NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F065802

Metagenome / Metatranscriptome Family F065802

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F065802
Family Type Metagenome / Metatranscriptome
Number of Sequences 127
Average Sequence Length 40 residues
Representative Sequence MIVLGKTPKEWRKEIGSKSLYYRAEIVIFLIGFILGSVIF
Number of Associated Samples 92
Number of Associated Scaffolds 127

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 74.02 %
% of genes near scaffold ends (potentially truncated) 30.71 %
% of genes from short scaffolds (< 2000 bps) 88.98 %
Associated GOLD sequencing projects 84
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (62.992 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Strait → Unclassified → Seawater
(26.772 % of family members)
Environment Ontology (ENVO) Unclassified
(86.614 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(94.488 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 70.00%    β-sheet: 0.00%    Coil/Unstructured: 30.00%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 127 Family Scaffolds
PF03237Terminase_6N 2.36
PF05063MT-A70 0.79
PF13730HTH_36 0.79

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 127 Family Scaffolds
COG4725N6-adenosine-specific RNA methylase IME4Translation, ribosomal structure and biogenesis [J] 1.57

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms74.02 %
UnclassifiedrootN/A25.98 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000101|DelMOSum2010_c10102147Not Available1187Open in IMG/M
3300000101|DelMOSum2010_c10118035All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C2811052Open in IMG/M
3300000101|DelMOSum2010_c10154644All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P835Open in IMG/M
3300000101|DelMOSum2010_c10274737Not Available517Open in IMG/M
3300000115|DelMOSum2011_c10100584All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes948Open in IMG/M
3300000115|DelMOSum2011_c10124737All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes801Open in IMG/M
3300000115|DelMOSum2011_c10222411All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC024P515Open in IMG/M
3300000116|DelMOSpr2010_c10043575All Organisms → cellular organisms → Bacteria2006Open in IMG/M
3300000116|DelMOSpr2010_c10202227All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-AD10-C281636Open in IMG/M
3300000117|DelMOWin2010_c10093397All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P1127Open in IMG/M
3300001355|JGI20158J14315_10230200Not Available514Open in IMG/M
3300001450|JGI24006J15134_10018181Not Available3281Open in IMG/M
3300001450|JGI24006J15134_10059699All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1514Open in IMG/M
3300001450|JGI24006J15134_10116034All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage Lederberg EXVC029P934Open in IMG/M
3300001472|JGI24004J15324_10031882All Organisms → cellular organisms → Bacteria1700Open in IMG/M
3300001472|JGI24004J15324_10126291All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus620Open in IMG/M
3300001472|JGI24004J15324_10139246Not Available573Open in IMG/M
3300001472|JGI24004J15324_10158550Not Available515Open in IMG/M
3300001589|JGI24005J15628_10088983All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005)1065Open in IMG/M
3300006026|Ga0075478_10040234All Organisms → Viruses → Predicted Viral1546Open in IMG/M
3300006027|Ga0075462_10053186All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P1284Open in IMG/M
3300006029|Ga0075466_1087090All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes863Open in IMG/M
3300006029|Ga0075466_1131511All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC024P656Open in IMG/M
3300006399|Ga0075495_1501437All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC024P684Open in IMG/M
3300006735|Ga0098038_1052446All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005)1470Open in IMG/M
