NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F066032

Metagenome Family F066032

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F066032
Family Type Metagenome
Number of Sequences 127
Average Sequence Length 41 residues
Representative Sequence MAEPRRKSGHFQIHVAYSFDRLLEPKLAQAYEILVPCRER
Number of Associated Samples 102
Number of Associated Scaffolds 127

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 34.43 %
% of genes near scaffold ends (potentially truncated) 92.13 %
% of genes from short scaffolds (< 2000 bps) 88.98 %
Associated GOLD sequencing projects 95
AlphaFold2 3D model prediction Yes
3D model pTM-score0.32

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (95.276 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(26.772 % of family members)
Environment Ontology (ENVO) Unclassified
(39.370 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(54.331 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 23.53%    β-sheet: 0.00%    Coil/Unstructured: 76.47%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.32
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 127 Family Scaffolds
PF00078RVT_1 10.24
PF08388GIIM 8.66
PF01402RHH_1 7.09
PF02585PIG-L 0.79
PF04030ALO 0.79
PF04366Ysc84 0.79
PF00069Pkinase 0.79

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 127 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 3.15
COG0277FAD/FMN-containing lactate dehydrogenase/glycolate oxidaseEnergy production and conversion [C] 0.79
COG2120N-acetylglucosaminyl deacetylase, LmbE familyCarbohydrate transport and metabolism [G] 0.79
COG2930Lipid-binding SYLF domain, Ysc84/FYVE familyLipid transport and metabolism [I] 0.79

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.28 %
UnclassifiedrootN/A4.72 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000893|AP72_2010_repI_A001DRAFT_1057082All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium612Open in IMG/M
3300001431|F14TB_100763306All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300001593|JGI12635J15846_10796237All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300001686|C688J18823_10655682All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium668Open in IMG/M
3300002560|JGI25383J37093_10166438All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium580Open in IMG/M
3300004633|Ga0066395_10797311All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium567Open in IMG/M
3300005332|Ga0066388_106806368All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300005436|Ga0070713_100192978All Organisms → cellular organisms → Bacteria1836Open in IMG/M
3300005450|Ga0066682_10232002All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1186Open in IMG/M
3300005468|Ga0070707_101321229All Organisms → cellular organisms → Bacteria → Proteobacteria687Open in IMG/M
3300005556|Ga0066707_10575728All Organisms → cellular organisms → Bacteria → Proteobacteria723Open in IMG/M
3300005587|Ga0066654_10557578All Organisms → cellular organisms → Bacteria → Proteobacteria631Open in IMG/M
3300005764|Ga0066903_104526297All Organisms → cellular organisms → Bacteria → Proteobacteria741Open in IMG/M
3300005764|Ga0066903_108310464All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium530Open in IMG/M
3300006028|Ga0070717_10097153All Organisms → cellular organisms → Bacteria2495Open in IMG/M
