Basic Information | |
---|---|
Family ID | F065864 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 127 |
Average Sequence Length | 40 residues |
Representative Sequence | FGLNPSYNGGYYTPEIRDLFLSRGADVERERIFFGNGLRF |
Number of Associated Samples | 111 |
Number of Associated Scaffolds | 127 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 2.38 % |
% of genes near scaffold ends (potentially truncated) | 96.85 % |
% of genes from short scaffolds (< 2000 bps) | 92.13 % |
Associated GOLD sequencing projects | 104 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.35 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (97.638 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (12.598 % of family members) |
Environment Ontology (ENVO) | Unclassified (26.772 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.969 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 13.24% β-sheet: 11.76% Coil/Unstructured: 75.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 127 Family Scaffolds |
---|---|---|
PF08281 | Sigma70_r4_2 | 13.39 |
PF07715 | Plug | 4.72 |
PF13801 | Metal_resist | 2.36 |
PF01739 | CheR | 2.36 |
PF07043 | DUF1328 | 1.57 |
PF01019 | G_glu_transpept | 1.57 |
PF08241 | Methyltransf_11 | 0.79 |
PF05694 | SBP56 | 0.79 |
PF00370 | FGGY_N | 0.79 |
PF10609 | ParA | 0.79 |
PF13649 | Methyltransf_25 | 0.79 |
COG ID | Name | Functional Category | % Frequency in 127 Family Scaffolds |
---|---|---|---|
COG1352 | Methylase of chemotaxis methyl-accepting proteins | Signal transduction mechanisms [T] | 4.72 |
COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 2.36 |
COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 1.57 |
COG5487 | Uncharacterized membrane protein YtjA, UPF0391 family | Function unknown [S] | 1.57 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 97.64 % |
Unclassified | root | N/A | 2.36 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2166559005|cont_contig94377 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
2170459005|F1BAP7Q01DTJG1 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 520 | Open in IMG/M |
3300000955|JGI1027J12803_101029780 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
3300004156|Ga0062589_102082040 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300004643|Ga0062591_102243834 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 569 | Open in IMG/M |
3300005171|Ga0066677_10149421 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1279 | Open in IMG/M |
3300005175|Ga0066673_10672528 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
3300005186|Ga0066676_10098797 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1767 | Open in IMG/M |
3300005290|Ga0065712_10436400 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 698 | Open in IMG/M |
3300005332|Ga0066388_103585716 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
3300005335|Ga0070666_10246308 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1265 | Open in IMG/M |
3300005340|Ga0070689_102215047 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300005435|Ga0070714_101971130 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 570 | Open in IMG/M |
3300005439|Ga0070711_100258671 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1368 | Open in IMG/M |
3300005446|Ga0066686_10392472 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
3300005468|Ga0070707_100884580 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 857 | Open in IMG/M |
3300005540|Ga0066697_10093621 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1745 | Open in IMG/M |