3300006735|Ga0098038_1239667All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus576Open in IMG/M
3300006737|Ga0098037_1041290All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1679Open in IMG/M
3300006737|Ga0098037_1205231All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia644Open in IMG/M
3300006737|Ga0098037_1242556Not Available580Open in IMG/M
3300006749|Ga0098042_1053718All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1087Open in IMG/M
3300006752|Ga0098048_1050633All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P1306Open in IMG/M
3300006803|Ga0075467_10268924All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes918Open in IMG/M
3300006810|Ga0070754_10226900All Organisms → cellular organisms → Bacteria861Open in IMG/M
3300006810|Ga0070754_10471758All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P542Open in IMG/M
3300006916|Ga0070750_10248561All Organisms → cellular organisms → Bacteria773Open in IMG/M
3300006922|Ga0098045_1033138All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1323Open in IMG/M
3300006928|Ga0098041_1145948All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes761Open in IMG/M
3300006929|Ga0098036_1185179Not Available633Open in IMG/M
3300006929|Ga0098036_1188071Not Available628Open in IMG/M
3300007345|Ga0070752_1200802All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC024P795Open in IMG/M
3300007346|Ga0070753_1320436All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC024P551Open in IMG/M
3300007540|Ga0099847_1196467Not Available589Open in IMG/M
3300007640|Ga0070751_1223337Not Available724Open in IMG/M
3300008012|Ga0075480_10598621Not Available522Open in IMG/M
3300009001|Ga0102963_1039844All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1953Open in IMG/M
3300009193|Ga0115551_1495353Not Available521Open in IMG/M
3300009423|Ga0115548_1114444All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes870Open in IMG/M
3300009435|Ga0115546_1113774All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P974Open in IMG/M
3300010149|Ga0098049_1062128All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P1184Open in IMG/M
3300011254|Ga0151675_1000540All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes3288Open in IMG/M
3300017706|Ga0181377_1027961All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005)1185Open in IMG/M
3300017708|Ga0181369_1103806All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P589Open in IMG/M
3300017709|Ga0181387_1140022Not Available500Open in IMG/M
3300017710|Ga0181403_1027191Not Available1210Open in IMG/M
3300017713|Ga0181391_1022670All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Fowlmouthvirus → Fowlmouthvirus fowlmouth1556Open in IMG/M
3300017713|Ga0181391_1077586Not Available761Open in IMG/M
3300017713|Ga0181391_1135097All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P549Open in IMG/M
3300017714|Ga0181412_1050794All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC024P1051Open in IMG/M
3300017717|Ga0181404_1153932All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes554Open in IMG/M
3300017720|Ga0181383_1025378All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P1593Open in IMG/M
3300017720|Ga0181383_1186396Not Available553Open in IMG/M
3300017728|Ga0181419_1025033All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1655Open in IMG/M
3300017729|Ga0181396_1109120All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes568Open in IMG/M
3300017739|Ga0181433_1010916All Organisms → cellular organisms → Bacteria2504Open in IMG/M
3300017741|Ga0181421_1064962All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes961Open in IMG/M
3300017744|Ga0181397_1193130All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P511Open in IMG/M
3300017750|Ga0181405_1071644All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P893Open in IMG/M
3300017750|Ga0181405_1114908All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes674Open in IMG/M
