Metagenome / Metatranscriptome Family F065965

Basic Information
Family ID	F065965
Family Type	Metagenome / Metatranscriptome
Number of Sequences	127
Average Sequence Length	41 residues
Representative Sequence	MSQNVYLRITAEGRLFGLNSGDWTMLVGGFALVALVVLLL
Number of Associated Samples	99
Number of Associated Scaffolds	127

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	62.20 %
% of genes near scaffold ends (potentially truncated)	33.86 %
% of genes from short scaffolds (< 2000 bps)	81.89 %
Associated GOLD sequencing projects	93
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.45

Most Common Taxonomy
Group	Unclassified (55.118 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (19.685 % of family members)
Environment Ontology (ENVO)	Unclassified (43.307 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (62.205 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 42.65% β-sheet: 2.94% Coil/Unstructured: 54.41%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 127 Family Scaffolds
PF00425	Chorismate_bind	13.39
PF04715	Anth_synt_I_N	4.72
PF03466	LysR_substrate	3.94
PF01321	Creatinase_N	2.36
PF00496	SBP_bac_5	1.57
PF13624	SurA_N_3	1.57
PF08811	DUF1800	0.79
PF04392	ABC_sub_bind	0.79
PF05378	Hydant_A_N	0.79
PF13379	NMT1_2	0.79
PF13592	HTH_33	0.79
PF02538	Hydantoinase_B	0.79
PF00175	NAD_binding_1	0.79
PF04055	Radical_SAM	0.79
PF03776	MinE	0.79
PF01757	Acyl_transf_3	0.79
PF04355	SmpA_OmlA	0.79
PF08874	DUF1835	0.79
PF04892	VanZ	0.79

COG ID	Name	Functional Category	% Frequency in 127 Family Scaffolds
COG0147	Anthranilate/para-aminobenzoate synthases component I	Amino acid transport and metabolism [E]	9.45
COG0006	Xaa-Pro aminopeptidase	Amino acid transport and metabolism [E]	2.36
COG0145	N-methylhydantoinase A/oxoprolinase/acetone carboxylase, beta subunit	Amino acid transport and metabolism [E]	1.57
COG0146	N-methylhydantoinase B/oxoprolinase/acetone carboxylase, alpha subunit	Amino acid transport and metabolism [E]	1.57
COG0851	Septum formation topological specificity factor MinE	Cell cycle control, cell division, chromosome partitioning [D]	0.79
COG2913	Outer membrane protein assembly factor BamE, lipoprotein component of the BamABCDE complex	Cell wall/membrane/envelope biogenesis [M]	0.79
COG2984	ABC-type uncharacterized transport system, periplasmic component	General function prediction only [R]	0.79
COG5267	Uncharacterized conserved protein, DUF1800 family	Function unknown [S]	0.79

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.12 %
All Organisms	root	All Organisms	44.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.12 %
cellular organisms	root	All Organisms → cellular organisms	44.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.12 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	44.88 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.12 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	37.80 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	2.36 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.12 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	35.43 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2.36 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	0.79 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.79 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.12 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	12.60 %
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	10.24 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	2.36 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.79 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.79 %
Rhodobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales	0.79 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.12 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	10.24 %
Streptomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales	2.36 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1.57 %
Hyphomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	1.57 %
Beijerinckiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae	0.79 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.79 %
unclassified Deltaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria	0.79 %
Rhodobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae	0.79 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.79 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.12 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	10.24 %
Streptomycetaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae	2.36 %
Rhodoplanes	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes	1.57 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.79 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.79 %
Rhizobium/Agrobacterium group	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group	0.79 %
Rhodovulum	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum	0.79 %