3300005553|Ga0066695_10491830 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
3300005554|Ga0066661_10673376 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 609 | Open in IMG/M |
3300005560|Ga0066670_10209702 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1172 | Open in IMG/M |
3300005569|Ga0066705_10445221 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
3300005587|Ga0066654_10873596 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300005764|Ga0066903_102122041 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
3300005764|Ga0066903_108834923 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300006237|Ga0097621_102199520 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300006800|Ga0066660_10212132 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales | 1486 | Open in IMG/M |
3300009012|Ga0066710_102115892 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 826 | Open in IMG/M |
3300009012|Ga0066710_104536291 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 519 | Open in IMG/M |
3300009038|Ga0099829_11746291 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 510 | Open in IMG/M |
3300009101|Ga0105247_10621762 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
3300009137|Ga0066709_100450246 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1800 | Open in IMG/M |
3300009137|Ga0066709_102283651 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
3300009137|Ga0066709_104647503 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 502 | Open in IMG/M |
3300010046|Ga0126384_11628061 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300010047|Ga0126382_10477665 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
3300010048|Ga0126373_12915047 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300010159|Ga0099796_10322619 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
3300010320|Ga0134109_10319356 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
3300010322|Ga0134084_10088078 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 974 | Open in IMG/M |
3300010323|Ga0134086_10308835 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 616 | Open in IMG/M |
3300010325|Ga0134064_10119701 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 884 | Open in IMG/M |
3300010326|Ga0134065_10352304 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 578 | Open in IMG/M |
3300010333|Ga0134080_10305131 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 715 | Open in IMG/M |
3300010361|Ga0126378_11354354 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 805 | Open in IMG/M |
3300010362|Ga0126377_10579323 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1164 | Open in IMG/M |
3300010371|Ga0134125_13027765 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 509 | Open in IMG/M |
3300010376|Ga0126381_101144775 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1124 | Open in IMG/M |
3300010396|Ga0134126_10496877 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1406 | Open in IMG/M |
3300010397|Ga0134124_11026288 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
3300010398|Ga0126383_13488422 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300012198|Ga0137364_10695663 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 767 | Open in IMG/M |
3300012198|Ga0137364_11288785 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300012199|Ga0137383_10087580 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 2254 | Open in IMG/M |
3300012203|Ga0137399_11185642 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 643 | Open in IMG/M |