3300017753|Ga0181407_1138479All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P604Open in IMG/M
3300017755|Ga0181411_1025578All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P1896Open in IMG/M
3300017755|Ga0181411_1138226All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes705Open in IMG/M
3300017756|Ga0181382_1031339All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1608Open in IMG/M
3300017760|Ga0181408_1127448All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes658Open in IMG/M
3300017763|Ga0181410_1209126Not Available532Open in IMG/M
3300017767|Ga0181406_1184650Not Available622Open in IMG/M
3300017768|Ga0187220_1219314All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes571Open in IMG/M
3300017770|Ga0187217_1085689Not Available1078Open in IMG/M
3300017773|Ga0181386_1011478All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes3005Open in IMG/M
3300017773|Ga0181386_1167993All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes667Open in IMG/M
3300017776|Ga0181394_1066147All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P1193Open in IMG/M
3300017776|Ga0181394_1248351All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P533Open in IMG/M
3300017779|Ga0181395_1166643All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes691Open in IMG/M
3300017781|Ga0181423_1066277All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1431Open in IMG/M
3300017782|Ga0181380_1143531All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P815Open in IMG/M
3300017783|Ga0181379_1293786All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes553Open in IMG/M
3300017783|Ga0181379_1325982Not Available519Open in IMG/M
3300017824|Ga0181552_10407182All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage Lederberg EXVC029P651Open in IMG/M
3300017950|Ga0181607_10019601All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes5137Open in IMG/M
3300018036|Ga0181600_10009821All Organisms → Viruses7007Open in IMG/M
3300018048|Ga0181606_10038323All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P3370Open in IMG/M
3300020438|Ga0211576_10362956Not Available745Open in IMG/M
3300021375|Ga0213869_10009624Not Available5842Open in IMG/M
3300021375|Ga0213869_10378926Not Available584Open in IMG/M
3300021957|Ga0222717_10561420Not Available605Open in IMG/M
3300021959|Ga0222716_10035128All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes3630Open in IMG/M
3300021959|Ga0222716_10601897All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P600Open in IMG/M
3300022200|Ga0196901_1198687All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes645Open in IMG/M
3300024344|Ga0209992_10071164All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1605Open in IMG/M
3300025070|Ga0208667_1023714All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1163Open in IMG/M
3300025086|Ga0208157_1044879Not Available1211Open in IMG/M
3300025086|Ga0208157_1118623Not Available617Open in IMG/M
3300025102|Ga0208666_1120069All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P624Open in IMG/M
3300025120|Ga0209535_1033190All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2405Open in IMG/M
3300025120|Ga0209535_1046530Not Available1886Open in IMG/M
3300025137|Ga0209336_10162579Not Available581Open in IMG/M
3300025508|Ga0208148_1016146All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P2186Open in IMG/M
3300025543|Ga0208303_1041265All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1168Open in IMG/M
3300025632|Ga0209194_1070750All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P942Open in IMG/M
3300025645|Ga0208643_1183177Not Available507Open in IMG/M
3300025652|Ga0208134_1029912All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1929Open in IMG/M
3300025652|Ga0208134_1037653All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1639Open in IMG/M