Methylocella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocella	0.79 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.79 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.12 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	10.24 %
Streptomyces	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces	2.36 %
Methylocella tundrae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocella → Methylocella tundrae	0.79 %
Bradyrhizobium symbiodeficiens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium symbiodeficiens	0.79 %
unclassified Rhodoplanes	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes	0.79 %
unclassified Rhodovulum	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum	0.79 %
Rhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium	0.79 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.79 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.79 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.12 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	10.24 %
Streptomyces violaceusniger group	species group	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces violaceusniger group	2.36 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.79 %
Rhodovulum sp. PH10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	0.79 %
Methylocella tundrae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocella → Methylocella tundrae	0.79 %
Bradyrhizobium symbiodeficiens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium symbiodeficiens	0.79 %
Rhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium	0.79 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.79 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.79 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	55.12 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	10.24 %
Streptomyces malaysiensis	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces violaceusniger group → Streptomyces malaysiensis	2.36 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.79 %
Rhodovulum sp. PH10	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	0.79 %
Methylocella tundrae	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocella → Methylocella tundrae	0.79 %
Bradyrhizobium symbiodeficiens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium symbiodeficiens	0.79 %
Rhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium	0.79 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.79 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.79 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.79 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300002914\|JGI25617J43924_10145708	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	818	Open in IMG/M
3300004633\|Ga0066395_10000007	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	57657	Open in IMG/M
3300004633\|Ga0066395_10082817	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1507	Open in IMG/M
3300005332\|Ga0066388_100369789	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium	2080	Open in IMG/M
3300005332\|Ga0066388_101536666	Not Available	1167	Open in IMG/M
3300005332\|Ga0066388_103410659	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	812	Open in IMG/M
3300005332\|Ga0066388_104264790	Not Available	729	Open in IMG/M
3300005332\|Ga0066388_104325910	Not Available	724	Open in IMG/M
3300005531\|Ga0070738_10001038	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	65333	Open in IMG/M
3300005533\|Ga0070734_10004752	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	12630	Open in IMG/M
3300005713\|Ga0066905_100138517	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1732	Open in IMG/M
3300005764\|Ga0066903_100127860	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3560	Open in IMG/M
3300005764\|Ga0066903_101292145	Not Available	1362	Open in IMG/M
3300006047\|Ga0075024_100056693	Not Available	1646	Open in IMG/M
3300006047\|Ga0075024_100104314	Not Available	1247	Open in IMG/M
3300006052\|Ga0075029_100848885	Not Available	624	Open in IMG/M
3300006057\|Ga0075026_100239836	Not Available	969	Open in IMG/M
3300006086\|Ga0075019_10185331	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1227	Open in IMG/M
3300006176\|Ga0070765_101089201	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	755	Open in IMG/M
3300007255\|Ga0099791_10307225	Not Available	757	Open in IMG/M
3300007258\|Ga0099793_10245025	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	864	Open in IMG/M
3300007258\|Ga0099793_10460871	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	629	Open in IMG/M
3300009038\|Ga0099829_10621268	Not Available	898	Open in IMG/M
3300009088\|Ga0099830_10105081	All Organisms → cellular organisms → Bacteria	2114	Open in IMG/M
3300009089\|Ga0099828_11094495	Not Available	708	Open in IMG/M
3300009143\|Ga0099792_10264484	Not Available	1007	Open in IMG/M
3300009143\|Ga0099792_10316652	Not Available	931	Open in IMG/M
3300009523\|Ga0116221_1093243	All Organisms → cellular organisms → Bacteria	1337	Open in IMG/M
3300009764\|Ga0116134_1068600	Not Available	1320	Open in IMG/M
3300009792\|Ga0126374_10124097	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1516	Open in IMG/M