3300012210|Ga0137378_10239183 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1691 | Open in IMG/M |
3300012285|Ga0137370_10299317 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter | 960 | Open in IMG/M |
3300012358|Ga0137368_10671044 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
3300012582|Ga0137358_10284438 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1123 | Open in IMG/M |
3300012930|Ga0137407_10153956 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 2033 | Open in IMG/M |
3300012937|Ga0162653_100029636 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter | 782 | Open in IMG/M |
3300012948|Ga0126375_11563148 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300012960|Ga0164301_10710811 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 757 | Open in IMG/M |
3300012961|Ga0164302_10205831 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1214 | Open in IMG/M |
3300012971|Ga0126369_10095443 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 2677 | Open in IMG/M |
3300012971|Ga0126369_13308803 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300012972|Ga0134077_10288710 | Not Available | 686 | Open in IMG/M |
3300012977|Ga0134087_10707429 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300013307|Ga0157372_10699772 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1179 | Open in IMG/M |
3300015261|Ga0182006_1174894 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 718 | Open in IMG/M |
3300015373|Ga0132257_103821547 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300015374|Ga0132255_100998895 | All Organisms → cellular organisms → Bacteria | 1255 | Open in IMG/M |
3300016294|Ga0182041_11957299 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300017654|Ga0134069_1212014 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
3300017659|Ga0134083_10031925 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1925 | Open in IMG/M |
3300018027|Ga0184605_10514705 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 519 | Open in IMG/M |
3300018433|Ga0066667_11556875 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
3300018482|Ga0066669_10189227 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1563 | Open in IMG/M |
3300019361|Ga0173482_10178258 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 852 | Open in IMG/M |
3300019999|Ga0193718_1054167 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 871 | Open in IMG/M |
3300020006|Ga0193735_1012348 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2688 | Open in IMG/M |
3300020006|Ga0193735_1173092 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
3300020018|Ga0193721_1157474 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 542 | Open in IMG/M |
3300021086|Ga0179596_10437278 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
3300021171|Ga0210405_10095706 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2343 | Open in IMG/M |
3300024254|Ga0247661_1058622 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
3300025898|Ga0207692_10886357 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300025922|Ga0207646_11411954 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
3300025926|Ga0207659_10227492 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1503 | Open in IMG/M |
3300025928|Ga0207700_12034528 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300025939|Ga0207665_10417450 | All Organisms → cellular organisms → Bacteria | 1024 | Open in IMG/M |
3300025945|Ga0207679_11460488 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
3300025972|Ga0207668_10243901 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1455 | Open in IMG/M |