3300025652|Ga0208134_1046105All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P1414Open in IMG/M
3300025759|Ga0208899_1070294All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1404Open in IMG/M
3300025759|Ga0208899_1076918All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1314Open in IMG/M
3300025769|Ga0208767_1248394Not Available558Open in IMG/M
3300025816|Ga0209193_1103176All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P707Open in IMG/M
3300025869|Ga0209308_10094495All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1459Open in IMG/M
3300025889|Ga0208644_1374705All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P533Open in IMG/M
3300028600|Ga0265303_11577083Not Available549Open in IMG/M
3300029309|Ga0183683_1003010All Organisms → Viruses5986Open in IMG/M
3300029309|Ga0183683_1012281All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P2079Open in IMG/M
3300029787|Ga0183757_1019707All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1637Open in IMG/M
3300031851|Ga0315320_10203695All Organisms → Viruses → Predicted Viral1456Open in IMG/M
3300032257|Ga0316205_10205254All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes733Open in IMG/M
3300032277|Ga0316202_10151027All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC034P1079Open in IMG/M
3300032277|Ga0316202_10306555Not Available739Open in IMG/M
3300032277|Ga0316202_10404554All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes638Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater26.77%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine22.83%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous19.68%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine7.87%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine4.72%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat3.15%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh3.15%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine3.15%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water2.36%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater1.57%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.79%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater0.79%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.79%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface0.79%
SedimentEnvironmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment0.79%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water0.79%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000101Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010EnvironmentalOpen in IMG/M
3300000115Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011EnvironmentalOpen in IMG/M
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300000117Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010EnvironmentalOpen in IMG/M
3300001355Pelagic Microbial community sample from North Sea - COGITO 998_met_08EnvironmentalOpen in IMG/M
3300001450Marine viral communities from the Pacific Ocean - LP-53EnvironmentalOpen in IMG/M
3300001472Marine viral communities from the Pacific Ocean - LP-32EnvironmentalOpen in IMG/M
3300001589Marine viral communities from the Pacific Ocean - LP-40EnvironmentalOpen in IMG/M
3300006026Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006027Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006399Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006737Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaGEnvironmentalOpen in IMG/M
3300006749Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaGEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006922Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaGEnvironmentalOpen in IMG/M
3300006928Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaGEnvironmentalOpen in IMG/M
3300006929Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaGEnvironmentalOpen in IMG/M