3300006028|Ga0070717_11724651All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300006052|Ga0075029_100526903All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium782Open in IMG/M
3300006059|Ga0075017_101295988All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium572Open in IMG/M
3300006102|Ga0075015_100044990All Organisms → cellular organisms → Bacteria → Proteobacteria2067Open in IMG/M
3300006174|Ga0075014_100108834All Organisms → cellular organisms → Bacteria1302Open in IMG/M
3300006804|Ga0079221_10594685All Organisms → cellular organisms → Bacteria → Proteobacteria744Open in IMG/M
3300009012|Ga0066710_101659064All Organisms → cellular organisms → Bacteria975Open in IMG/M
3300009038|Ga0099829_11153996All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300009089|Ga0099828_11875332All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium526Open in IMG/M
3300009162|Ga0075423_12832461All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium531Open in IMG/M
3300010048|Ga0126373_11846267All Organisms → cellular organisms → Bacteria668Open in IMG/M
3300010162|Ga0131853_10834489All Organisms → cellular organisms → Bacteria736Open in IMG/M
3300010359|Ga0126376_12876079All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300010366|Ga0126379_12931560All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium571Open in IMG/M
3300010369|Ga0136643_10859564Not Available521Open in IMG/M
3300010376|Ga0126381_100192718All Organisms → cellular organisms → Bacteria2718Open in IMG/M
3300010376|Ga0126381_102941780All Organisms → cellular organisms → Bacteria678Open in IMG/M
3300010376|Ga0126381_103358444All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300010376|Ga0126381_104340132All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium549Open in IMG/M
3300010399|Ga0134127_12925808All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium556Open in IMG/M
3300011120|Ga0150983_16073570All Organisms → cellular organisms → Bacteria811Open in IMG/M
3300012205|Ga0137362_11235513All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae632Open in IMG/M
3300012205|Ga0137362_11251613All Organisms → cellular organisms → Bacteria627Open in IMG/M
3300012206|Ga0137380_11254183All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium626Open in IMG/M
3300012532|Ga0137373_10969020All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300012927|Ga0137416_11062319All Organisms → cellular organisms → Bacteria725Open in IMG/M
3300012971|Ga0126369_11414442All Organisms → cellular organisms → Bacteria785Open in IMG/M
3300012971|Ga0126369_12264106All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300012975|Ga0134110_10082298All Organisms → cellular organisms → Bacteria → Proteobacteria1289Open in IMG/M
3300014154|Ga0134075_10324655All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300014164|Ga0181532_10185121All Organisms → cellular organisms → Bacteria1230Open in IMG/M
3300016270|Ga0182036_10163635All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1597Open in IMG/M
3300016270|Ga0182036_10205740All Organisms → cellular organisms → Bacteria → Proteobacteria1446Open in IMG/M
3300016270|Ga0182036_10375890All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1101Open in IMG/M
3300016341|Ga0182035_10136024All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1864Open in IMG/M
3300016341|Ga0182035_10978027All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales749Open in IMG/M
3300016341|Ga0182035_12087592All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300016371|Ga0182034_10260907All Organisms → cellular organisms → Bacteria → Proteobacteria1372Open in IMG/M
3300016371|Ga0182034_11232770All Organisms → cellular organisms → Bacteria → Proteobacteria651Open in IMG/M
3300016371|Ga0182034_11341437All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300016387|Ga0182040_10798741All Organisms → cellular organisms → Bacteria → Proteobacteria777Open in IMG/M
3300016404|Ga0182037_11675052All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium566Open in IMG/M
3300016422|Ga0182039_11469302All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium620Open in IMG/M
3300016422|Ga0182039_11882940All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300016445|Ga0182038_11478686All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300019361|Ga0173482_10663167All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300020170|Ga0179594_10276617All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300021088|Ga0210404_10715754All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300021358|Ga0213873_10198408All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300021372|Ga0213877_10175375All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium687Open in IMG/M
3300021420|Ga0210394_11837817All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium504Open in IMG/M
3300021439|Ga0213879_10118791All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium751Open in IMG/M
3300021475|Ga0210392_10456917All Organisms → cellular organisms → Bacteria → Proteobacteria937Open in IMG/M
3300021477|Ga0210398_11234773All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300021478|Ga0210402_10097800All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2631Open in IMG/M
3300021560|Ga0126371_12203046All Organisms → cellular organisms → Bacteria665Open in IMG/M
3300021976|Ga0193742_1132144All Organisms → cellular organisms → Bacteria → Proteobacteria794Open in IMG/M
3300025910|Ga0207684_10789541All Organisms → cellular organisms → Bacteria → Proteobacteria803Open in IMG/M
3300025928|Ga0207700_10136585All Organisms → cellular organisms → Bacteria2009Open in IMG/M
3300026557|Ga0179587_10931642All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300027034|Ga0209730_1021820All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium692Open in IMG/M
3300027371|Ga0209418_1065085All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium651Open in IMG/M
3300027376|Ga0209004_1056467All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300027548|Ga0209523_1083137All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300027667|Ga0209009_1103381All Organisms → cellular organisms → Bacteria723Open in IMG/M
3300027737|Ga0209038_10172018All Organisms → cellular organisms → Bacteria656Open in IMG/M
3300027829|Ga0209773_10415806All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium557Open in IMG/M
3300028798|Ga0302222_10386081All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300030618|Ga0311354_10311021All Organisms → cellular organisms → Bacteria1625Open in IMG/M
3300030618|Ga0311354_11264019All Organisms → cellular organisms → Bacteria664Open in IMG/M
3300031545|Ga0318541_10556099All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300031545|Ga0318541_10667223All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300031561|Ga0318528_10509974All Organisms → cellular organisms → Bacteria646Open in IMG/M
3300031573|Ga0310915_11009628All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300031679|Ga0318561_10486502All Organisms → cellular organisms → Bacteria → Proteobacteria679Open in IMG/M
3300031680|Ga0318574_10771580All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300031719|Ga0306917_11537378All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300031770|Ga0318521_10332317All Organisms → cellular organisms → Bacteria → Proteobacteria898Open in IMG/M
3300031821|Ga0318567_10649332All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300031821|Ga0318567_10761334All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300031833|Ga0310917_10783656All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300031879|Ga0306919_11196112All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300031890|Ga0306925_11531828All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300031910|Ga0306923_10797012All Organisms → cellular organisms → Bacteria1043Open in IMG/M
3300031941|Ga0310912_10969512All Organisms → cellular organisms → Bacteria653Open in IMG/M
3300031945|Ga0310913_10354624All Organisms → cellular organisms → Bacteria → Proteobacteria1038Open in IMG/M
3300031946|Ga0310910_10918175All Organisms → cellular organisms → Bacteria686Open in IMG/M
3300031947|Ga0310909_10042032All Organisms → cellular organisms → Bacteria3462Open in IMG/M
3300031947|Ga0310909_10406124All Organisms → cellular organisms → Bacteria1144Open in IMG/M
3300031947|Ga0310909_11161041All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium626Open in IMG/M
3300031954|Ga0306926_10134420All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3058Open in IMG/M
3300031954|Ga0306926_11991499All Organisms → cellular organisms → Bacteria → Proteobacteria653Open in IMG/M
3300031954|Ga0306926_12002602All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300032001|Ga0306922_12175389All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300032035|Ga0310911_10579587All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300032035|Ga0310911_10670558All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300032042|Ga0318545_10238482All Organisms → cellular organisms → Bacteria → Proteobacteria652Open in IMG/M
3300032044|Ga0318558_10467099All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium629Open in IMG/M
3300032044|Ga0318558_10495646All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium610Open in IMG/M
3300032059|Ga0318533_11408466All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium509Open in IMG/M
3300032066|Ga0318514_10700961All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300032076|Ga0306924_11697572All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300032091|Ga0318577_10024483All Organisms → cellular organisms → Bacteria2549Open in IMG/M
3300032094|Ga0318540_10415798All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300032160|Ga0311301_10220755All Organisms → cellular organisms → Bacteria3197Open in IMG/M
3300032174|Ga0307470_11255255All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300034268|Ga0372943_0163873All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1360Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil26.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil18.11%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.87%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil7.87%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil5.51%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.72%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.15%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds3.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.36%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa2.36%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.57%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.57%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil1.57%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.57%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.57%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.57%
Termite GutHost-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut1.57%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.79%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.79%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.79%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.79%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.79%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.79%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.79%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.79%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000893Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A001EnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300002560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cmEnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010162Labiotermes labralis P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P1 (version 2)Host-AssociatedOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010369Labiotermes labralis P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P1 (version 3)Host-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300014154Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015EnvironmentalOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021358Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3Host-AssociatedOpen in IMG/M
3300021372Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R01EnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021439Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03EnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300021976Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c1EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027034Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027371Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027376Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027548Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027667Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027737Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027829Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300028798Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2EnvironmentalOpen in IMG/M
3300030618II_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032042Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300034268Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
AP72_2010_repI_A001DRAFT_105708213300000893Forest SoilMAEPRQNRGPFQIQVSYSFDRLLEPKLAQAYEILVPCREHPVG
F14TB_10076330633300001431SoilMAEPRLKSGSWQIHVSYSFDRLLEXKLAQAYDILVPTREHPVGG
JGI12635J15846_1079623723300001593Forest SoilMAEPHPRGDPFRIHIAYAFDRLLEAKITQAYEILVPRR
C688J18823_1065568213300001686SoilMAEPHRKSGHFQVDVSYSFDRLLESKLAQAYEILVPCRERPVGAPV
JGI25383J37093_1016643823300002560Grasslands SoilMAEPRPKGGPLQIHVSYSFDRLLESKLAQAYDILVPTRERPIGGRVKE
Ga0066395_1079731113300004633Tropical Forest SoilMAEPHRKSGSFQVHVSYSFDRLLEPKLAQAYEILVPCRERPVG
Ga0066388_10680636813300005332Tropical Forest SoilMAEPHRKSGSFQVHASYSFDRLLEPKLAQAYEILVPCRERPVGA
Ga0070713_10019297843300005436Corn, Switchgrass And Miscanthus RhizosphereMAEPPAKSGPWQIHVSYSFDRLFESKLAQAYEILVPARERPVA
Ga0066682_1023200233300005450SoilMAEPRLKSGSWQIHVSYSFDRLLESKLARAYDILVPTREQP
Ga0070707_10132122913300005468Corn, Switchgrass And Miscanthus RhizosphereMAEPRPKGGPLQIHVAYSFDRLLESKLAQAYDILVPRRERPVGG
Ga0066707_1057572813300005556SoilMAEPRPKGGPLQIHVSYSFDRLLESKLAQAYDILVPTR
Ga0066654_1055757823300005587SoilMAEPHRKSGHFQVEVSYSFDRLLESKLAQAYEILVHAVSAPSAHP*
Ga0066903_10452629713300005764Tropical Forest SoilMAEPHRKSGHSQVQVSYSFDRLLEPKLAQAYEILV
Ga0066903_10831046413300005764Tropical Forest SoilMAEPHRKSGSFQVHVSYSFDRLLEPKLAQAYEILVPC
Ga0070717_1009715363300006028Corn, Switchgrass And Miscanthus RhizosphereMAEPRPKSGSFQIHVSYSFDRLLEPKLAQAYDILVP
Ga0070717_1172465113300006028Corn, Switchgrass And Miscanthus RhizosphereMAEPHRKSGHFQVDVSYSFDRLLESKLAQAYEILVPCRKRPV
Ga0075029_10052690323300006052WatershedsMAEPRQNRDAFQIQVSYSFDRLLEPKLARAYEILVPCREHP
Ga0075017_10129598813300006059WatershedsMAEPRLKSGAWQIHVSYSFDRLLESKLAQAYDILVPTRE
Ga0075015_10004499043300006102WatershedsMPFCALCKGMAEPRHKSGPFQIQVSFSFDRLLALKLAQAYEILVPCRE
Ga0075014_10010883443300006174WatershedsMPEPRQNRGAFQIQVSYSFDRLLEPKLAQAYELLVP
Ga0075014_10074474923300006174WatershedsMAEPRARSGPLQIQVDYAFDRLLESKLAQAYDILVPRRERPVGAPVK
Ga0079221_1059468533300006804Agricultural SoilMAEPHRKSGSFQIQVSYSFDRLLELKLAQAYDILVP
Ga0066710_10165906413300009012Grasslands SoilMAEPHRKSGHFQVEVSYSFDRLLESKLAQAYEILVPCRERPVGAPVK
Ga0099829_1115399613300009038Vadose Zone SoilMAEPRQKSGSFQIHVSYSFDRLLEPKLAQAYDILVPC
Ga0099828_1187533213300009089Vadose Zone SoilMAEPGQKSGSFQIHVSYSFDRLLEPKLAQAYDILVPC
Ga0075423_1283246113300009162Populus RhizosphereMAEPRPKSGPLQIHVSYSFDRLLESKLAQAHDILVPLRERPVGGR
Ga0126373_1184626733300010048Tropical Forest SoilMAEPRQNSGAFHIHISYSFDRLLEPKLAQAYEILVPCRE
Ga0131853_1083448913300010162Termite GutMAEPQRRSGPFRIHIAYSFDRLLETKLAQAYETLVPCCER
Ga0126376_1287607913300010359Tropical Forest SoilMAEPHRKSGSFQVHVSYSFDRLLEPKLAQAYEILVPCRE
Ga0126379_1293156013300010366Tropical Forest SoilMAEPRRKSGHFQIHVAYSFDRLLEPKLAQAYEILVPCRER
Ga0136643_1085956413300010369Termite GutMAEPQRKSGPFRIDIAYCFDRLLETKLAQAYETLVPCRERF
Ga0126381_10019271813300010376Tropical Forest SoilMAEPRQNRGPFQIQVSYSFDRLLEPKLAQAYEILV
Ga0126381_10294178033300010376Tropical Forest SoilMAEPRQNRGAFQIQVSYLFDRLLEPKLAQAYELLVPCREHPVG
Ga0126381_10335844413300010376Tropical Forest SoilMAEPRRKSGHFQIQVAYSFDRLLEPKLAQAYEILVP
Ga0126381_10434013223300010376Tropical Forest SoilMAEPHRKSGSFQVHVSYSFDRLLEPKLAQAYEILVPCR
Ga0134127_1292580823300010399Terrestrial SoilMAEPRLKSGSWQIHVSYSFDRLLESKLAQAYDILVPTREQPVGGCLVDA*
Ga0150983_1607357033300011120Forest SoilMPEPRQNRDAFQIQVSYLFDRLLEPKLARAYEILVPCREHPVGARVK
Ga0137391_1111203213300011270Vadose Zone SoilMAEPRARSGPFQIYVDYAFDRLRESKLAQAYDILVPRRERPVGG
Ga0137362_1123551333300012205Vadose Zone SoilMAEPRPKSGPLQIHVSYSFDRLLESKLAQAYDILVPSRERPV
Ga0137362_1125161333300012205Vadose Zone SoilMAEPRRKSDSFQIHISYSFDRLLEAKLAQAYDILV
Ga0137380_1125418313300012206Vadose Zone SoilMAEPRPKSSPLQIHVTYSFDRLLESKLAQAYDILVPSRERPVG
Ga0137373_1096902013300012532Vadose Zone SoilMAEPRRKSSRFQIRVSYSFDRLLEPKLAQAYDILVPCRERPV
Ga0137416_1106231913300012927Vadose Zone SoilMAEPRPKSGPLQIHVAYSFDRLLESKLAQAYDILVPRRERPVG
Ga0126369_1141444233300012971Tropical Forest SoilMAEPHRKSGSFQVHVSYSFDRLLEPKLAQAYEILV
Ga0126369_1226410633300012971Tropical Forest SoilMAEPHRKSGSFQIHVSYSFDRLLEPKLARAYEILVPCRERP
Ga0134110_1008229833300012975Grasslands SoilMAEPRRKSGPFQIHASYSFDRLLEPKLAQAYDILVP
Ga0134075_1032465513300014154Grasslands SoilMAEPLGRSGPLQIQIDYAFDRLCESKLAQAYSILVPCRERPMGEHVKEFAH
Ga0181532_1018512113300014164BogMAEPRQNRDAFQIQVSYSFDRLLEPKLARAYEILVPCRE
Ga0182036_1016363513300016270SoilMAEPQRKSGPFRVHIAYSFDRLLEAKLAQAYEILVP
Ga0182036_1020574013300016270SoilMAEPHPRSGPFRIHIAYSFDRLLEAKLAQAYEILV
Ga0182036_1037589013300016270SoilMAEPRQKSGPFQIHVAYWFDRLLEPKLAQAYNILVPCRERPIGVR
Ga0182035_1013602413300016341SoilMAEPRAKSGPLQIQVDYVFDRLLESKLAQAYDILVPRRERPVGGRVKE
Ga0182035_1097802713300016341SoilMAEPRRTSGPLQIHVAYWLDRLLEPKLAQAYELLVPCRERPVG
Ga0182035_1208759223300016341SoilMAEPRLKSGLWQIHVSYSFDRLLESKLAQAYDILVPTREY
Ga0182034_1026090713300016371SoilMAEPRLKSGLWQIQVSYSFDRLLESKLAQAYDILVPTREYPVG
Ga0182034_1123277013300016371SoilMAEPRQSRGPFQIQVSYSFDRWLEPKLAQAYDILVPC
Ga0182034_1134143723300016371SoilMAEPHPKSGPFRIHIAYSFDRLLEAKLAQAYEILVPC
Ga0182040_1079874113300016387SoilMAEPRSKSGPFQIQISYSFDRLLESKLAQAYDILVPCRERPVG
Ga0182037_1167505223300016404SoilMAEPHRKSGSFQVHVSYSFDRLLEPKLAQAYEILVPCRER
Ga0182039_1146930223300016422SoilMAEPQRKSGPFRVHIAYSFDRLLEAKLAQAYEILV
Ga0182039_1188294013300016422SoilMAEPRQNRGPFQIQVSYSFDRLLEPKLAQAYELLVPCREHPV
Ga0182038_1147868613300016445SoilMAEPHQNRGAFQIQVSYLFDRLLEPKLAQAYELLVPCREHPVG
Ga0173482_1066316713300019361SoilMAEPHRKSGHFQVHVSYSFDRLLESKLAQAYEILVPCRERLVGAR
Ga0179594_1027661713300020170Vadose Zone SoilMADPRPKSGSFQIHVSYSFDRLLEAKLAQAYDILVPCRERPVGVRVK
Ga0210404_1071575413300021088SoilMAEPRPKSGPLQIHVSFSFDRLLESKLAQAYDILVPLRE
Ga0213873_1019840813300021358RhizosphereMAEPHRKSGHFQVHVSYSFDRLLESKLEQAYEILVPCRERLVGAR
Ga0213877_1017537533300021372Bulk SoilMAEPRQNRGAFQIQVSYLFDRLLEPKLAQAYELLVPCREHPV
Ga0210386_1163795413300021406SoilMAEPRSRSGPLQIHVDYVFDRLLESKLAQAYDLLV
Ga0210394_1183781723300021420SoilMAEARLRSGVWQIHISYSFDRLLESKLAQAYDILVPTRERPVGG
Ga0213879_1011879113300021439Bulk SoilMAEPYRKSGHFHVNVSYSFDRLLEPKLAQAYEILVPCRERPVGASVK
Ga0210392_1045691713300021475SoilMAEPHPRDDPFRIHIAYAFDRLLEAKLTQAYEILVP
Ga0210398_1123477313300021477SoilMAEPHPRGDPFRVHIAYSFDRLLESKLTQAYEILVPCRERPVGV
Ga0210402_1009780033300021478SoilMAEPHRKSGSFQIQVSYSFDRLLELKLAQAYDILTE
Ga0126371_1220304613300021560Tropical Forest SoilMAEPHRKSGSFQVHVSYSFDRLLEPKLAQAYEILVP
Ga0193742_113214433300021976SoilMAEPRLKSGLWQIHVSYSFDRLLESKLAQAYDILAPTREEPVGGCL
Ga0207684_1078954133300025910Corn, Switchgrass And Miscanthus RhizosphereMAEQHRKSASFQIQVSYSFDRLLELKLAQAYDILVPCRERPVG
Ga0207700_1013658543300025928Corn, Switchgrass And Miscanthus RhizosphereMAEPRQNRDAFQIQVSYSFDRLLEPKLARAYEILVPCRAHPV
Ga0179587_1093164213300026557Vadose Zone SoilMAEPRQNRDAFQIQVSYSFDRLLEPKLVRAYEILVPCREHPVG
Ga0209730_102182013300027034Forest SoilMAESRQNRDAFQIQVSYSFDRLLEPKLARAYEILVPCR
Ga0209418_106508523300027371Forest SoilMAEPRTKSGPFQIHVSYSFDRLLESKLVQAYDREVGM
Ga0209004_105646733300027376Forest SoilMAEPRTKSGPFQIHVSYSFDRLLESKLVQAYDILVPC
Ga0209523_108313733300027548Forest SoilMAEPRQNRGAFQIQVSYLFDRLLDPKLAQAYELLVPCREHPVGARV
Ga0209009_110338113300027667Forest SoilMAEPRPKSGPLQIHVAYSFDRLLESKLAQAYDILVPR
Ga0209038_1017201813300027737Bog Forest SoilMAEPRTKSGPFQIHVSYSFDRLLESKLVQAYDILVPCRER
Ga0209773_1041580623300027829Bog Forest SoilMAEPRTKSGPFQIHVSYSFDRLLESKLVQAYDILVPCRERPVGG
Ga0302222_1038608113300028798PalsaMAEPRPRGDPYRVHIAYSFDRLLESKLTQAYEILVPCRERAVGVG
Ga0311354_1031102143300030618PalsaMAEQRLKSGAWQIHVSYSFDRLLESKLAQAYNILAPTRERPVGGKESE
Ga0311354_1126401913300030618PalsaMAEPRPRGDPYRIHIAYSFDRLLESKPTQAYEILVPCRERVIG
Ga0318541_1055609923300031545SoilMAESHRKSGSFQVHVSYSFDRLLEPKLAQAYEILVPCRERPVGACLK
Ga0318541_1066722313300031545SoilMAEPRCKSGPLEIHVAFVFDRLLESKLAQAYSILVPTRERPVE
Ga0318538_1078652013300031546SoilMADPRARSSPLQIKVDYAFDRLLQSKLAQAYDILVPLRERPVGG
Ga0318528_1050997433300031561SoilMAEPRLKSGLWQIHVSYSFDRLLESKLAQAYDILVPTREYPVGGCVK
Ga0310915_1100962823300031573SoilMAEPHQNRGAFQIQVSYLFDRLLEPKLAQAYELLVPCREHPVGVK
Ga0318561_1048650233300031679SoilMAEPGRKSGPLQIHVAYWFDRLLEPKLAQAYEILVPCRER
Ga0318574_1077158013300031680SoilMAEPRQNRGPFQIQVSYSFDRLLEPKLAQAYEILVPRRDIPSGRA
Ga0306917_1153737823300031719SoilMAEPRQNRGPFQIQVSYSFDRLLEPKLAQAYELLVPCRE
Ga0318521_1033231713300031770SoilMAEPRQNRGPFQIQVSYSFDRLLEPKLAQAYEILVPRREHP
Ga0318567_1064933213300031821SoilMAEPRQSRGPFQIQVSYSFDRWLEPKLAQAYDILVPCRE
Ga0318567_1076133433300031821SoilMAEPRQNRGPFQIQVSYSFDRLLEPKLAQAYELLVPC
Ga0310917_1017415533300031833SoilMAEPRAKSGPLQIQVDYVFDRLLESKLAQAYDILV
Ga0310917_1078365623300031833SoilMAEPHQNRGAFQIQVSYLFDRLLEPKLAQAYELLV
Ga0306919_1119611223300031879SoilMAEPRQNRGPFQIQVSYSFDRLLEPKLAQAYEILVPRREHPVGARVKE
Ga0306925_1153182823300031890SoilMAEPRQNRGPFQIQVSYSFDRLLEPKLAQAYELLVPCREHP
Ga0306923_1079701233300031910SoilMAEPQRKSGPFRIHIAYSFDRLLDPKLTQAYDILVPCRERAV
Ga0310912_1096951213300031941SoilMAEPRSKSGPFQIQISYSFDRLLESKLAQAYDILVPCR
Ga0310913_1035462413300031945SoilMAEPRQNRGAFQIQVSYLFDRLLEPKLAQAYELLVPCREHPVGVK
Ga0310910_1091817533300031946SoilMAEPHPRSGPFRIHIAYSFDRLLEAKLAQAYEILVPC
Ga0310909_1004203213300031947SoilMAEPGRKSGPLQIHVAYWFDRLLEPKLAQAYEILVPCRERP
Ga0310909_1040612423300031947SoilMAEPRSKSGPLEIHVAYVFDRLLESKLAQAYSILVPTRECPVERVKECDH
Ga0310909_1116104113300031947SoilMAEPRQNSGAFQIHVSYSFDRLLEPKLAQAYEILVPCR
Ga0306926_1013442033300031954SoilMAEPRQNRGPFQIQVSYSFDRLLEPKLAQAYEILVPCRETPCRGAREGVRR
Ga0306926_1199149913300031954SoilMAEPHRRGGPFRIHIAYSFDRLLEAKLAQAYEILV
Ga0306926_1200260213300031954SoilMAEPHQNRGAFQIQVSYLFDRLLEPKLAQAYELLVPC
Ga0306922_1217538913300032001SoilMAEPRLKSGSWQIHVSYSFDRLLESKLAQAYDLLVP
Ga0310911_1057958713300032035SoilMAEPHRKSGSIQVHVSYSFDRLLEPKLAQAYEILVPCRERP
Ga0310911_1067055813300032035SoilMAEPRCKSGPLEIHVAFVFDRLLESKLAQAYSILVPTRERPVERVKECD
Ga0318545_1023848213300032042SoilMAEPRQSRGPFQIQVSYSFDRWLEPKLAQAYDILVPCRERPL
Ga0318558_1046709923300032044SoilMAEPRQNRDPFQIQVSYSFDRLLEPKLAQAYEILVPRREHPVG
Ga0318558_1049564613300032044SoilMAEPHRKSGSIQVHVSYSFDRLLEPKLAQAYEILVPCRERPVGACVK
Ga0318533_1140846613300032059SoilMAEPRQNSGAFQIHVSYSFDRLLEPKLAQAYEILVPCRECPAGVRV
Ga0318514_1070096123300032066SoilMAEPRQNRGPFQIQVSYSFDRLLEPKLAQAYELLVPCRERPVGVK
Ga0306924_1169757213300032076SoilMAEPHQNRGAFQIQVSYLFDRLLEPKLAQAYELLVPCRE
Ga0318577_1002448313300032091SoilMAEPRQSRGPFQIQVSYSFDRLLEPKLAQAYDILVPCRE
Ga0318540_1041579823300032094SoilMAEPRCKSGPLEIHVAFVFDRLLESKLAQAYSILVPTRERPVERVK
Ga0311301_1022075533300032160Peatlands SoilMAEPRQNRDAFQIQVSYSFDRLLEPKLARAYEILVPCREEYEILCDST
Ga0307470_1125525523300032174Hardwood Forest SoilMAEPHRKSGSFQIQVSYSFDRLLELKLAQAYDILVPCRERPVGVKE
Ga0372943_0163873_2_1093300034268SoilMAEPHRKSGHFQVDVSYSFDRLLESKLAQAYEILVP

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.