3300026095|Ga0207676_12508782 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300026296|Ga0209235_1084257 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1410 | Open in IMG/M |
3300026309|Ga0209055_1243402 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300026333|Ga0209158_1250155 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 607 | Open in IMG/M |
3300026334|Ga0209377_1178756 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
3300026335|Ga0209804_1262555 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 623 | Open in IMG/M |
3300026342|Ga0209057_1161396 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 676 | Open in IMG/M |
3300026538|Ga0209056_10006910 | All Organisms → cellular organisms → Bacteria | 11699 | Open in IMG/M |
3300026557|Ga0179587_10858542 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 598 | Open in IMG/M |
3300027846|Ga0209180_10810762 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 500 | Open in IMG/M |
3300027873|Ga0209814_10142498 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1027 | Open in IMG/M |
3300028381|Ga0268264_12362929 | Not Available | 538 | Open in IMG/M |
3300028778|Ga0307288_10098678 | All Organisms → cellular organisms → Bacteria | 1062 | Open in IMG/M |
3300030844|Ga0075377_10008562 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
3300030916|Ga0075386_10034257 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300031128|Ga0170823_10379466 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 643 | Open in IMG/M |
3300031231|Ga0170824_101574015 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 520 | Open in IMG/M |
3300031231|Ga0170824_101826717 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 520 | Open in IMG/M |
3300031231|Ga0170824_107987503 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
3300031231|Ga0170824_113583320 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 878 | Open in IMG/M |
3300031231|Ga0170824_115549691 | All Organisms → cellular organisms → Bacteria | 3641 | Open in IMG/M |
3300031231|Ga0170824_128425945 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 863 | Open in IMG/M |
3300031446|Ga0170820_10179069 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300031474|Ga0170818_111166973 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
3300031474|Ga0170818_112059251 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 935 | Open in IMG/M |
3300031740|Ga0307468_100516106 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
3300031740|Ga0307468_101572432 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
3300031820|Ga0307473_10171110 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1260 | Open in IMG/M |
3300031910|Ga0306923_10218097 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2182 | Open in IMG/M |
3300031910|Ga0306923_12296762 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
3300031942|Ga0310916_10124456 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2102 | Open in IMG/M |
3300031954|Ga0306926_12469096 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 571 | Open in IMG/M |