3300009792\|Ga0126374_10831463	All Organisms → cellular organisms → Bacteria	709	Open in IMG/M
3300009792\|Ga0126374_10916342	Not Available	680	Open in IMG/M
3300010043\|Ga0126380_10060061	Not Available	2103	Open in IMG/M
3300010043\|Ga0126380_11141985	Not Available	667	Open in IMG/M
3300010046\|Ga0126384_11002892	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	760	Open in IMG/M
3300010046\|Ga0126384_12388129	Not Available	512	Open in IMG/M
3300010047\|Ga0126382_12410594	Not Available	511	Open in IMG/M
3300010049\|Ga0123356_13729795	Not Available	527	Open in IMG/M
3300010358\|Ga0126370_10664192	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	910	Open in IMG/M
3300010359\|Ga0126376_11639842	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	676	Open in IMG/M
3300010361\|Ga0126378_10082647	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	3116	Open in IMG/M
3300010361\|Ga0126378_10218205	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1990	Open in IMG/M
3300010361\|Ga0126378_10496025	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1336	Open in IMG/M
3300010362\|Ga0126377_12625877	Not Available	579	Open in IMG/M
3300010366\|Ga0126379_11012744	Not Available	936	Open in IMG/M
3300010376\|Ga0126381_103184072	Not Available	649	Open in IMG/M
3300010398\|Ga0126383_11614650	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	738	Open in IMG/M
3300011120\|Ga0150983_10875386	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes	1271	Open in IMG/M
3300011120\|Ga0150983_12730852	Not Available	593	Open in IMG/M
3300011120\|Ga0150983_12985479	Not Available	859	Open in IMG/M
3300011120\|Ga0150983_13386642	Not Available	799	Open in IMG/M
3300011120\|Ga0150983_15241416	Not Available	929	Open in IMG/M
3300011269\|Ga0137392_11080189	Not Available	658	Open in IMG/M
3300011271\|Ga0137393_11688446	Not Available	522	Open in IMG/M
3300012189\|Ga0137388_10490277	Not Available	1141	Open in IMG/M
3300012189\|Ga0137388_11696128	Not Available	566	Open in IMG/M
3300012205\|Ga0137362_10030471	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	4268	Open in IMG/M
3300012211\|Ga0137377_10029453	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	4959	Open in IMG/M
3300012361\|Ga0137360_10209793	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces violaceusniger group → Streptomyces malaysiensis	1581	Open in IMG/M
3300012361\|Ga0137360_10363855	Not Available	1213	Open in IMG/M
3300012362\|Ga0137361_10921378	Not Available	792	Open in IMG/M
3300012930\|Ga0137407_11972884	Not Available	557	Open in IMG/M
3300012971\|Ga0126369_10006524	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	8693	Open in IMG/M
3300012971\|Ga0126369_10447948	Not Available	1339	Open in IMG/M
3300014164\|Ga0181532_10165616	Not Available	1318	Open in IMG/M
3300016319\|Ga0182033_11644531	Not Available	581	Open in IMG/M
3300017932\|Ga0187814_10362913	Not Available	560	Open in IMG/M
3300017961\|Ga0187778_11185377	Not Available	534	Open in IMG/M
3300017970\|Ga0187783_10094912	Not Available	2198	Open in IMG/M
3300017970\|Ga0187783_10677996	Not Available	744	Open in IMG/M
3300017972\|Ga0187781_10900323	Not Available	644	Open in IMG/M
3300019258\|Ga0181504_1041021	Not Available	698	Open in IMG/M
3300020170\|Ga0179594_10379627	Not Available	536	Open in IMG/M
3300020581\|Ga0210399_10218537	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1587	Open in IMG/M
3300021086\|Ga0179596_10013587	All Organisms → cellular organisms → Bacteria	2758	Open in IMG/M
3300021086\|Ga0179596_10701567	Not Available	512	Open in IMG/M
3300021170\|Ga0210400_10411019	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1116	Open in IMG/M
3300021178\|Ga0210408_10236996	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1453	Open in IMG/M
3300021404\|Ga0210389_10175717	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1666	Open in IMG/M
3300021420\|Ga0210394_10984791	All Organisms → cellular organisms → Bacteria → Proteobacteria	731	Open in IMG/M
3300021476\|Ga0187846_10027749	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. PH10	2586	Open in IMG/M
3300021560\|Ga0126371_10918282	Not Available	1019	Open in IMG/M
3300021560\|Ga0126371_12114212	Not Available	678	Open in IMG/M
3300022504\|Ga0242642_1082329	Not Available	543	Open in IMG/M
3300022507\|Ga0222729_1048311	Not Available	583	Open in IMG/M
3300022530\|Ga0242658_1042486	Not Available	931	Open in IMG/M
3300022533\|Ga0242662_10250678	Not Available	575	Open in IMG/M
3300022709\|Ga0222756_1012600	Not Available	992	Open in IMG/M
3300022711\|Ga0242674_1044405	Not Available	595	Open in IMG/M
3300022715\|Ga0242678_1074009	Not Available	532	Open in IMG/M
3300022716\|Ga0242673_1056448	Not Available	674	Open in IMG/M
3300022722\|Ga0242657_1233714	Not Available	521	Open in IMG/M
3300022724\|Ga0242665_10327584	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	543	Open in IMG/M
3300022726\|Ga0242654_10173480	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	735	Open in IMG/M