3300007345Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30EnvironmentalOpen in IMG/M
3300007346Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31EnvironmentalOpen in IMG/M
3300007540Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007640Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28EnvironmentalOpen in IMG/M
3300008012Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300009001Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MGEnvironmentalOpen in IMG/M
3300009193Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321EnvironmentalOpen in IMG/M
3300009423Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423EnvironmentalOpen in IMG/M
3300009435Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413EnvironmentalOpen in IMG/M
3300010149Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaGEnvironmentalOpen in IMG/M
3300011254Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, 0.02EnvironmentalOpen in IMG/M
3300017706Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaGEnvironmentalOpen in IMG/M
3300017708Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaGEnvironmentalOpen in IMG/M
3300017709Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27EnvironmentalOpen in IMG/M
3300017710Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28EnvironmentalOpen in IMG/M
3300017713Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11EnvironmentalOpen in IMG/M
3300017714Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15EnvironmentalOpen in IMG/M
3300017717Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25EnvironmentalOpen in IMG/M
3300017720Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23EnvironmentalOpen in IMG/M
3300017728Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24EnvironmentalOpen in IMG/M
3300017729Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 19 SPOT_SRF_2011-01-11EnvironmentalOpen in IMG/M
3300017739Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10EnvironmentalOpen in IMG/M
3300017741Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19EnvironmentalOpen in IMG/M
3300017744Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23EnvironmentalOpen in IMG/M
3300017750Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29EnvironmentalOpen in IMG/M
3300017753Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26EnvironmentalOpen in IMG/M
3300017755Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09EnvironmentalOpen in IMG/M
3300017756Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22EnvironmentalOpen in IMG/M
3300017760Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16EnvironmentalOpen in IMG/M
3300017763Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20EnvironmentalOpen in IMG/M
3300017767Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20EnvironmentalOpen in IMG/M
3300017768Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2)EnvironmentalOpen in IMG/M
3300017770Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2)EnvironmentalOpen in IMG/M
3300017773Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24EnvironmentalOpen in IMG/M
3300017776Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23EnvironmentalOpen in IMG/M
3300017779Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16EnvironmentalOpen in IMG/M
3300017781Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300017783Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10EnvironmentalOpen in IMG/M
3300017824Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017950Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018036Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018048Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020438Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942)EnvironmentalOpen in IMG/M