3300032001|Ga0306922_12217168 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300033412|Ga0310810_11044644 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 690 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 12.60% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.02% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 8.66% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.87% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 7.87% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.09% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 6.30% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.72% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.94% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.36% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.36% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.36% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.57% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.57% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.57% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.57% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.57% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.79% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.79% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.79% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.79% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.79% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.79% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.79% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.79% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.79% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.79% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.79% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.79% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.79% |
Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.79% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012937 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t5i015 | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
3300019999 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a1 | Environmental | Open in IMG/M |
3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300024254 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02 | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
3300030844 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA11 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030916 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
cont_0377.00006060 | 2166559005 | Simulated | FGLNPSYNGGYYTPEIRDLFLSRGADVERERIFLETGCASDL |
E41_05650640 | 2170459005 | Grass Soil | LNPLYSGDYYTPELRDLFISRGADVERERIFFENGLRF |
JGI1027J12803_1010297801 | 3300000955 | Soil | YDGGYYTPEIRDLFLSRGAEVERERIFFENGVRF* |
Ga0062589_1020820402 | 3300004156 | Soil | FGLNPSYNGGYYTPEIRDLFISRGAAVERERIFFENGVRF* |
Ga0062591_1022438342 | 3300004643 | Soil | GLNPLYSGDYYTPELRDLFISRGADVERERILFQNGVRF* |
Ga0066677_101494211 | 3300005171 | Soil | GLNPTFGGNYYTPELRDFFLRRGADVERERIFFERGAHF* |
Ga0066673_106725282 | 3300005175 | Soil | FGLNPTFGGHYHTSELRKFFIDRGANVEREQIFFDKGLRF* |
Ga0066676_100987971 | 3300005186 | Soil | GGKIFFGLNPLYSGDYYTPELRDLFISRGADVERERIFFENGLRF* |
Ga0065712_104364001 | 3300005290 | Miscanthus Rhizosphere | KIFFGLNPLYNGDYYTPELRDLFISRGADVERERIFFENGLRF* |
Ga0066388_1035857163 | 3300005332 | Tropical Forest Soil | LAPGGKIFFGLNPSYNGGYYTPEIRGLFFSRGADIERERIFFENGVRM* |
Ga0070666_102463084 | 3300005335 | Switchgrass Rhizosphere | LAPGGKIFFGLNPSYNGGYYTPEIRDLFVSRGADVERERIFFENGLRF* |
Ga0070689_1022150472 | 3300005340 | Switchgrass Rhizosphere | GGKIFFGLNPLYSGDYYTPELRDLFIGRGADVERERIFFEQGVRF* |
Ga0070714_1019711301 | 3300005435 | Agricultural Soil | GKIFFGLNPSYNGGYYTPEIRDLFVSRGADVERERIFFENGVRL* |
Ga0070711_1002586714 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | FGLNPSYNGGYYTPEIRDLFLSRGADVERERIFFGNGLRF* |
Ga0066686_103924722 | 3300005446 | Soil | GGRMFFGLNPTFGGNYYTPELHGFFLRRGADVERERIFFESGVRF* |