3300022726\|Ga0242654_10280393	Not Available	607	Open in IMG/M
3300026304\|Ga0209240_1029345	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2100	Open in IMG/M
3300026320\|Ga0209131_1156160	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1145	Open in IMG/M
3300026355\|Ga0257149_1001687	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2262	Open in IMG/M
3300026489\|Ga0257160_1006005	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces violaceusniger group → Streptomyces malaysiensis	1575	Open in IMG/M
3300026494\|Ga0257159_1049186	Not Available	715	Open in IMG/M
3300026497\|Ga0257164_1093552	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	516	Open in IMG/M
3300027635\|Ga0209625_1042438	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1016	Open in IMG/M
3300027773\|Ga0209810_1003994	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	14729	Open in IMG/M
3300027826\|Ga0209060_10007983	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	6782	Open in IMG/M
3300027862\|Ga0209701_10233139	Not Available	1083	Open in IMG/M
3300027874\|Ga0209465_10000355	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	21791	Open in IMG/M
3300027898\|Ga0209067_10421820	Not Available	749	Open in IMG/M
3300027903\|Ga0209488_10099091	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2183	Open in IMG/M
3300027903\|Ga0209488_10168780	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1653	Open in IMG/M
3300027905\|Ga0209415_10045851	All Organisms → cellular organisms → Bacteria	5765	Open in IMG/M
3300027915\|Ga0209069_10087831	Not Available	1490	Open in IMG/M
3300028536\|Ga0137415_10010295	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	9276	Open in IMG/M
3300029701\|Ga0222748_1019455	Not Available	976	Open in IMG/M
3300030730\|Ga0307482_1120377	Not Available	738	Open in IMG/M
3300031057\|Ga0170834_104143515	Not Available	555	Open in IMG/M
3300031561\|Ga0318528_10161824	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces violaceusniger group → Streptomyces malaysiensis	1194	Open in IMG/M
3300031572\|Ga0318515_10651610	Not Available	558	Open in IMG/M
3300031718\|Ga0307474_11275043	Not Available	580	Open in IMG/M
3300031719\|Ga0306917_10328211	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1186	Open in IMG/M
3300031720\|Ga0307469_10011118	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	4424	Open in IMG/M
3300031740\|Ga0307468_102264224	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium symbiodeficiens	527	Open in IMG/M
3300031823\|Ga0307478_11805124	Not Available	503	Open in IMG/M
3300031890\|Ga0306925_11201254	Not Available	760	Open in IMG/M
3300032089\|Ga0318525_10475393	Not Available	640	Open in IMG/M
3300032205\|Ga0307472_100330475	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1241	Open in IMG/M
3300032515\|Ga0348332_10794076	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocella → Methylocella tundrae	651	Open in IMG/M
3300032515\|Ga0348332_12108067	Not Available	569	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	99.21%
Host-Associated	Host-Associated	0.79%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	90.55%
Aquatic	Environmental → Aquatic	8.66%
Arthropoda	Host-Associated → Arthropoda	0.79%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	88.19%
Sediment	Environmental → Aquatic → Sediment	5.51%
Freshwater	Environmental → Aquatic → Freshwater	3.15%
Plant Litter	Environmental → Terrestrial → Plant Litter	1.57%
Cave	Environmental → Terrestrial → Cave	0.79%
Digestive System	Host-Associated → Arthropoda → Digestive System	0.79%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	70.87%
Loam	Environmental → Terrestrial → Soil → Loam	14.17%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	5.51%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	3.15%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	3.15%
Unclassified	Environmental → Terrestrial → Plant Litter → Unclassified	1.57%
Unclassified	Environmental → Terrestrial → Cave → Unclassified	0.79%
Gut	Host-Associated → Arthropoda → Digestive System → Gut	0.79%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	40.94%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	27.56%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	14.17%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	5.51%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	3.15%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	2.36%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	1.57%
Unclassified	Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified	1.57%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	0.79%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	0.79%
Unclassified	Environmental → Terrestrial → Cave → Unclassified → Unclassified	0.79%
Unclassified	Host-Associated → Arthropoda → Digestive System → Gut → Unclassified	0.79%

Habitat	Taxonomy	Distribution
