRGGDFQE* |
Ga0177922_111862373 | 3300013372 | Freshwater | FVVVSFAFLFVFRKQNKELKNLRKVSGRGGDFQE* |
Ga0180043_1330172 | 3300016681 | Freshwater | MSLYIVIAVFIVVSIAFVVVFNRQNKALKNVRKLSG |
Ga0180048_10118022 | 3300016690 | Freshwater | MSLYIVIAVIIVVSIAFVAVFNRQNKDLKNVRKVSGRGGD |
Ga0187842_10030464 | 3300018790 | Freshwater | MSLYIVIAVIIVVSIAFVAVFNRQNKDLKNVRKVSGRGGDFHD |
Ga0211736_103337822 | 3300020151 | Freshwater | MEIVILIAVFMVVSFAFLYVFRKQNKELKNLRKVSGRGGDFQE |
Ga0194115_101734972 | 3300020183 | Freshwater Lake | MELGILIAVIVVVSFAFIYVFRKQNKEVKRLRKVSGRGGDFQE |
Ga0194124_103623181 | 3300020196 | Freshwater Lake | LGILIAVIVVVSFAFIYVFRKQNKEVKRLRKVSGRGGDFQE |
Ga0207911_1082862 | 3300020481 | Freshwater | KANEMELGILIAVVVVVSFAFLYVFRKQNKELKGLRKVSGRGGDFQE |
Ga0208052_1064793 | 3300020490 | Freshwater | MELGILIAVVVVVSFAFLYVFRKQNKELKRLRKVSGRGGDF |
Ga0208591_10099202 | 3300020493 | Freshwater | MELGILIAVVVVVSFAFLYVFRKQNKELKRLRKVSGRGGDFQE |
Ga0208591_10256131 | 3300020493 | Freshwater | KSRPTGKANEMELGILIAVVVVVSFAFLYVFRKQNKELKGLRKVSGRGGDFQE |
Ga0208230_10011626 | 3300020496 | Freshwater | MELGILIAVVVVVSFAFLYVFRKQNKELKGLQKVSGRGGD |
Ga0208592_10025153 | 3300020497 | Freshwater | MELGILIAVVVVVSFAFLYVFRKQNKELKGLQKVSGRGGDFQE |
Ga0208592_10094742 | 3300020497 | Freshwater | MSLYLVIAVFIVVSIAFVVVFNRQNKDLKNVRKVSGRGGDFHD |
Ga0208463_100066213 | 3300020500 | Freshwater | VFIVVSIAFVAVFNRQSKDLKNVRKLSGRGGDFHD |
Ga0208484_10019813 | 3300020504 | Freshwater | MDLVLLLVVFAVVPIAFIVVFNRQSKKLKKIRKVSGRGGDFQE |
Ga0208225_10122201 | 3300020508 | Freshwater | MSLYIVIAVFIVVSIAFVAVFNRQNKDLKNVRKVSGRGGDFHD |
Ga0208594_100043612 | 3300020509 | Freshwater | MELGILIAVVVVVSFAFLYVFRKQNKELKRLRKVSGRGGD |
Ga0208086_100053416 | 3300020510 | Freshwater | MELVLLLVVFAVVPIAFIVVFNRQSKKLKKIRKVSGRGGDFQE |
Ga0208327_10120121 | 3300020522 | Freshwater | MSLYLVIAVFIVVSIAFVVVFNRQQKALKNVRKVSGRGGDFHD |
Ga0208085_10040093 | 3300020526 | Freshwater | MDLVLLLAVFAVVPIAFIVVFNRQSKKLKKIRKVSGRGGDFQE |
Ga0208596_10024054 | 3300020534 | Freshwater | MSLYIVIAVFIVVSIAFVAVFNRQSKDLKNVRKLSGRGGDFHD |
Ga0208595_10034095 | 3300020538 | Freshwater | MSLYIVIAVFVVVSIAFVAVFNRQSKDLKNVRKVSGRGGDFHD |
Ga0208599_10048422 | 3300020554 | Freshwater | MDLVLLLVVFAVVPIAFIVVFNRQNRKLKKIRKVSGRGGDFQE |
Ga0208083_10108001 | 3300020559 | Freshwater | KANEMELGILIAVVVVVSFAFLYVFRKQNKELKRLRKVSGRGGDFQE |
Ga0208597_10794572 | 3300020562 | Freshwater | ELGILIAVVVVVSFAFLYVFRKQNKELKRLRKVSGRGGDFQE |
Ga0208082_10130082 | 3300020563 | Freshwater | MDLVLLVVVFAVVPIAFIVVFNRQNRKLKKIRKVSGRGGDFQE |
Ga0208719_10308671 | 3300020564 | Freshwater | EMELGILIAVVVVVSFAFLYVFRKQNKELKRLRKVSGRGGDFQE |
Ga0208221_10937192 | 3300020574 | Freshwater | MSLYIVIAVFIVVSIAFVVVFNRQNKDLKNVRKVSGRGGDFHD |
Ga0208053_10819813 | 3300020575 | Freshwater | GKANEMELGILIAVVVVVSFAFLYVFRKQNKELKGLQKVSGRGGDFQE |
Ga0222713_106451142 | 3300021962 | Estuarine Water | MELVILIAVVAVVSFAFIYVFRKQNKELKGLRKVSGRGGDFQE |
Ga0256306_11438622 | 3300024560 | Freshwater | MDLVLLLVVFAVVPIAFIVVFNRQNRKLKKIRKVSGRGG |
Ga0255246_11419022 | 3300024863 | Freshwater | MELVLLLVVFVVVPIAFIVVFNRQSKKLKKIRKVSGRGGDF |
Ga0255249_10840981 | 3300025760 | Freshwater | MELVLLLAVFVVVPIAFIVVFNRQSKKLKKIRKVSGRG |
Ga0208009_10149764 | 3300027114 | Deep Subsurface | MELVLVLAVFVVVSIAFVVIFRKQSKDLKKIRKVSGRGGDFQE |
Ga0208306_10871971 | 3300027214 | Estuarine | MSLYIVIAVFIVVSIAFVAVFNRQSKDLKNVRKVSGRGGDFH |
Ga0208788_10336116 | 3300027499 | Deep Subsurface | MEIVILIAVFVVVSFAFLFVFRKQNKELKGLRKVSGRGGDFQE |
Ga0255075_10947841 | 3300027578 | Freshwater | MSLYIVIAVFIVVSIAFVAVFNRQSKDLKNVRKVSGRGGDFHD |
Ga0209135_10109305 | 3300027642 | Freshwater Lake | FTALFVAVLIAFIVVFTRQNKKLKKVSGRGGDFQE |
Ga0209599_101559762 | 3300027710 | Deep Subsurface | LYIVIAVFIVVSIAFVVVFNRQNKALKNVRKVSGRGGDFQE |
Ga0209107_103183522 | 3300027797 | Freshwater And Sediment | MSLYIVIAVFIVVSIAFVVVFKRQNKALKNVRKVSGRGGDFQE |
Ga0209358_104429211 | 3300027804 | Freshwater Lake | MSLYIVIAVFIVVSIAFVVVFNRQNKALKNVRKVSGRGGDFQE |
Ga0247722_100028877 | 3300028027 | Deep Subsurface Sediment | MEIVILIAVLAVVSFAFLYVFRKQNKELKNLRKVSGRGGDFQE |
Ga0256324_10686032 | 3300028080 | Freshwater | MELVLLLVVFAVVPIAFIVVFNRQSKKLKKIRKVSGR |
Ga0255251_11021671 | 3300028088 | Freshwater | MSLYIVIAVIIVVSIAFVAGFNRQNKDLKNVRKVSGRGG |
Ga0255254_11097351 | 3300028105 | Freshwater | MDLVLLLAVFAVVPIAFIVVFNRQSKKLKKIRKVSGRGGD |
Ga0315907_102124013 | 3300031758 | Freshwater | MELGILIAVIVVVSFAFIYVFRKQNKELKRLRKVSGRGGDFQE |
Ga0315907_105200772 | 3300031758 | Freshwater | MELGILIVVVVVVSFAFLYVFRKQNKELKGLRKVSGRGGDFQE |
Ga0315899_102344371 | 3300031784 | Freshwater | MSLYIVIAVFIVVSIAFVVVFNRQNKALKNVRKLSGRGGDFQE |
Ga0315899_113264752 | 3300031784 | Freshwater | MSLYLVIAVFIVVSIAFVVVFNRQNKALKNVRKVSGRGGDFQE |
Ga0315908_115108962 | 3300031786 | Freshwater | MTLYIVIAVFIVVSIAFVVVFNRQNKALKNVRKVSGRGGDFQE |
Ga0315904_109349793 | 3300031951 | Freshwater | ANEMELGILIVVVVVVSFAFLYVFRKQNKELKGLRKVSGRGGDFQE |
Ga0315904_109405341 | 3300031951 | Freshwater | GKANEMELGILIAVVVVVSFAFLYVFRKQNKELKRLRKVSGRGGDFQE |
Ga0315905_103143661 | 3300032092 | Freshwater | MTLYIVIAVFIVVSIAFVVIFNRQNKALKNVRKVSGRGGDFQE |
Ga0315905_115204092 | 3300032092 | Freshwater | MELALLLAVFIVVSIAFVVVFRKQSKDLKKIRKVSGRGGDFQE |
Ga0334977_0274919_637_768 | 3300033978 | Freshwater | MSLYLVIAVFVVVSIAFVVVFNRQNKDLKNVRKVSGRGGDFHD |
Ga0334992_0420778_168_299 | 3300033992 | Freshwater | MSLYIVIAVFIVVSIAFVVVFNRQSEDLKNVRKVSGRGGDFHD |
Ga0334979_0466101_1_117 | 3300033996 | Freshwater | VIAVFIVVSIAFVAVFNRQSKDLKNVRKVSGRGGDFHD |
Ga0334985_0239572_1060_1170 | 3300034018 | Freshwater | AVFIVVSIAFVVVFNRQSEDLKNVRKVSGRGGDFHD |
Ga0335005_0490980_48_179 | 3300034022 | Freshwater | MSLYLVIAVFIVVSIAFVVVFRKQSKDLKKIRKVSGRGGDFQE |
Ga0335005_0697354_391_522 | 3300034022 | Freshwater | MELAILIAVVVVVSFAFLYVFRKQNKELKGLRKVSGRGGDFQE |
Ga0335021_0493733_1_126 | 3300034023 | Freshwater | MELGILIAVVVVVSFAFLYVFRKQNKELKRLRKVSGRGGDFQ |
Ga0335022_0508659_1_153 | 3300034095 | Freshwater | MDLVLLLVVFAVVPIAFIVVFNRQSKKLKKIRKVSGRGGDFQEWLDFKIIK |
Ga0335025_0649840_2_121 | 3300034096 | Freshwater | ILIAVVVVVSFAFLYVFRKQNKELKRLRKVSGRGGDFQE |
Ga0335027_0849759_3_110 | 3300034101 | Freshwater | MSLYIVIAVFIVVSIAFVAVFNRQNKDLKNVRKVSG |
Ga0335029_0752373_404_520 | 3300034102 | Freshwater | MSLYIVIAVFIVVSIAFVAVFNRQNKDLKNVRKVSGRGG |
Ga0335055_0199766_399_530 | 3300034110 | Freshwater | MTLYIVIAVFIVVSIAFVVVFNRQNKDLKNVRKVSGRGGDFHD |
Ga0335055_0412394_2_172 | 3300034110 | Freshwater | QFTKELNTRKAIEMELVLLLVVFAVVPIAFIVVFNRQSKKLKKIRKVSGRGGDFQE |
⦗Top⦘ |