Ga0070707_1008845801 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | APGGKVFFGLNPLYNGDYYTPELHHLFVSRGANVERERIFFENGLRF* |
Ga0066697_100936211 | 3300005540 | Soil | YNGDYYTPEIRDLFLSRGADVERERILFENGLRL* |
Ga0066695_104918301 | 3300005553 | Soil | FGLNPTFGGHYYTPELHDLFLKRGADVERERIFFGKGLRF* |
Ga0066661_106733763 | 3300005554 | Soil | PQYDGDYYTAEVRDLFLSRGANVERERITFENGLRF* |
Ga0066670_102097021 | 3300005560 | Soil | GKIFFGLNPLYSGDYYTPELRDLFISRGADVERERIFFENGVRF* |
Ga0066705_104452211 | 3300005569 | Soil | GLNPLYNGDYYTPELRDLFVSRGANVERERILFQNGLRF* |
Ga0066654_108735961 | 3300005587 | Soil | NPTFGGHYHTSELRKFFIDRGANVEREQIFFDKGLRF* |
Ga0066903_1021220411 | 3300005764 | Tropical Forest Soil | NPSYDGDYYTPEIRDLFLSRGAEVERERILFQKGLAF* |
Ga0066903_1088349232 | 3300005764 | Tropical Forest Soil | FGLNPSYNGGYYTPEIRDLFLSRGADVERERIFFENGIRI* |
Ga0097621_1021995201 | 3300006237 | Miscanthus Rhizosphere | YNGGYYTPEIRDLFLKRGAYVERERIFFENGLRF* |
Ga0066660_102121321 | 3300006800 | Soil | PLYSGDYYTSELHDLFISRGADVERERIFFENGVRF* |
Ga0066710_1021158921 | 3300009012 | Grasslands Soil | LNPLYDGDYYTPELRDLFLSRGANIERERIFFEKGLRF |
Ga0066710_1045362911 | 3300009012 | Grasslands Soil | LNPLFDGDYYTPELRDFFLSRGANVERERIFFKNGLLL |
Ga0099829_117462912 | 3300009038 | Vadose Zone Soil | PLYAGDYYTPELHDFFLSRGAKVERERIFFDKGLRF* |
Ga0105247_106217621 | 3300009101 | Switchgrass Rhizosphere | KIFFGLNPSYNGGYYTPEIRDLFLNRGADVERERIFFENGVRF* |
Ga0066709_1004502461 | 3300009137 | Grasslands Soil | GIIFFWLNPLSNGHYYTPELRDFFLSHGANVERERIFFENGLRF* |
Ga0066709_1022836513 | 3300009137 | Grasslands Soil | GLNPSYNGGFYTPEIRDLFLSRGADVERERIFFHNGLRF* |
Ga0066709_1046475031 | 3300009137 | Grasslands Soil | GLNPLYAGDYYTPELHDFFLSRGANVERERIFFDKGLRF* |
Ga0126384_116280612 | 3300010046 | Tropical Forest Soil | GKIFFGLNPSYNGGYYTPEIRDLFISRGADVERERIFFENGLRF* |
Ga0126382_104776651 | 3300010047 | Tropical Forest Soil | IFFGLNPSYNGGYYTPEIRGLFFRCGADIERERIFFENGVRM* |
Ga0126373_129150471 | 3300010048 | Tropical Forest Soil | GKIFFGLNPSYNGGYYTPEIRGLFFSRGADIERERIFFENGVRM* |
Ga0099796_103226192 | 3300010159 | Vadose Zone Soil | QHQLAPGGKIFFGLNPSYNGGYYTPEIRDLFLNRGADVERERIFFENGVRF* |
Ga0134109_103193562 | 3300010320 | Grasslands Soil | LYDGDYYSPELRDLFLSRGASVERERIFFERGLRF* |
Ga0134084_100880781 | 3300010322 | Grasslands Soil | KIFFGLNPQYDGDYYTSELRDLFLSRGASIERERIFFEKGLRF* |
Ga0134086_103088351 | 3300010323 | Grasslands Soil | NPLYAGDYYTPELRDLFLNRGANVERERIFFESGLRF* |
Ga0134064_101197013 | 3300010325 | Grasslands Soil | GLNPTFGRDYYIPELRDLFVSRGAKVEREQIFFNKGLRF* |
Ga0134065_103523042 | 3300010326 | Grasslands Soil | MFFGLNPSFGGNYYTPELRDFFSRRGADVERARIFF |
Ga0134080_103051312 | 3300010333 | Grasslands Soil | PQYDGDFYTPELHDFFLSQGASIERERIFFEKGLRF* |
Ga0126378_113543542 | 3300010361 | Tropical Forest Soil | VFFGLNPLYNGDYYSPELRSLFISRGANVERERIFFEKGLRF* |
Ga0126377_105793234 | 3300010362 | Tropical Forest Soil | DGKVFFGLNPLYDGDYYTPELRDLFIRRGAHVERERIFFENGLRF* |
Ga0134125_130277652 | 3300010371 | Terrestrial Soil | NPSYNGGYYTSEIRDLFLSRGADVERERIFFESGLRG* |
Ga0126381_1011447751 | 3300010376 | Tropical Forest Soil | IFFALNPHDYNAPELHDFFVSRGANVERERIFFENGLKRAVVSSVLR* |
Ga0134126_104968771 | 3300010396 | Terrestrial Soil | IFFGLNPSYNGGYYTPEIRDLFLSLGADVERERILFENGLRF* |
Ga0134124_110262881 | 3300010397 | Terrestrial Soil | LNPSYNGGYYTPEIRDLFLNRGADVERERIFFENGVRF* |
Ga0126383_134884222 | 3300010398 | Tropical Forest Soil | GGKIFFGLNPSYNGGYYTPEIRDLFLRRGAHVERERIFFENGVHI* |
Ga0137364_106956631 | 3300012198 | Vadose Zone Soil | LAPGGKIFFALNPHDYDAPELRDFFISRGANVERERIFFENGLRF* |