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	19.68%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	19.68%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	16.54%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	8.66%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	5.51%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	4.72%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	4.72%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	3.15%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	3.15%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	2.36%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	2.36%
Peatlands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil	1.57%
Plant Litter	Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter	1.57%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland	0.79%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog	0.79%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland	0.79%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	0.79%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	0.79%
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	0.79%
Biofilm	Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm	0.79%
Termite Gut	Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut	0.79%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300002914	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm	Environmental	Open in IMG/M
3300004633	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005531	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2	Environmental	Open in IMG/M
3300005533	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1	Environmental	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300006047	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013	Environmental	Open in IMG/M
3300006052	Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013	Environmental	Open in IMG/M
3300006057	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012	Environmental	Open in IMG/M
3300006086	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013	Environmental	Open in IMG/M
3300006176	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5	Environmental	Open in IMG/M
3300007255	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1	Environmental	Open in IMG/M
3300007258	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3	Environmental	Open in IMG/M
3300009038	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG	Environmental	Open in IMG/M
3300009088	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG	Environmental	Open in IMG/M
3300009089	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG	Environmental	Open in IMG/M
3300009143	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2	Environmental	Open in IMG/M
3300009523	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG	Environmental	Open in IMG/M
3300009764	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40	Environmental	Open in IMG/M
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental	Open in IMG/M
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010049	Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3	Host-Associated	Open in IMG/M
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010361	Tropical forest soil microbial communities from Panama - MetaG Plot_23	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300011120	Combined assembly of Microbial Forest Soil metaT	Environmental	Open in IMG/M
3300011269	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG	Environmental	Open in IMG/M
3300011271	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG	Environmental	Open in IMG/M
3300012189	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG	Environmental	Open in IMG/M
3300012205	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG	Environmental	Open in IMG/M
3300012211	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG	Environmental	Open in IMG/M
3300012361	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG	Environmental	Open in IMG/M
3300012362	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG	Environmental	Open in IMG/M
3300012930	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300014164	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG	Environmental	Open in IMG/M
3300016319	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H	Environmental	Open in IMG/M
3300017932	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4	Environmental	Open in IMG/M
3300017961	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG	Environmental	Open in IMG/M
3300017970	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG	Environmental	Open in IMG/M
3300017972	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG	Environmental	Open in IMG/M
3300019258	Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300020170	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300020581	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M	Environmental	Open in IMG/M
3300021086	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300021170	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M	Environmental	Open in IMG/M