3300021375Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300022200Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300024344Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025070Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025086Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025102Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025137Marine viral communities from the Pacific Ocean - LP-32 (SPAdes)EnvironmentalOpen in IMG/M
3300025508Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025543Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025632Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 (SPAdes)EnvironmentalOpen in IMG/M
3300025645Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes)EnvironmentalOpen in IMG/M
3300025652Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes)EnvironmentalOpen in IMG/M
3300025759Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes)EnvironmentalOpen in IMG/M
3300025769Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes)EnvironmentalOpen in IMG/M
3300025816Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 (SPAdes)EnvironmentalOpen in IMG/M
3300025869Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300028600Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160317 (Illumina Assembly)EnvironmentalOpen in IMG/M
3300029309Marine viral communities collected during Tara Oceans survey from station TARA_100 - TARA_R100001440EnvironmentalOpen in IMG/M
3300029787Marine viral communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000172EnvironmentalOpen in IMG/M
3300031851Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515EnvironmentalOpen in IMG/M
3300032257Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyriteEnvironmentalOpen in IMG/M
3300032277Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotiteEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2010_1010214763300000101MarineMIVLGKTPKEWRKEIGSKSLYYRAEIVIFLIGFILGSV
DelMOSum2010_1011803533300000101MarineMIVXGKTPKEWRKEIGSKSLYYRAEIVIFLIGFILGSVIF*
DelMOSum2010_1015464453300000101MarineMIVLGKTPKEWRKEIGSKSLYYRAEIVIFLIGFILGSVIF*
DelMOSum2010_1027473723300000101MarineMIVYGKTPKEWRKEIGLKSSRILLTLQEVSLYYRAEIVIFLIGFILGSVIF*
DelMOSum2011_1010058453300000115MarineMIVLGKTPKEWRKEIGIKSLYYRTEIVIFLIGFILGSVIF*
DelMOSum2011_1012473733300000115MarineMIVLGKTPKEWRKEIGSKSLYYRXEIVIFLIGFILGSVIF*
DelMOSum2011_1022241123300000115MarineMIVLGKTPKEWRKEIGLKSLYYRTEIVIFLIGFILGSVIF*
DelMOSpr2010_1004357573300000116MarineMIILGKTPKEWRKEIGIKSLYYRAEIVIFLIGFILGSVIF*
DelMOSpr2010_1020222733300000116MarineMMIVLGKTPKEWRKEIGSKSLYYRTEIVIFLIGFILGSVIF*
DelMOWin2010_1009339753300000117MarineMIVLGKTPKEWRKEIGSKSLYYRTEIVIFLIGFILGSIIF*
JGI20158J14315_1023020013300001355Pelagic MarineMILMGKTPKEWRKEIGLKSSRILLTLQEVSLYYRAEIVIF
JGI24006J15134_1001818193300001450MarineMIVLGKTPKEWRKEIGXXSLYYRAEIVIFLIGFILGSIIF*
JGI24006J15134_1005969943300001450MarineMIILDKTPKEWRKEIGLKSLYYRTEIIIFIIGFILGTIIF*
JGI24006J15134_1011603433300001450MarineMIVLGKTPKEWRKEIGSKSLYYRAEIVIFLIGFILGSIIF*
JGI24004J15324_1003188263300001472MarineMIILGRTPKEWRKEIGLKSLYYRTEIIIFIIGFILGAIIF*
JGI24004J15324_1012629113300001472MarineMIVLGKTPKEWRKQIGLKSLYYRAEIVIFLIGFILGSIIF*
JGI24004J15324_1013924623300001472MarineMMIVLGKTPKEWRKEIGLKSLYYRVEIIIFLIGFILGSIIF*
JGI24004J15324_1015855033300001472MarineKTPKEWRKEIGSKSLYYRAEIVIFLIGFILGSVIF*
JGI24005J15628_1008898353300001589MarineMIVLGKTPKEWRKEIGSKSLYYRAEIIIFLIGFILGSIIF*
Ga0075478_1004023443300006026AqueousMIILGKTPKEWRKEIGSKSLYYRTEIVIFLIGFILGSVIF*
Ga0075462_1005318663300006027AqueousMILMGKTPKEWRKEIGSKSLYYRAEIVIFLIGFILGSVIF*
Ga0075466_108709043300006029AqueousLGKTPKEWRKEIGSKSLYYRAEIVIFLIGFILGSVIF*
Ga0075466_113151153300006029AqueousMIVLGKTPKEWRKEIGLKSLYYRAEIVIFLIGFILGSVIF*
Ga0075495_150143723300006399AqueousMIVLGKTPKEWRKEISLKSLYYRAEIVIFLIGFILGSVIF*
Ga0098038_105244653300006735MarineMIILGKTPKEWRKEIGSKSLYYRAEIVIFLIGFILGSVIF*
Ga0098038_123966733300006735MarineMILMGKTPKEWRKEIGLKSLYYRAEIVIFLIGFILGSIIF*
Ga0098037_104129053300006737MarineMIVLGKTPKEWRKEIGSKSLYYRTEIVIFLIGFILGSVIF*
Ga0098037_120523143300006737MarineRKRGIMIILGKTPKEWRKEIGSKSLYYRAEIVIFIIGFILGSIIF*
Ga0098037_124255623300006737MarineMIILGKTPKEWRKEIGLKSLYYRTEIIIFIIGFILGAIIF*
Ga0098042_105371823300006749MarineMIILGKTPKEWRKEIGSKSLYYRAEIVIFLIGFILGSIIF*
Ga0098048_105063353300006752MarineMIVYGNTPKEWRKEIGSKSLYYRAEIVIFLIGFILGSVIF*
Ga0075467_1026892453300006803AqueousMMIVLGKTPKEWRKEIGLKSLYYRAEIVIFLIGFILGSVIF*
Ga0070754_1022690013300006810AqueousMMIVLGKTPKEWRKEIGSKSLYYRAEIVIFLIGFILGSVIF*
Ga0070754_1047175833300006810AqueousMMIVLGKTPKEWRKEIGLKSLYYRTEIVIFLIGFILGSVIF*
Ga0070750_1024856143300006916AqueousVLGKTPKEWRKEIGSKSLYYRAEIVIFLIGFILGSVIF*
Ga0098045_103313843300006922MarineMILMGKTPKEWRKEIGSKSLYYRAEIVIFLIGFILGSIIF*
Ga0098041_114594823300006928MarineMILMGKTPKEWRKEIGSKSLYYRTEIVIFLIGFILGSVIF*
Ga0098036_118517913300006929MarineMIILGKTPKEWRKEIGSKSLYYRAEIVIFIIGFILGSVIF*
Ga0098036_118807113300006929MarineMIILGKTPKEWRKEIGLKSLYYRTEIIIFIIGFILGA
Ga0070752_120080233300007345AqueousMGKTPKEWRKEIGSKSLYYRAEIVIFLIGFILGSVIF*
Ga0070753_132043633300007346AqueousMGKTPKEWRKEIGSKSLYYRAEIVIFLIGFILGSIIF*
Ga0099847_119646713300007540AqueousKTPKEWRKEIGLKSLYYRTEIVIFLIGFILGSVIF*
Ga0070751_122333713300007640AqueousKTPKEWRKEIGLKSLYYRAEIVIFLIGFILGSVIF*
Ga0075480_1059862113300008012AqueousMMIVLGKTPKEWRKEIGLKSLYYRAEIVIFLIGFILGSIIF*
Ga0102963_103984433300009001Pond WaterMIILGKTPKEWRKEIGSKSLYYRTEIVIFLIGFILGSIIF*
Ga0115551_149535333300009193Pelagic MarineMGKTPKEWRKQIGSKSLYYRAEIVIFLIGFILGSVIF*
Ga0115548_111444423300009423Pelagic MarineMILMGKTPKEWRKEIGSKSIYYRAEIVIFLIGFILGSVIF*
Ga0115546_111377453300009435Pelagic MarineMGKTPKEWRNEIGLKSLYYRAEIVIFLIGFILGSIIF*
Ga0098049_106212843300010149MarineMIILGKTPKEWRKEIGSKSLYYRAEIVIFIIGFILGSIIF*
Ga0151675_100054093300011254MarineMIVLGKTPKEWRKEIGSKSLYYRVEIVIFLIGFILGSIIF*
Ga0181377_102796153300017706MarineMMIVLGKTPKEWRKEIGSKSLYYRAEIVIFLIGFILGSIIF
Ga0181369_110380613300017708MarineMIVLGKTPKEWRKEIGLKSLYYRAEIVIFLIGFILGSVIF
Ga0181387_114002213300017709SeawaterGPMIILGKTPKEWRKEIGLKSLYYRTEIIIFIIGFILGAIIF
Ga0181403_102719143300017710SeawaterMIILGKTPKEWRKEIGLKSLYYRTEIIIFIIGFILGSIIF
Ga0181391_102267053300017713SeawaterMIILGKTPKEWRKEIGLKSLYYRAEIIIFLIGFILGSVIF
Ga0181391_107758633300017713SeawaterMIILGKTPKEWRKEIGLKSLYYRTEIIIFIIGFILGAIIF
Ga0181391_113509743300017713SeawaterMIVYRKTPKEWRKEIVLKSLYYRAEIVIFLIGFIL
Ga0181412_105079423300017714SeawaterMIVLGKTPKQWRKEMGLKSLYYRTEIVIFLIGFILGSVIF
Ga0181404_115393213300017717SeawaterKEVMMIVLGKTPKEWRKEIGSKSLYYRSEIVIFLIGFILGSVIF
Ga0181383_102537833300017720SeawaterMILMGKTPKEWRKQIGLKSLYYRAEIVIFLIGFILGSVIF
Ga0181383_118639643300017720SeawaterMIILGRTPKEWRKEIGLKSLYYRTEIIIFIIGFILGAIIF
Ga0181419_102503353300017728SeawaterMIILGRTPKEWRKEIGLKSLYYRTEIIIFIIGFIL
Ga0181396_110912013300017729SeawaterVLGKTPKEWRKEIGLKSLYYRAEIVIFLIGFILGSVIF
Ga0181433_101091613300017739SeawaterMIILGKTPKEWRKEIGLKSLYYRTEIIIFIIGFILGAII
Ga0181421_106496213300017741SeawaterVLGKTPKEWRKEIGSKSLYYRAEIIIFLIGFILGSVIF
Ga0181397_119313033300017744SeawaterGAIGKTPKEWRKEIGSKSLYYRTEIVIFLIGFILGSVIF
Ga0181405_107164443300017750SeawaterMIVLGKTPKEWRKEIGSKSLYYRAEIVIFIIGFILGSIIF
Ga0181405_111490833300017750SeawaterFNKEVMMIVLGKTPKEWRKEIGLKSLYYRTEIVIFLIGFILGSVIF
Ga0181407_113847923300017753SeawaterMIILGKTPKEWRKEIGSKSLYYRAEIIIFLIGFILGSVIF
Ga0181411_102557813300017755SeawaterMIVLGKTPKEWRKEIGLKSLYYRVEIVIFLIGFILG
Ga0181411_113822633300017755SeawaterVLGKTPKEWRKEIGLKSLYYRTEIVIFLIGFILGSIIF
Ga0181382_103133943300017756SeawaterMILMGKTPKEWRKEIGSKSLYYRAEIVIFLIGFILGSIIF
Ga0181408_112744813300017760SeawaterMMIVLGKTPKEWRKEIGLKSLYYRTEIVIFLIGFILGSVIF
Ga0181410_120912613300017763SeawaterMMIVLGKTPKEWRKEIGSKSLYYRAEIVIFIIGFILGSVIF
Ga0181406_118465013300017767SeawaterDKTPKEWRKEIGLKSLYYRTEIIIFIIGFILGTIIF
Ga0187220_121931443300017768SeawaterKTPKEWRKEIGLKSLYYRTEIVIFLIGFILGSIIF
Ga0187217_108568943300017770SeawaterMIVLGKTPKEWRKEIGSKSLYYRAEIIIFLIGFILGSVIF
Ga0181386_101147853300017773SeawaterMIILGKTPKEWRKQIGLKSLYYRAEIVIFLIGFILGSVIF
Ga0181386_116799313300017773SeawaterIVLGKTPKEWRKEIGLKSLYYRTEIVIFLIGFILGSVIF
Ga0181394_106614753300017776SeawaterMIVLGKTPKEWRKEIGSKSLYYRAEIIIFLIGFILGSIIF
Ga0181394_124835133300017776SeawaterMMIVLGKTPKEWRKEIGSKSLYYRTEIVIFLIGFILGSVIF
Ga0181395_116664333300017779SeawaterVYGKTTKECRKEIGSKSLDYRAEILIFLIGFILGSIIF
Ga0181423_106627713300017781SeawaterGKTPKEWRKEIGLKSLYYRVEIVIFLIGFILGSIIF
Ga0181380_114353113300017782SeawaterMIVLGKTPKEWRKEIGLKSLYYRTEIVIFLIGFILGSIIF
Ga0181379_129378613300017783SeawaterLGKTPKQWRKEMGLKSLYYRTEIVIFLIGFILGSVIF
Ga0181379_132598213300017783SeawaterLGKTPKEWRKEIGLKSLYYRAEIVIFLIGFILGSIIF
Ga0181552_1040718223300017824Salt MarshMIILGKTPKEWRKEIGSKSLYYRTEIVIFLIGFILGSVIF
Ga0181607_1001960163300017950Salt MarshMMIILGKTPKEWRKEIGSKSLYYRTEIVIFLIGFILGSIIF
Ga0181600_1000982173300018036Salt MarshMIILGKTPKEWRKEIGSKSLYYRTEIVIFLIGFILGSIIF
Ga0181606_1003832363300018048Salt MarshMMIILGKTPKEWRKEIGSKSLYYRTEIVIFLIGFILGSVIF
Ga0211576_1036295623300020438MarineMIILDKTPKEWRKEIGLKSLYYRTEIIIFIIGFILGTIIF
Ga0213869_1000962423300021375SeawaterMIVLGKTPKEWRKEIGSKSLYYRAEIVIFLIGFILGSVIF
Ga0213869_1037892633300021375SeawaterMIVLGKTPKEWRKEIGIKSLYYRTEIVIFLIGFILGSVIF
Ga0222717_1056142033300021957Estuarine WaterMIILGKTPKEWRSEIGVKSLYYRTEIIIFVCGFILGSIIF
Ga0222716_1003512843300021959Estuarine WaterMIILGKTPKEWRKEIGIKSLYYRTEIVIFLIGFILGSVIF
Ga0222716_1060189723300021959Estuarine WaterMIILGKTPKEWRKEIGSKSLYYRAEIVIFLIGFILGSVIF
Ga0196901_119868723300022200AqueousMILMGKTPKEWRKEIGSKSLYYRAEIVIFLIGFILGSVIF
Ga0209992_1007116443300024344Deep SubsurfaceMLIIGKTPKEWRKEIGSKSLYYRAEIVIFLIGFILGSIIF
Ga0208667_102371443300025070MarineMIILGKTPKEWRKEIGSKSLYYRAEIVIFLIGFILGSIIF
Ga0208157_104487943300025086MarineMIVLGKTPKEWRKEIGSKSLYYRTEIVIFLIGFILGSVIF
Ga0208157_111862313300025086MarineMIILGKTPKEWRKEIGSKSLYYRAEIVIFIIGFILGSIIF
Ga0208666_112006913300025102MarineMILMGKTPKEWRKEIGLKSLYYRAEIVIFLIGFILGSVIF
Ga0209535_103319063300025120MarineMIVLGKTPKEWQKQIGLKSLYYRAEIVIFLIGFILGSIIF
Ga0209535_104653063300025120MarineMIVLGKTPKEWRKEIGSKSLYYRAEIVIFLIGFILGSIIF
Ga0209336_1016257923300025137MarineMIVLGKTPKEWRKEIGLKSLYYRVEIIIFLIGFILGSIIF
Ga0208148_101614673300025508AqueousMIVLGKTPKEWRKEISLKSLYYRAEIVIFLIGFILGSVIF
Ga0208303_104126553300025543AqueousMIVLEKTPKEWRKEIGLKSLYYRTEIVIFLIGFILGSVIF
Ga0209194_107075053300025632Pelagic MarineMILMGKTPKEWRNEIGLKSLYYRAEIVIFLIGFILGSIIF
Ga0208643_118317733300025645AqueousMIVLGKTPKEWRKEIGIKSLYYRAEIVIFLIGFILGSIIF
Ga0208134_102991213300025652AqueousMMIVLGKTPKEWRKEIGLKSLYYRAEIVIFLIGFILGSIIF
Ga0208134_103765353300025652AqueousMMIVLGKTPKEWRKEIGSKSLYYRAEIVIFLIGFILGSVIF
Ga0208134_104610533300025652AqueousMMIVLGKTPKEWRKEISLKSLYYRAEIVIFLIGFILGSVIF
Ga0208899_107029413300025759AqueousIIGKTPKEWRKEIGSKSLYYRAEIVIFLIGFILGSVIF
Ga0208899_107691853300025759AqueousNKEVMMIVLGKTPKEWRKEIGLKSLYYRAEIVIFLIGFILGSIIF
Ga0208767_124839433300025769AqueousMMIVLGKTPKEWRKEIGLKSLYYRAEIVIFLIGFILGSVIF
Ga0209193_110317623300025816Pelagic MarineMILMGKTPKEWRKEIGSKSIYYRAEIVIFLIGFILGSVIF
Ga0209308_1009449523300025869Pelagic MarineMILMGKTPKEWRKEIGLKSSRILLTLQEVSLYYRAEIVIFLIGFILGSVIF
Ga0208644_137470513300025889AqueousMIILGKTPKEWRKEIGSKSLYYRTEIVIFLIGFILG
Ga0265303_1157708313300028600SedimentMILMGKTPKEWRKEIGSKSSRILLTLQEVSLYYRAEIVIFLIGFILGSIIF
Ga0183683_100301093300029309MarineMILMGKTPKEWRKEIGIKSLYYRHEIQWFLIGLLLGAIIF
Ga0183683_101228153300029309MarineMGKTPKEWRKEIGIKSLYYRTEIVIFLIGFILGSVIF
Ga0183757_101970763300029787MarineMILMGKTPKEWRKEIGSKSLYYRAEIVIFIIGFILGSVIF
Ga0315320_1020369513300031851SeawaterMIVLGKTPKEWRKEIGLKSLYYRAEIVIFLIGFILG
Ga0316205_1020525413300032257Microbial MatGKTPKEWRKEIGSKSLYYRAEIVIFLIGFILGSVIF
Ga0316202_1015102713300032277Microbial MatMIVLGKTPKEWRKEIGLKSLYYRTEIVIFLIGFILGSVIF
Ga0316202_1030655553300032277Microbial MatVLGKTPKEWRKEIGLKSLYYRAEIVIFLIGFILGSIIF
Ga0316202_1040455423300032277Microbial MatKEVMMIVLGKTPKEWRKEIGLKSLYYRAEIVIFLIGFILGSVIF

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.