Ga0137364_112887852 | 3300012198 | Vadose Zone Soil | NPSYNGDYYTPEIRDLFLSRGADVERERILFEKGLGF* |
Ga0137383_100875801 | 3300012199 | Vadose Zone Soil | FFGLNPAYNGDYYTSELRDLFLKRGASVERERIFFKNGLRF* |
Ga0137399_111856421 | 3300012203 | Vadose Zone Soil | GKIFFGLNPLYNGDYYTPELRDFFLSHGANVERERIFFENGLRF* |
Ga0137378_102391831 | 3300012210 | Vadose Zone Soil | FFGLNPLYDGDYYSPELRDLFLSRGASVERERIFFEGGLRF* |
Ga0137370_102993171 | 3300012285 | Vadose Zone Soil | IFFGLNPSYNGGYYTPEIRDLFLRRGADVERERIFFENGVRF* |
Ga0137368_106710443 | 3300012358 | Vadose Zone Soil | PGGKIFFGLNPLYSGDYYTPELRDLFISRGANVERERIFFENGVRF* |
Ga0137358_102844382 | 3300012582 | Vadose Zone Soil | MFFGLNPSFGGNYYTPELRDFFLRRGADVERARIFFDRGVRF* |
Ga0137407_101539565 | 3300012930 | Vadose Zone Soil | YNGGFYTPEIRDLFLSRGADVERERIFFHNGLRL* |
Ga0162653_1000296361 | 3300012937 | Soil | NPSYNGGYYTPEIRDLFLSRGADVERERIFFGNGLRF* |
Ga0126375_115631481 | 3300012948 | Tropical Forest Soil | SYNGGYYTPEIRDLFLSRGADVERERILFEKGLGF* |
Ga0164301_107108111 | 3300012960 | Soil | LNPSYNGGYYTPEIRDLFLSRGADVDRERIFFENGVRF* |
Ga0164302_102058311 | 3300012961 | Soil | SYNGGYYTPEIRDLFLKRGADVERERIFFENGLRF* |
Ga0126369_100954431 | 3300012971 | Tropical Forest Soil | KIFFGLNPLYDGDYYTSELRDLFISRGAHVERERIFFENGVRF* |
Ga0126369_133088031 | 3300012971 | Tropical Forest Soil | PSGKIFFGLNPSYNGGYYTPEIRDLFISRGADVERERIFFENGLRF* |
Ga0134077_102887102 | 3300012972 | Grasslands Soil | LYAGDDYTRELDDFFLSRGGNVERERNFFDKGLRF* |
Ga0134087_107074292 | 3300012977 | Grasslands Soil | PSYDGGYYTPEIRKLFLIRGADVERERIFFKNGLRF* |
Ga0157372_106997724 | 3300013307 | Corn Rhizosphere | NPSYNGGYYTPEIRDLFLKRGAYVERERIFFENGLRF* |
Ga0182006_11748943 | 3300015261 | Rhizosphere | SYDGGYYTPEIRDLFLSRGADVERERIFFENGLRF* |
Ga0132257_1038215471 | 3300015373 | Arabidopsis Rhizosphere | NPSYNGGYYTPEIRELFLSRGADVERERIFFESGLRF* |
Ga0132255_1009988951 | 3300015374 | Arabidopsis Rhizosphere | PSYNGGYYTPEIRGLFLSRGADIERERIFFENGLRF* |
Ga0182041_119572991 | 3300016294 | Soil | IFFGLNPSYNGDYYTSEIRDLFLIRGANVERERILFEKGLGF |
Ga0134069_12120142 | 3300017654 | Grasslands Soil | IFFGLNPLYNGGYHTPEIRDLFLSRGADVERERIFFENGVRL |
Ga0134083_100319251 | 3300017659 | Grasslands Soil | NPLPNGDYLSPELRQFFYSRGADVERERIFFANGVKK |
Ga0184605_105147051 | 3300018027 | Groundwater Sediment | LNPTFGGNYYTPELRDFFLRRGADIECERIFFDQGVRF |
Ga0066667_115568751 | 3300018433 | Grasslands Soil | SGKIFFGLNPNYEGDYYTPELRELFISRGADVERERIFFRNGPRF |
Ga0066669_101892271 | 3300018482 | Grasslands Soil | GKIFFGLNPLYSGEYYTPELRDLFVSRGADVERERILFENGVRF |
Ga0173482_101782581 | 3300019361 | Soil | PGGKIFFGLNPLYGGDYYTPGLRDLFISRGADVERERIFFENGLRF |
Ga0193718_10541673 | 3300019999 | Soil | GLNPTFGRDYYIPELRDLFVDRGAKIERERIFFDKGLRF |
Ga0193735_10123483 | 3300020006 | Soil | PGGKIFFALNPHDYDAPELRDFFISRGANVERERIFFENGLRF |
Ga0193735_11730921 | 3300020006 | Soil | QHLIPGGKIFFGLNPLHDGDYYTPELRDLFVSGGANVERERIFFEKGLRF |
Ga0193721_11574741 | 3300020018 | Soil | GGKIFFGLNPLYSGDYYTPELRDLFIGRGADVERERILFENGLRF |
Ga0179596_104372781 | 3300021086 | Vadose Zone Soil | NPSYNGGFYTPEIRDLFLSRGADVERERIFFHNGLRF |
Ga0210405_100957062 | 3300021171 | Soil | GLNPTFGDDYYTSELRDFFLRRGADVERERIFFERGAHF |
Ga0247661_10586223 | 3300024254 | Soil | SYDGGYYTPEIRDLFLSRGADVERERIFFENGVRF |
Ga0207692_108863572 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | KIFFGLNPSYNGGYYTPEIRDLFLNRGADVERERIFFENGVRL |
Ga0207646_114119542 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | FFGLNPLYNGDYYTPELHHLFVSRGANVERERIFFENGLRF |
Ga0207659_102274921 | 3300025926 | Miscanthus Rhizosphere | KIFFGLNPSYNGGYYTPEIRDLFLKRGAYVERERIFFENGLRF |
Ga0207700_120345282 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | SYNGGYYTPEIRDLFLNRGADVERERIFFENGVRL |