3300021178	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M	Environmental	Open in IMG/M
3300021404	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O	Environmental	Open in IMG/M
3300021420	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M	Environmental	Open in IMG/M
3300021476	Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2)	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300022504	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300022507	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-M (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300022530	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300022533	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300022709	Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300022711	Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300022715	Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300022716	Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300022722	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300022724	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300022726	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300026304	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes)	Environmental	Open in IMG/M
3300026320	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes)	Environmental	Open in IMG/M
3300026355	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-A	Environmental	Open in IMG/M
3300026489	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A	Environmental	Open in IMG/M
3300026494	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-A	Environmental	Open in IMG/M
3300026497	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B	Environmental	Open in IMG/M
3300027635	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes)	Environmental	Open in IMG/M
3300027773	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300027826	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300027862	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027874	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)	Environmental	Open in IMG/M
3300027898	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)	Environmental	Open in IMG/M
3300027903	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)	Environmental	Open in IMG/M
3300027905	Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)	Environmental	Open in IMG/M
3300027915	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)	Environmental	Open in IMG/M
3300028536	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300029701	Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030730	Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031057	Oak Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031561	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26	Environmental	Open in IMG/M
3300031572	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19	Environmental	Open in IMG/M
3300031718	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05	Environmental	Open in IMG/M
3300031719	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)	Environmental	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental	Open in IMG/M
3300031823	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05	Environmental	Open in IMG/M
3300031890	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)	Environmental	Open in IMG/M
3300032089	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23	Environmental	Open in IMG/M
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental	Open in IMG/M
3300032515	FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.45
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.45
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F065965

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI25617J43924_101457082	3300002914	Grasslands Soil	MSRNVGLRITAEGRLFGLDSGDWTMLVGGFALVALVILLI*
Ga0066395_1000000737	3300004633	Tropical Forest Soil	MSQNVYLRITADGRFFGLNSGDWTVLVGGFVLVALMILLL*
Ga0066395_100828173	3300004633	Tropical Forest Soil	MSPNMHLRITADGRLFGLNSGDWTVLLGGFALVALVILLL*
Ga0066388_1003697893	3300005332	Tropical Forest Soil	MSSNVYLRITSEGRLFGLNSGDWMMLLGGFALVALVVLLL*
Ga0066388_1015366661	3300005332	Tropical Forest Soil	MSQNVGLRITAERRLFGLDSGDWTMLVGGFALVALVILVLS*
Ga0066388_1034106591	3300005332	Tropical Forest Soil	NMSRNVGLRITAEGRLFGLNSGDWMMLLGGFALAAAAVLLL*
Ga0066388_1042647901	3300005332	Tropical Forest Soil	MSPNVYLRIAAERRLFGLTSGDWTLLVGGYALIALMVLLL*
Ga0066388_1043259102	3300005332	Tropical Forest Soil	MSRNVGLRITADGRLFGLNSGDWTVLVGGFALVTLVILLL*
Ga0070738_1000103849	3300005531	Surface Soil	MSPNVDLRVMAEGRLLGLNSGDWLMLAGGFALVALLIFLL*
Ga0070734_100047525	3300005533	Surface Soil	MSQNVYLRIAAEGRLFGLSPGDWTILVGGFALVALLVLLL*
Ga0066905_1001385172	3300005713	Tropical Forest Soil	MSQNIGFRITPEGRLLGLNSGDWMLLVGGFAAVALVVLLI*
Ga0066903_1001278604	3300005764	Tropical Forest Soil	MSPNVYLRITSEGRLFGLNSGDWMVLLGGFALVALVVLLL*
Ga0066903_1012921453	3300005764	Tropical Forest Soil	VSNGLDQGTHMSRNVGLRITAEGRLFGLNSGDWMMLASGFALVAAIVLLL*