Ga0207665_104174501 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | SYHGGYYTPEIRDLFLSRGADVERERIFFENGVRF |
Ga0207679_114604882 | 3300025945 | Corn Rhizosphere | PGGKIFFGLNPSYNGDYYTPEIRDLFLSRGGQVERERILFENGVHF |
Ga0207668_102439011 | 3300025972 | Switchgrass Rhizosphere | GGKVFFGLNPSYNGGYYTPEIRDLFLNRGADVERERIFFENGVRF |
Ga0207676_125087821 | 3300026095 | Switchgrass Rhizosphere | NPSYDGGYYTPEIRDLFLSRGADVERERIFFENGVRF |
Ga0209235_10842572 | 3300026296 | Grasslands Soil | IFFGLNPLYGGDYYTPELRDLFLDRGAKVERERIFFDKGLRF |
Ga0209055_12434021 | 3300026309 | Soil | GLNPLYNGGYYTPEIRDLFLRRGAEVERERIFFQNGLRF |
Ga0209158_12501551 | 3300026333 | Soil | NPTFGGNYYTPELCDFFLRRGADVERERIFFKGGAHF |
Ga0209377_11787561 | 3300026334 | Soil | FFGLNPLYNGGYHTPEIRDLFLSRGADVERERIFFENGVRL |
Ga0209804_12625551 | 3300026335 | Soil | LNPTFGGNYYTPELCDFFLRRGADVERERIFFKGGAHF |
Ga0209057_11613961 | 3300026342 | Soil | LNPQYDGDFYTPELRDLFLSRGASIERERIFFEKGLRF |
Ga0209056_100069106 | 3300026538 | Soil | NPTFGGDYYTPELCDFFLRRGADVERERIFFERGAHF |
Ga0179587_108585421 | 3300026557 | Vadose Zone Soil | PGGKIFFGLNPLYSGDYYTPELRDLFISRGADVERERIFFENGLRF |
Ga0209180_108107622 | 3300027846 | Vadose Zone Soil | PLYAGDYYTPELHDFFLSRGAKVERERIFFDKGLRF |
Ga0209814_101424981 | 3300027873 | Populus Rhizosphere | LNPLYSGDYYTPELRDLFVSRGASVERERIFFENWVRF |
Ga0268264_123629291 | 3300028381 | Switchgrass Rhizosphere | NPEGRGGQYYNEELRKYFVRRGAQIERERIFFRKGLR |
Ga0307288_100986784 | 3300028778 | Soil | PSYNGGYYTPEIRDLFLSRGADVERERIFFGNGLRF |
Ga0075377_100085621 | 3300030844 | Soil | PSYNGGYYTPEIRDLFLSRGADVERERIFFENGVRL |
Ga0075386_100342572 | 3300030916 | Soil | FFGLNPSYNGGYYTPEIRDLFLSCGADVERERIFFENGLRF |
Ga0170823_103794663 | 3300031128 | Forest Soil | LNPSFGGNYYSPELRDFFLRRGADVERARIFFDRGVRF |
Ga0170824_1015740151 | 3300031231 | Forest Soil | PAGKIFFGLNPSFGGNYYSPELRDFFLRRGADVERARIFFDRGVRF |
Ga0170824_1018267171 | 3300031231 | Forest Soil | GLNPLYSGDYYTPELRDLFISRGADVERERISFENGVRF |
Ga0170824_1079875033 | 3300031231 | Forest Soil | NPSYNGGYYTPEIRDLFLSHGADVERERIFFENGVRF |
Ga0170824_1135833201 | 3300031231 | Forest Soil | PLYSGDYYTPELRDLFISRGADVERERIFFENGLRF |
Ga0170824_1155496911 | 3300031231 | Forest Soil | LYSGDYYTPELRDLFISRGADVERERISFENGVRF |
Ga0170824_1284259451 | 3300031231 | Forest Soil | PGGKIFFGLNPLYSGDYYTPELRDLFISRGADVERERILFENGVRF |
Ga0170820_101790691 | 3300031446 | Forest Soil | PSYNGGYYTPEIRDLFLSRGANVERERIFFENGVRF |
Ga0170818_1111669731 | 3300031474 | Forest Soil | GKIFFGLNPSFGGNYYSPELRDFFLRRGADVERARIFFDRGVRF |
Ga0170818_1115852442 | 3300031474 | Forest Soil | LLRDLQRHLAPAGKIFFGLNPSFGGNYYSPELRDFFLRRGADVERARIFFDRGVRF |
Ga0170818_1120592513 | 3300031474 | Forest Soil | FGLNPLYSGDYYTPELRDLFISRGADVERERIFFENGLRF |
Ga0307468_1005161061 | 3300031740 | Hardwood Forest Soil | RPGGKLFFGLNPSSGGEYYTPELGDFFVSRGAHVERERIFFDKGLRF |
Ga0307468_1015724323 | 3300031740 | Hardwood Forest Soil | LNPTFGGNYYTPELRDFFLRRGADIESERIFFDQGVRF |
Ga0307473_101711101 | 3300031820 | Hardwood Forest Soil | KIFFGLNPLYSGDYYTPELRDLFINRGADVERERILFENGVRF |
Ga0306923_102180971 | 3300031910 | Soil | LAPGGKIFFGLNPSYNGGYYTPDIRDLFFSRGADVERERIFFENGVRL |
Ga0306923_122967621 | 3300031910 | Soil | PSYNGGYYTPEIRGLFLSRGADVERERIFFENGVRM |
Ga0310916_101244565 | 3300031942 | Soil | NPLYNGGYYTPEIRDLFLSRGAEVERERIFFKTGVRF |
Ga0306926_124690961 | 3300031954 | Soil | LNPLYDGGYYTPAIRDLFLSRGADVERERILFEKGLRF |
Ga0306922_122171682 | 3300032001 | Soil | GKIFFGLNPSYNGDYYTPEIRDLFLNRGADVERERILFDKGFRF |
Ga0310810_110446441 | 3300033412 | Soil | PLYNGDYYTPELRDLFISRGADVERERILFENGVQF |
⦗Top⦘ |