Ga0075024_1000566932	3300006047	Watersheds	MLQNVYGSMTAEGRLFGLNSGDWTMLLGGFALVALVALLL*
Ga0075024_1001043143	3300006047	Watersheds	MSVRFDQGTLMSQNVYLRITAEGRLFGLNSGDWTLLFGGFALVALLVMLL*
Ga0075029_1008488851	3300006052	Watersheds	SQNVYLRITAEGRLFGLSPGDWTILIGGFALVALVVLLL*
Ga0075026_1002398362	3300006057	Watersheds	VATPMSVRFDQGTLMSQNVYLRITAERRLFGLNSGDWTLLFGGFALVALLVMLL*
Ga0075019_101853311	3300006086	Watersheds	MSQNVYLRITAEGRLFGLSPGDWTILIGGFALVALVVLLL*
Ga0070765_1010892013	3300006176	Soil	MYQNVFGRMTAEGRLLGLNPGDWSMLIGGFVLAVLVVLLL*
Ga0099791_103072252	3300007255	Vadose Zone Soil	MVLDQGTHMSQNVGLRITAEGRLFGLDSGDWMMLVGGFALVALVVLLI*
Ga0099793_102450252	3300007258	Vadose Zone Soil	MSQNVGLRITAEGRLFGLDSGDWMMLVGGFALVALVVLLI*
Ga0099793_104608711	3300007258	Vadose Zone Soil	MSQNVGLRITAEGRFFGLDSGDWTMLVGGFALVALVVLLV*
Ga0099829_106212682	3300009038	Vadose Zone Soil	MSQNVGLRITAEGRLFGLDSGDWMMLVGGFALVALVILLL*
Ga0099830_101050812	3300009088	Vadose Zone Soil	MSQNVGLRITAEGRFFGLDSGDWTMLVGGFALVALVILLV*
Ga0099828_110944952	3300009089	Vadose Zone Soil	MSQNAGLRITAEGRLFGLDSGDWTMLFGGFALVALVVLLV*
Ga0099792_102644841	3300009143	Vadose Zone Soil	MSQNVGLRITAEGRFFGLDSGDWMMLVGGFALVALVVLL
Ga0099792_103166521	3300009143	Vadose Zone Soil	QGTHMSQNVGLRITAEGRLFGLDSGDWTMLVGGFALVALVVLLV*
Ga0116221_10932433	3300009523	Peatlands Soil	GRMTAEGRLLGLSPGDWSMLIGGFVLVALVVLLL*
Ga0116134_10686001	3300009764	Peatland	MSLNLYARMTAERRLYGLNPGDWTVLLGGVALVALVVFLL*
Ga0126374_101240973	3300009792	Tropical Forest Soil	MSQNVGLRITAEGRLFGLDSGDWTMLVGGFAFVALVILLI*
Ga0126374_108314631	3300009792	Tropical Forest Soil	MSHNVYLRITADGRFFGLNSGDWTVLVGGFVLLALVILLL*
Ga0126374_109163421	3300009792	Tropical Forest Soil	MSQNVGLRITAEGRLFGLDSGDWTMLVGGFALVALVVLLV*
Ga0126380_100600611	3300010043	Tropical Forest Soil	IGFRITPEGRLLGLNSGDWMLLVGGFAAVALVVLLI*
Ga0126380_111419851	3300010043	Tropical Forest Soil	MSQNVYLRFAAEGRLFGLTSGDWTVLVGGFALVALMIFL
Ga0126384_110028921	3300010046	Tropical Forest Soil	MSQNVGLRITAEGRLFGLDSGDWTMLVGGFALVALVILLI*
Ga0126384_123881292	3300010046	Tropical Forest Soil	MSQNVYLRTAAERRLFGLTCGDWTVLVGGFALITLVILLL*
Ga0126382_124105941	3300010047	Tropical Forest Soil	TMSRNAGLRIAAEGRLFGLNSGDWMMLAGGFALAAAVVLLL*
Ga0123356_137297951	3300010049	Termite Gut	MGRNGDLRITTEGRLLGLNSGDWLILVGGFALAALVVLLL*
Ga0126370_106641922	3300010358	Tropical Forest Soil	MSQNVHLRIVADGRFFGLTAGDWTVLVGGFGLVALVVLLL*
Ga0126376_116398422	3300010359	Tropical Forest Soil	MSQNVHLRIIVADGRFFGLTAGDWTVLVGGFGLVALVVLLL*
Ga0126378_100826472	3300010361	Tropical Forest Soil	MHLRITADGRLFGLNSGDWTVLLGGFALVALVILLL*
Ga0126378_102182053	3300010361	Tropical Forest Soil	MSRNVGLRITAEGRLFGLNSGDWMMLLGGFALAAAAVLLL*
Ga0126378_104960252	3300010361	Tropical Forest Soil	MSQNVYLRFAAEGRLFGLTSGDWTVLVGGFALVALMIFLL*
Ga0126377_126258771	3300010362	Tropical Forest Soil	MYLRTAVERRLFGLTSGDWTVLVGGFALITLVILLL*
Ga0126379_110127441	3300010366	Tropical Forest Soil	MSRNVGLRITAEGRLFGLNSGDWMMLVCGFALAAAAVL
Ga0126381_1031840721	3300010376	Tropical Forest Soil	MSRNVGLRITAEGRLFGLNSGDWMMLASGFALVAAIVLLL*
Ga0126383_116146501	3300010398	Tropical Forest Soil	MSQNVHLRIVADGRFFGLTAGDWTVLVGGFGLVTLMVLLL*
Ga0150983_108753861	3300011120	Forest Soil	MYQSVFGRMTAEGRLLGLNPGDWSMLIGGFVLVALVVLLL*
Ga0150983_127308521	3300011120	Forest Soil	GASMYQNVFGRITAEGRLLGLNPGDWSMLIGGFVLVALVVLLL*
Ga0150983_129854791	3300011120	Forest Soil	QNVFGRITAEGRLLGLNPGDWSMLIGGFVLVALVVLLL*
Ga0150983_133866421	3300011120	Forest Soil	QKGAVMYQSVFGRMTAEGRLLGLNPGDWSLLIGGFVLVALVVLLL*
Ga0150983_152414162	3300011120	Forest Soil	SQKGASMYQSVFGRMTAEGRLLGLNPGDWSLLIGGFVLVVLVVLLL*
Ga0137392_110801892	3300011269	Vadose Zone Soil	MSQNVGLRITAEGRFFGLDSGDWMMLVGGFALVALV
Ga0137393_116884461	3300011271	Vadose Zone Soil	MSQNVGLRITAEGRFFGLDSGDWMMLVGGFALVALVVLLV*
Ga0137388_104902772	3300012189	Vadose Zone Soil	MSQNVGLRITAEGRLFGLDSGDWMMLVGGFALVALVILLV*
Ga0137388_116961281	3300012189	Vadose Zone Soil	MSQNVGLRITAEGRLFGLDSGDWTMLVGGFVFVALVVLLV*
Ga0137362_100304711	3300012205	Vadose Zone Soil	QNVGLRITAEGRLFGLDSGDWMMLVGGFALVALVVLLI*
Ga0137377_100294533	3300012211	Vadose Zone Soil	MGLRITAEGRLFGLDSGDWTMLVGGFALVALVVLLV*
Ga0137360_102097932	3300012361	Vadose Zone Soil	SQNVGLRITAEGRLFGLDSGDWMMLVGGFALVALVVLLI*
Ga0137360_103638551	3300012361	Vadose Zone Soil	MSQNVGLRITAEGRLFGLDSGDWMMLVGGFALVALV
Ga0137361_109213782	3300012362	Vadose Zone Soil	MSQNVGLRITAEGRLFGLDSGDWTMLVGGFALVALIILLI*
Ga0137407_119728841	3300012930	Vadose Zone Soil	MYQSVFGRMTAEGRLLGLNPGDWSLLIGGFVLVALVALLL*
Ga0126369_100065241	3300012971	Tropical Forest Soil	LRITADGRLFGLNSGDWTVLLGGFALVALVILLL*
Ga0126369_104479483	3300012971	Tropical Forest Soil	MSQNIGFHITPEGRLLGLNSGDWMLLVGGFAVVALVVLLI*
Ga0181532_101656161	3300014164	Bog	MSLNLYARMTAERRLFGLNPGDWTVLLGGVALVALVVFLL*
Ga0182033_116445311	3300016319	Soil	MSFDQETLMSPNVHLRITAEGRLLGLNSGDWTLLLGGFALIALMLLLL
Ga0187814_103629131	3300017932	Freshwater Sediment	MLPNVDLRITAEGRLLGLNSGDWMLLVGGFALVALVIFLL
Ga0187778_111853771	3300017961	Tropical Peatland	MHMSPNVDLRITAEGRLLGLNSGDWMMLVGGFALVALVIFVL
Ga0187783_100949122	3300017970	Tropical Peatland	MSQNVGLRITAEGRLFGLDSGDWMVLIGGFALVALVVLVL
Ga0187783_106779961	3300017970	Tropical Peatland	MSPNVDLRITAEGRLLGLNSGDWMMLVGGFALVALVILLL
Ga0187781_109003231	3300017972	Tropical Peatland	MSQNVGLRITAEGRLFGLDSGDWMVLIGGFALVALVVLLL
Ga0181504_10410211	3300019258	Peatland	MSLNLYARMTAERRLFGLNPGDWTVLLGGVALVALVVFLL
Ga0179594_103796271	3300020170	Vadose Zone Soil	MSQNVGLRITAEGRLFGLDSGDWMMLVGGFALVALVVLLI
Ga0210399_102185373	3300020581	Soil	MSQNVYLRITADGRFFGLNTGDWTILVGGFGLAALVVLLL
Ga0179596_100135873	3300021086	Vadose Zone Soil	MSQNVGLRITAEGRFFGLDSGDWTMLVGGFALVALVVLLV
Ga0179596_107015671	3300021086	Vadose Zone Soil	MSQNVYLRITADGRFFGLNSGDWMMLLGGFALIALVVLLL
Ga0210400_104110193	3300021170	Soil	RGTPMPQNVYLRITADGRFFGLNTGDWTILVGGFGLAALVVLLL
Ga0210408_102369962	3300021178	Soil	MSQNVYLRITAEGRLFGLNSGDWTMLVGGFALVALVILLL
Ga0210389_101757172	3300021404	Soil	MSRNGELPMAEGRLLGLNSGDWMIIVGGFALVALIVLLL
Ga0210394_109847912	3300021420	Soil	GALMDQNVFGRMTAEGRLLGLNPGDWSMLIGGFVLVALVVLLL
Ga0187846_100277493	3300021476	Biofilm	MSQNVGLRLTADGRLLGLNSGDWMLLVGGFAVVALIVLLV
Ga0126371_109182822	3300021560	Tropical Forest Soil	MHLRITADGRLFGLNSGDWTVLLGGFALVALVILLL
Ga0126371_121142122	3300021560	Tropical Forest Soil	MSQNVYLRITADGRFFGLNSGDWTVLVGGFVLVALMILLL
Ga0242642_10823292	3300022504	Soil	SMYQNVFGRMTAEGRLLGLNPGDWSMLIGGFVLVVLVVLLL
Ga0222729_10483111	3300022507	Soil	SMYQNVFGRITAEGRLLGLNPGDWPMLIGGFVLVALVVLLL
Ga0242658_10424861	3300022530	Soil	KGALMYQNVFGRMTAEGRLLGLNPGDWSMLIGGFVLAVLVVLLL
Ga0242662_102506782	3300022533	Soil	LMYQNVFGRMTAEGRLLGLNPGDWSMLIGGMVLVVLVVLLL
Ga0222756_10126002	3300022709	Soil	ALMYQNVFGRMTAEGRLLGLNPGDWSMLIGGFVLAVLVVLLL
Ga0242674_10444051	3300022711	Soil	NVFGRMTAEGRLLGLNPGDWSMLIGGFVLAVLVVLLL
Ga0242678_10740091	3300022715	Soil	SMYQSVFGRMTAEGRLLGLNPGDWSMLIGGFVLVALVVLLL
Ga0242673_10564482	3300022716	Soil	GALMYQNVFGRMTAEGRLLGLNPGDWSMLIGGFVLAVLVVLLL
Ga0242657_12337141	3300022722	Soil	YQNVFGRITAEGRLLGLNPGDWSMLIGGFVLVALVVLLL
Ga0242665_103275842	3300022724	Soil	GTLMSQNVYLRITAEGRLFGLNSGDWTMLVGGFALVALVVLLL
Ga0242654_101734801	3300022726	Soil	RGTPMSQNVYLRITADGRFFGLNTGDWTILVGGFGLAALVVLLL
Ga0242654_102803931	3300022726	Soil	QGTHMSQNVGLRITAEGRLFGLDSGDWTMLVGGFALVALVVLLV
Ga0209240_10293453	3300026304	Grasslands Soil	MSRNVGLRITAEGRLFGLDSGDWTMLVGGFALVALVILLI
Ga0209131_11561601	3300026320	Grasslands Soil	GTHMSQNVGLRITAEGRFFGLDSGDWTMLVGGFALVALVVLLV
Ga0257149_10016873	3300026355	Soil	MSQNVGLRITAEGRFFGLDSGDWMMLVGGFALVALVVLLV
Ga0257160_10060053	3300026489	Soil	THMSQNVGLRITAEGRFFGLDSGDWMMLVGGFALVALVILLV
Ga0257159_10491861	3300026494	Soil	MSQNVYLRITAEGRLFGLNSGDWMMLVGGFALVALVVLLV
Ga0257164_10935522	3300026497	Soil	DGLDQGTHMSQNVGLRITAEGRFFGLDSGDWTMLVGGFALVALVVLLV
Ga0209625_10424382	3300027635	Forest Soil	MSQNVYLRITAEGRLFGLNSGDWTMLVGGFALVALVVLLL
Ga0209810_10039944	3300027773	Surface Soil	MSPNVDLRVMAEGRLLGLNSGDWLMLAGGFALVALLIFLL
Ga0209060_100079833	3300027826	Surface Soil	MSQNVYLRIAAEGRLFGLSPGDWTILVGGFALVALLVLLL
Ga0209701_102331391	3300027862	Vadose Zone Soil	MSQNVGLRITAEGRFFGLDSGDWTMLVGGFALVALVILLV
Ga0209465_1000035513	3300027874	Tropical Forest Soil	MSQNIGFHITPEGRLLGLNSGDWMLLVGGFAVVALVVLLI
Ga0209067_104218201	3300027898	Watersheds	MSQNVYLRITAEGRLFGLSPGDWTILIGGFALVALVVLLL
Ga0209488_100990912	3300027903	Vadose Zone Soil	MSQNVGLRITAEGRLFGLDSGDWMMLVGGFALVALVILLV
Ga0209488_101687802	3300027903	Vadose Zone Soil	MSQNVGLRITAEGRLFGLDSGDWTMLVGGFALVALVVLLV
Ga0209415_100458514	3300027905	Peatlands Soil	MYQNVFGRMTAEGRLLGLSPGDWSMLIGGFVLVALVVLLL
Ga0209069_100878312	3300027915	Watersheds	MSVRFDQGTLMSQNVYLRITAEGRLFGLNSGDWTLLFGGFALVALLVMLL
Ga0137415_100102954	3300028536	Vadose Zone Soil	MSQNVGLRITAEGRLFGLDSGDWMMLVGGFALVALVVLLV
Ga0222748_10194552	3300029701	Soil	PMYQNVFGRMTAEGRLLGLNPGDWSMLIGGFVLVVLVVLLL
Ga0307482_11203772	3300030730	Hardwood Forest Soil	GASMYQNVFGRITAEGRLLGLNPGDWSILIGGFVLVALVVLLL
Ga0170834_1041435152	3300031057	Forest Soil	MYQNAFGRMTAEGRLLGLSPGDWTVLIGGVVLVALIVLLL
Ga0318528_101618241	3300031561	Soil	NDGFEQGTHMSQNVGLRITAEGRLFGLDSGDWTMLVGGFALVALVILLI
Ga0318515_106516101	3300031572	Soil	MSPNVYLRITSEGRLFGLNSGDWMVLVSGFALVALVVLLL
Ga0307474_112750432	3300031718	Hardwood Forest Soil	MSRNGDLPIMAEGRLLGLNSGDWMMLVGGFALVALVVLLL
Ga0306917_103282111	3300031719	Soil	MSPNVYLRITSEGRLFGLNSGDWMMLLGGFALVALVVLLL
Ga0307469_100111184	3300031720	Hardwood Forest Soil	MPENMYLRTAVERRLFGLTSGDWTVLVGGFALITLVILLL
Ga0307468_1022642242	3300031740	Hardwood Forest Soil	LMPENMYLRTAAERRLFGLTSGDWTVLVGGFALITLVILLL
Ga0307478_118051241	3300031823	Hardwood Forest Soil	MYQNVFGRITAEGRLLGLNPGDWSILIGGFVLVALVVLLL
Ga0306925_112012542	3300031890	Soil	MSFDQETLMSPNVHLRITAEGRLLGLNSGDWTLLLGGFALIALMLLVL
Ga0318525_104753931	3300032089	Soil	MSQNVGLRITAEGRLFGLDSGDWIVLVGGFALVALVILLI
Ga0307472_1003304752	3300032205	Hardwood Forest Soil	MGFDRGTLMPENMYLRTAVERRLFGLTSGDWTVLVGGFALITLVILLL
Ga0348332_107940762	3300032515	Plant Litter	MSQNMFGRMAAEGRLFGLNPGDWSVLLGGFALVALVVLLI
Ga0348332_121080672	3300032515	Plant Litter	GALMYQNVFGRMTAEGRLLGLNPGDWSMLIGGFVLVALVVLLL

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign