Basic Information | |
---|---|
Family ID | F066065 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 127 |
Average Sequence Length | 45 residues |
Representative Sequence | TGHTFQHYLSLADAFKGKRAPFDPKVIGLLADWLRNEAITHED |
Number of Associated Samples | 110 |
Number of Associated Scaffolds | 127 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 97.64 % |
% of genes from short scaffolds (< 2000 bps) | 92.91 % |
Associated GOLD sequencing projects | 105 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.33 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (99.213 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (26.772 % of family members) |
Environment Ontology (ENVO) | Unclassified (43.307 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (59.055 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.07% β-sheet: 0.00% Coil/Unstructured: 54.93% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 127 Family Scaffolds |
---|---|---|
PF00903 | Glyoxalase | 52.76 |
PF12681 | Glyoxalase_2 | 29.92 |
PF02629 | CoA_binding | 12.60 |
PF00535 | Glycos_transf_2 | 0.79 |
PF00202 | Aminotran_3 | 0.79 |
PF13646 | HEAT_2 | 0.79 |
PF07578 | LAB_N | 0.79 |
PF01435 | Peptidase_M48 | 0.79 |
PF01408 | GFO_IDH_MocA | 0.79 |
COG ID | Name | Functional Category | % Frequency in 127 Family Scaffolds |
---|---|---|---|
COG3952 | Uncharacterized N-terminal domain of lipid-A-disaccharide synthase | General function prediction only [R] | 0.79 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 100.00 % |
Unclassified | root | N/A | 0.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000597|AF_2010_repII_A1DRAFT_10142624 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300000955|JGI1027J12803_102356543 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300000955|JGI1027J12803_108808734 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 851 | Open in IMG/M |
3300002914|JGI25617J43924_10266900 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
3300004156|Ga0062589_102826851 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300004157|Ga0062590_101354893 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
3300004157|Ga0062590_102518449 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300005166|Ga0066674_10556145 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300005171|Ga0066677_10695366 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300005181|Ga0066678_10362747 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
3300005184|Ga0066671_10188886 | All Organisms → cellular organisms → Bacteria | 1231 | Open in IMG/M |
3300005187|Ga0066675_11267341 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300005293|Ga0065715_11190126 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300005336|Ga0070680_102015158 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300005445|Ga0070708_100547856 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
3300005446|Ga0066686_10366821 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
3300005446|Ga0066686_10608458 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
3300005450|Ga0066682_10447694 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
3300005451|Ga0066681_10030607 | All Organisms → cellular organisms → Bacteria | 2837 | Open in IMG/M |
3300005457|Ga0070662_100577748 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
3300005467|Ga0070706_100469708 | All Organisms → cellular organisms → Bacteria | 1170 | Open in IMG/M |
3300005467|Ga0070706_102127329 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300005536|Ga0070697_100022676 | All Organisms → cellular organisms → Bacteria | 4987 | Open in IMG/M |
3300005536|Ga0070697_100761634 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
3300005540|Ga0066697_10743494 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300005553|Ga0066695_10461478 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 783 | Open in IMG/M |
3300005555|Ga0066692_10899118 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300005558|Ga0066698_10368599 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
3300005561|Ga0066699_10877242 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
3300005566|Ga0066693_10390557 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
3300005568|Ga0066703_10091791 | All Organisms → cellular organisms → Bacteria | 1772 | Open in IMG/M |
3300005574|Ga0066694_10504712 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
3300005575|Ga0066702_10746088 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
3300005587|Ga0066654_10850331 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
3300005764|Ga0066903_109057831 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300006028|Ga0070717_10016868 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae | 5670 | Open in IMG/M |
3300006032|Ga0066696_10358072 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales | 951 | Open in IMG/M |
3300006034|Ga0066656_10503519 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
3300006173|Ga0070716_100507259 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae | 891 | Open in IMG/M |
3300006796|Ga0066665_11697695 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300006800|Ga0066660_10332395 | All Organisms → cellular organisms → Bacteria | 1226 | Open in IMG/M |
3300006800|Ga0066660_10556959 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
3300007255|Ga0099791_10063939 | All Organisms → cellular organisms → Bacteria | 1661 | Open in IMG/M |
3300007255|Ga0099791_10585291 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300007258|Ga0099793_10392236 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
3300007265|Ga0099794_10372434 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
3300009012|Ga0066710_100403395 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2038 | Open in IMG/M |
3300009012|Ga0066710_103555979 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
3300009098|Ga0105245_13094108 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300009137|Ga0066709_101382355 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
3300009137|Ga0066709_101577789 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 941 | Open in IMG/M |
3300010048|Ga0126373_10973603 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Verrucomicrobium → unclassified Verrucomicrobium → Verrucomicrobium sp. | 913 | Open in IMG/M |
3300010303|Ga0134082_10305431 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
3300010320|Ga0134109_10493499 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300010321|Ga0134067_10166235 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 795 | Open in IMG/M |
3300010322|Ga0134084_10412774 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300010323|Ga0134086_10191533 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
3300010323|Ga0134086_10235337 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
3300010336|Ga0134071_10688384 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300010364|Ga0134066_10435974 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300010366|Ga0126379_13358298 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300011270|Ga0137391_11397077 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300012096|Ga0137389_11631592 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300012189|Ga0137388_11637358 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300012198|Ga0137364_10014621 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales | 4630 | Open in IMG/M |
3300012198|Ga0137364_11178655 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
3300012200|Ga0137382_10100619 | All Organisms → cellular organisms → Bacteria | 1906 | Open in IMG/M |
3300012201|Ga0137365_10145795 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae | 1779 | Open in IMG/M |
3300012210|Ga0137378_10693322 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae | 929 | Open in IMG/M |
3300012211|Ga0137377_10584443 | All Organisms → cellular organisms → Bacteria | 1054 | Open in IMG/M |
3300012212|Ga0150985_109964945 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales | 1185 | Open in IMG/M |
3300012351|Ga0137386_10341828 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1077 | Open in IMG/M |
3300012354|Ga0137366_10113839 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales | 2046 | Open in IMG/M |
3300012354|Ga0137366_10668742 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae | 742 | Open in IMG/M |
3300012356|Ga0137371_10329205 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1188 | Open in IMG/M |
3300012356|Ga0137371_10348540 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales | 1151 | Open in IMG/M |
3300012357|Ga0137384_11015419 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
3300012359|Ga0137385_10831487 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae | 766 | Open in IMG/M |
3300012582|Ga0137358_10030214 | All Organisms → cellular organisms → Bacteria | 3550 | Open in IMG/M |
3300012906|Ga0157295_10034732 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
3300012948|Ga0126375_11486222 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300012958|Ga0164299_11530631 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300012971|Ga0126369_10495474 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales | 1279 | Open in IMG/M |
3300012971|Ga0126369_11228541 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 839 | Open in IMG/M |
3300012976|Ga0134076_10056201 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1494 | Open in IMG/M |
3300012977|Ga0134087_10036255 | All Organisms → cellular organisms → Bacteria | 1888 | Open in IMG/M |
3300012977|Ga0134087_10823695 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300014150|Ga0134081_10068088 | All Organisms → Viruses → Predicted Viral | 1084 | Open in IMG/M |
3300014157|Ga0134078_10585890 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300014166|Ga0134079_10365669 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
3300015357|Ga0134072_10357523 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300017656|Ga0134112_10097776 | All Organisms → cellular organisms → Bacteria | 1101 | Open in IMG/M |
3300018027|Ga0184605_10244414 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae | 815 | Open in IMG/M |
3300018061|Ga0184619_10108264 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1253 | Open in IMG/M |
3300018482|Ga0066669_12147850 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300019789|Ga0137408_1333580 | All Organisms → cellular organisms → Bacteria | 1809 | Open in IMG/M |
3300019999|Ga0193718_1024293 | All Organisms → cellular organisms → Bacteria | 1345 | Open in IMG/M |
3300020010|Ga0193749_1051404 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae | 789 | Open in IMG/M |
3300020015|Ga0193734_1033375 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae | 965 | Open in IMG/M |
3300020015|Ga0193734_1077615 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
3300020170|Ga0179594_10386328 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300020579|Ga0210407_11156844 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
3300021344|Ga0193719_10142089 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae | 1038 | Open in IMG/M |
3300025911|Ga0207654_10663232 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
3300025939|Ga0207665_11517877 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300026301|Ga0209238_1213487 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300026317|Ga0209154_1294505 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300026323|Ga0209472_1318891 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300026328|Ga0209802_1238900 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
3300026331|Ga0209267_1124820 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1082 | Open in IMG/M |
3300026343|Ga0209159_1079122 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales | 1485 | Open in IMG/M |
3300026523|Ga0209808_1247920 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300026524|Ga0209690_1074391 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales | 1444 | Open in IMG/M |
3300026527|Ga0209059_1094398 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1238 | Open in IMG/M |
3300026529|Ga0209806_1200369 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
3300028819|Ga0307296_10408441 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae | 742 | Open in IMG/M |
3300028828|Ga0307312_11159135 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300030916|Ga0075386_11951768 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 714 | Open in IMG/M |
3300030991|Ga0073994_12179465 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300031446|Ga0170820_16831476 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
3300031720|Ga0307469_11978650 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300031942|Ga0310916_11426057 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300032001|Ga0306922_10007312 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 10652 | Open in IMG/M |
3300032001|Ga0306922_10815201 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 975 | Open in IMG/M |
3300032035|Ga0310911_10038548 | All Organisms → cellular organisms → Bacteria | 2434 | Open in IMG/M |
3300032180|Ga0307471_100547239 | All Organisms → cellular organisms → Bacteria | 1311 | Open in IMG/M |
3300033412|Ga0310810_10517410 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1180 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 26.77% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 18.11% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 12.60% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.87% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.30% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.51% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.36% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.57% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.57% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.57% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.57% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.79% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.79% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.79% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.79% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.79% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.79% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.79% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.79% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012906 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1 | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300019999 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a1 | Environmental | Open in IMG/M |
3300020010 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s2 | Environmental | Open in IMG/M |
3300020015 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m1 | Environmental | Open in IMG/M |
3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300030916 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
AF_2010_repII_A1DRAFT_101426241 | 3300000597 | Forest Soil | EIPQTGHTFQHYLSLADAFKGKSAPFDPKIIGLLADWLRNEAITHED* |
JGI1027J12803_1023565431 | 3300000955 | Soil | YEIPNTGHTFQHYLSLADAFKGKSAPFDPKVIALLADWLRNKAITHED* |
JGI1027J12803_1088087342 | 3300000955 | Soil | LSLADAFKGKSAPFEPKIIGLLADWLRNEAITHED* |
JGI25617J43924_102669002 | 3300002914 | Grasslands Soil | FQHYLSLADAFKGKSAPFDPKVIGLLADWLRNKAITHED* |
Ga0062589_1028268512 | 3300004156 | Soil | ASFYEIPNTGHTFQHYLSLADAFKGKSTPFDPKVIALLADWLRNKAITHED* |
Ga0062590_1013548931 | 3300004157 | Soil | GHTFQHYLSLADAFKGKSAPFDPKIIGLLGDWLRNQAITHED* |
Ga0062590_1025184492 | 3300004157 | Soil | FYEIPNTGHTFQHYLSLADAFKGKSAPFDPKVIGLLADWLRNRAITHED* |
Ga0066674_105561451 | 3300005166 | Soil | TFQHYLSLVDAFKGKRAQFDPKMIGLLTDWLSNQAITHED* |
Ga0066677_106953661 | 3300005171 | Soil | WASKNGADANAYEVPQMGHTFQHYVSLVDAFKGKEAPFDPKVTGLLVDWLKKEGVTHED* |
Ga0066678_103627471 | 3300005181 | Soil | YEVPQMGHTFQHYLNFADAFKGKSAPFDSKLTGLLVDWLKHEAITRED* |
Ga0066671_101888861 | 3300005184 | Soil | NGADANAYEVPQMGHTLQHYVSLVDAFKGKEAPFDPKVTGLLVDWLKKEGVTHED* |
Ga0066675_112673412 | 3300005187 | Soil | FQHYLNFADAFKGKSAPFDPKVTGILVDWLKHEAITRED* |
Ga0065715_111901261 | 3300005293 | Miscanthus Rhizosphere | DTGHTFQHYLSLVDAFKGKRAPFDPKMIGLLADWLQNKAITHED* |
Ga0070680_1020151581 | 3300005336 | Corn Rhizosphere | FYEIPQTGHTFQHYLSLADAFKGKRAPFDPKVIGLLSDWLRNEAIAHED* |
Ga0070708_1005478561 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MGHTFQHYLSWADAFKGKAAPFDPKVTGLLIDWLKHEAITRED* |
Ga0066686_103668211 | 3300005446 | Soil | TGHTFQHYLSLADAFKGKRAKFDPKMIALLTDWLGNQAITHED* |
Ga0066686_106084583 | 3300005446 | Soil | YEIPNTGHTFQHFLSLADAFKGKSASFDPKVTGLLADWLHNRAITHED* |
Ga0066682_104476941 | 3300005450 | Soil | TFQHYLTLADAFKGKSAPFDPKVTGLLVDWLKHEAITRED* |
Ga0066681_100306075 | 3300005451 | Soil | RQLAFSYEVPQMGHTFQHYLTLVDAFKGKSAPFDPKVTGLLVDWLKHEAITRED* |
Ga0070662_1005777483 | 3300005457 | Corn Rhizosphere | FQHYLSLADAFKGKSAPFDPKIIGLLADWLRNQAITHED* |
Ga0070706_1004697081 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MGHTFQHYLSFGDAFKGKSAPFDPKVTGLLVDWLKHEAIIRED* |
Ga0070706_1021273291 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | AYAYEVPKMGHTFQHYLSLADAFKGKEAPFDPKVIGLLTDWLMKEGVTHED* |
Ga0070697_1000226761 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | HTFQHYLSFADAFKGKSAPFDPKVTGLLVDWLKHEAITRED* |
Ga0070697_1007616343 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | AGHTFQHYLSLADAFRGKSAPFDPKMIALLADWLRNKAITHED* |
Ga0066697_107434942 | 3300005540 | Soil | AYEVPKMGHTFQHYLNLADAFKDKEASFDPKVIGLLTDWLMKEGITHED* |
Ga0066695_104614783 | 3300005553 | Soil | AAYVYKNGSGASAYSYEVPQMGHTFQHYLSVADAFRGKSAPFDSNTTGLLVDWLLKEELTRDN* |
Ga0066692_108991182 | 3300005555 | Soil | TFQHYLSFADAFKGKSAPFDPKVTGLLVDWLKHEAITRED* |
Ga0066698_103685993 | 3300005558 | Soil | QHYLSLADAFKGKRAPFDPKMIGLLADWLQNKAITHED* |
Ga0066699_108772423 | 3300005561 | Soil | HYLSLADAFKDKRAHFDPKVIGLLTDWLNNKAITHED* |
Ga0066693_103905571 | 3300005566 | Soil | ANDEDAYAYEVPKMGHTFQHYLNLADAFKDKEASFDPKVIGLLTDWLMKEGITHED* |
Ga0066703_100917911 | 3300005568 | Soil | SLADAFKGKSAPFDPKVIGLLADWLRNKAITHED* |
Ga0066694_105047121 | 3300005574 | Soil | GHTFQHYLSLADAFKGKSAPFDPKMIGLLADWLCNQAITHED* |
Ga0066702_107460881 | 3300005575 | Soil | TFQHYLNFADAFKGKSAPFDPKVTGLLVDWFKHEAITRED* |
Ga0066654_108503311 | 3300005587 | Soil | PNTGHTFQHYLSLADAFKGKSAPFDPKVIALLADWLRNKAITHED* |
Ga0066903_1090578312 | 3300005764 | Tropical Forest Soil | SFYEIPNTGHTFQHYLSLADAFKDKRAHFDPKVIGLLTDWLNNKAITHED* |
Ga0070717_100168689 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LNLADAFKGKEASFDPKVISLLTDWLKNEGITHED* |
Ga0066696_103580721 | 3300006032 | Soil | TGHTFQHYLSLADAFKGRSAPFDSKVIGLLVDWLTNKAITHED* |
Ga0066656_105035193 | 3300006034 | Soil | LAFSYEVPQMGHTFQHYLTLADAFKGKSAPFDPKVTGLLVDWLKHEAITRED* |
Ga0070716_1005072591 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | HYLSLADAFKGKRARFDPNIIGLLTDWLQNKAITHED* |
Ga0066665_116976952 | 3300006796 | Soil | QYLNLADAFKDKEASFDPKVIGLLTDWLMKEGITHED* |
Ga0066660_103323951 | 3300006800 | Soil | QLAFSYEVPQMGHTFQHYLNFADAFKGKSAPFDPKVTGLLVEWLKHEAITRED* |
Ga0066660_105569594 | 3300006800 | Soil | FQHYLSFADAFKGKSAPFDPKVTGLLVDWLKHEAITRED* |
Ga0099791_100639391 | 3300007255 | Vadose Zone Soil | SNRQLAFSYEVPQMGHTFQHYLTLADAFKGKSAPFDPKVTGLLVDWLKHEAITRED* |
Ga0099791_105852912 | 3300007255 | Vadose Zone Soil | VPQMGHTFQHYSSFADAFKGKSAPFDPKITGLLVDWVKHEAITRED* |
Ga0099793_103922362 | 3300007258 | Vadose Zone Soil | MGHTFQHYLNFADAFKGKSAPFDPKVTGLLVDWLKHEAITRED* |
Ga0099794_103724341 | 3300007265 | Vadose Zone Soil | YVSAKGGDAYAYEVPKMGHTFQHYLNLADAFKGKEAPFDSKVIQLLTDWLMKEGVTHED* |
Ga0066710_1004033951 | 3300009012 | Grasslands Soil | HTFQHYLSFADAFKGKSAPFDPKVTGLLVDWLKHEAITRED |
Ga0066710_1035559791 | 3300009012 | Grasslands Soil | DTGHTFQHYLSLADAFKGKRAPFDPKMIGLLADWLQNKAITHED |
Ga0105245_130941082 | 3300009098 | Miscanthus Rhizosphere | HTFQHYLSLADAFKGKSAPFDPKVIGLLSDWLRNEAIAHED* |
Ga0066709_1013823551 | 3300009137 | Grasslands Soil | FYEIPNTGQTFQHYLSLADAFKGKSAPFDPKMIGLLADWLRNQAITHED* |
Ga0066709_1015777893 | 3300009137 | Grasslands Soil | LSLADAFKGKRAPFDPKVIGLLAEWLRNRAITHED* |
Ga0126373_109736031 | 3300010048 | Tropical Forest Soil | YEIPNTGHTFEHYLSLADAFKGQRAQFDPNVIGLLTDWLNNKGITHED* |
Ga0134082_103054313 | 3300010303 | Grasslands Soil | YEIPNTGHTFQHYLSLADAFKGKSAPFDPKVIGLLADWLRNKAITHED* |
Ga0134109_104934991 | 3300010320 | Grasslands Soil | FSYEVPQMGHTFQHYLTLADAFKGKSAPFDPKVTGLLVDWLKHEAITRED* |
Ga0134067_101662353 | 3300010321 | Grasslands Soil | DTGHTFQHYLSLADAFKGKKARFDPNMIGLLADWLQNEAITHED* |
Ga0134084_104127742 | 3300010322 | Grasslands Soil | AFSYEVPQMGHTFQHYLTLADAFKGKSAPFDPKVTGLLVDWLKHEAITRED* |
Ga0134086_101915331 | 3300010323 | Grasslands Soil | QMGHTFQHYLTLADAFKGKSAPFDPKVTGLLVDWLKHEAITRED* |
Ga0134086_102353373 | 3300010323 | Grasslands Soil | YVSANGGDAYADEVPKTGHTFQHYLSLADAFKGKEAPFDPKVIGLLTDWLMKEGVTHED* |
Ga0134071_106883842 | 3300010336 | Grasslands Soil | NRQLAFSYEVPQMGHTFQHYLTLADAFKGKSAPFDPKVTGLLVDWLKHEAITRED* |
Ga0134066_104359741 | 3300010364 | Grasslands Soil | LAFSYEVPQMGHTFQHYLTLVDAFKGKSAPFDPKVTGLLVDWLKHEAITRED* |
Ga0126379_133582982 | 3300010366 | Tropical Forest Soil | YEVPKMGHTFQHYFNLADAFKGKEAPFDPKVIGLVTDWLMKEGVTHED* |
Ga0137391_113970772 | 3300011270 | Vadose Zone Soil | LSLTDAFKGRRAQFDPKMIALLTDWLSNQAITHED* |
Ga0137389_116315922 | 3300012096 | Vadose Zone Soil | NFADAFKGKSAPFDSKVTGLLADWLKHEAITRED* |
Ga0137388_116373581 | 3300012189 | Vadose Zone Soil | LAFSYEVPQMGHTFQHYLSFADAFKGKSAPFDPKVTGLLVNWLKHEAITRED* |
Ga0137364_100146211 | 3300012198 | Vadose Zone Soil | SFYEIPDTGHTFQHYLSLADAFKGKKARFDPNMIGLLADWLQNKAITHED* |
Ga0137364_111786551 | 3300012198 | Vadose Zone Soil | HTFQHYLNFADAFKGKAAPFDPKVTGLLVDWLKHEAITRED* |
Ga0137382_101006194 | 3300012200 | Vadose Zone Soil | FSYEVPQMGHTFQHYLNFADAFKGRSAPFDPKVTGLFVDWLKHEAITRED* |
Ga0137365_101457954 | 3300012201 | Vadose Zone Soil | FYEIPNTGHTFQHYLSLADAFKGKSAPFDPKVIALLADWLRNKAITHED* |
Ga0137378_106933221 | 3300012210 | Vadose Zone Soil | KTGHTFQHYLSLADAFKGKEAPFDPKVIGLLTDWLMKEGVTHED* |
Ga0137377_105844431 | 3300012211 | Vadose Zone Soil | QMGHTFQHYLSFGDAFKGKSAPFDPKVTGLLVDWLKHEAITRED* |
Ga0150985_1099649451 | 3300012212 | Avena Fatua Rhizosphere | PQTGHTFQHYSSLADAFKGKSAPFDPKIIGLLGDWLRNQAITHED* |
Ga0137386_103418281 | 3300012351 | Vadose Zone Soil | YLNFADAFKGKSAPFDSKVTGLLADWLKHEAITRED* |
Ga0137366_101138394 | 3300012354 | Vadose Zone Soil | LSLADAFKGKSAPFDPKVIALLADWLRNKAITHED* |
Ga0137366_106687421 | 3300012354 | Vadose Zone Soil | EIPNTGNTFQHYLSLADAFTGKRAPFDPKVIGLLADWLRNKDITHED* |
Ga0137371_103292051 | 3300012356 | Vadose Zone Soil | HTFQHYLSLADAFKGKSAPFDPKVIGLLADWLRNKAITHED* |
Ga0137371_103485401 | 3300012356 | Vadose Zone Soil | EIPNTGHTFQHYLSLADAFKGKSAPFDPKVIALLADWLRNKAITHED* |
Ga0137384_110154193 | 3300012357 | Vadose Zone Soil | FQHYLSLADAFKGKSAPFDPKVIALLTDWLRNKAITHED* |
Ga0137385_108314873 | 3300012359 | Vadose Zone Soil | FQHYLSLADAFRGKRAPFDPKVIGLLADWLRNKAITHED* |
Ga0137358_100302141 | 3300012582 | Vadose Zone Soil | NGGDAYAYEVPKTGHTFQHYLSLADAFKGKEALFDSKVIQLLTDWLMKEGVTHED* |
Ga0157295_100347321 | 3300012906 | Soil | QTGQTFQHYLSLAYAFSGKRAPFDPKVIGLLSDWLRNEAIAHEY* |
Ga0126375_114862221 | 3300012948 | Tropical Forest Soil | TGHTFQHYLNLADAFKGKTAPFDPNVTGLLADWLRNQAITHED* |
Ga0164299_115306312 | 3300012958 | Soil | GDAYAYEVPKTGHTFQHYLSLADAFKGKEAPFDSKVIQLISDWLMKEGVTHED* |
Ga0126369_104954741 | 3300012971 | Tropical Forest Soil | PNTGHTFQHYLSLADAFKGKRARFDPNIIGLLTDWLQNKAITHED* |
Ga0126369_112285413 | 3300012971 | Tropical Forest Soil | YVSGNGGDAYAYEVPKMGHTFQHYFNLADAFKGKEASFDPKVIGLVTDWLMKEGVTHED* |
Ga0134076_100562011 | 3300012976 | Grasslands Soil | HYLSWTDAFKGNAARFDPKVTGLLIDWLKHEAITRED* |
Ga0134087_100362551 | 3300012977 | Grasslands Soil | QHYLNVADAFKGKEAPFDTKVVSLITDWLMKEGVTHED* |
Ga0134087_108236951 | 3300012977 | Grasslands Soil | HYLTLADAFKGKSAAFDPKMITLVSDWLRNKGSTHED* |
Ga0134081_100680884 | 3300014150 | Grasslands Soil | FYEIPDTGHTFQHYLSLADAFKGKRAPFDPKVIGLLADWLRNEAITHED* |
Ga0134078_105858901 | 3300014157 | Grasslands Soil | MGHTFQHYLTLVDAFKGKSAPFDPKVTGLLVDWLKHEAITRED* |
Ga0134079_103656691 | 3300014166 | Grasslands Soil | TGHTFQHYLSLVDAFKGKRAQFDPKMIGLLTDWLSNQAITHED* |
Ga0134072_103575231 | 3300015357 | Grasslands Soil | YEVPQMGHTFQHYLSFADAFKGKSAPFDPKVTGLLVDWLKHEAITRED* |
Ga0134112_100977761 | 3300017656 | Grasslands Soil | TGHTFQHYLSLADAFKGKRAPFDPKVIGLLADWLRNEAITHED |
Ga0184605_102444143 | 3300018027 | Groundwater Sediment | FYEIPNTGHTFQHYLSLADAFREKSAPFDPKMIALLADWLRNKAITHED |
Ga0184619_101082646 | 3300018061 | Groundwater Sediment | LASFYEIPQTGHTFQHYLSLADAFKGKSAPFDPKIIGLLVDWLHNEAITHED |
Ga0066669_121478501 | 3300018482 | Grasslands Soil | EIPNTGHTFQHYLSVADAFKGKRARFDPNIIGLLTDWLQNKAITHED |
Ga0137408_13335801 | 3300019789 | Vadose Zone Soil | MGHTFQHYLTLADAFKGKSAPFDPKVTGLLVDWLKHEAITRED |
Ga0193718_10242934 | 3300019999 | Soil | PNTGHTFQHYLSLADAFRGKSAPFDPKMIALLADWLRNKAITHED |
Ga0193749_10514043 | 3300020010 | Soil | FQHYLNLADAFKGKEAPFDSKVIQLLTDWLMKEGVTHED |
Ga0193734_10333751 | 3300020015 | Soil | LSLADAFKGKEAPFDPKVIGLLTDWLMKEGVTHED |
Ga0193734_10776151 | 3300020015 | Soil | QHYLSLADAFKGKSAPFDPKVVGLLADWLRNKAITHED |
Ga0179594_103863281 | 3300020170 | Vadose Zone Soil | SFYEIPDTGHTFQHYLSMADAFKGKRAPFDPKVIGLISDWLRNKAITHED |
Ga0210407_111568443 | 3300020579 | Soil | FQHYLSLSEAFKGKSAPFDPKVIGLLTDWLRNKGITHED |
Ga0193719_101420891 | 3300021344 | Soil | TFQHYLNLADAFKGREAPFDSKVIGLLTDWLMKEGVTHED |
Ga0207654_106632321 | 3300025911 | Corn Rhizosphere | TFYEIPQTGHTFQHYLSLADAFKGKRAPFDPKVIGLLSDWLRNEAIAHED |
Ga0207665_115178772 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | SFYEIPNTGHTFQHYLSLADAFKGKRARFDPNIIGLLTDWLQNKAITHED |
Ga0209238_12134873 | 3300026301 | Grasslands Soil | LNFADAFKGKSAPFDPKVTGLVVDWLKHEAITRED |
Ga0209154_12945052 | 3300026317 | Soil | VSYEVPQMGHTFQHYLSFSDAFKDRSAPFDPKVTGLLVEWLKHEAITRED |
Ga0209472_13188911 | 3300026323 | Soil | FLSLADAFKGKSASFDPKVTGLLADWLHNRAITHED |
Ga0209802_12389001 | 3300026328 | Soil | PKMGHTFQHYLSLADAFKGKEAPFDPKVIGLLTDWLMKEGVTHED |
Ga0209267_11248204 | 3300026331 | Soil | HYLSLADAFKGKRAPFDPKMIGLLADWLQNKAITHED |
Ga0209159_10791221 | 3300026343 | Soil | YEIPNTGHTFQHYLSLADAFKGKSAPFDPKVIGLLADWLRNKAITHED |
Ga0209808_12479202 | 3300026523 | Soil | PNTGHTFQHYLSLADAFKGKSAPFDPKVIGLLADWLRNKAITHED |
Ga0209690_10743911 | 3300026524 | Soil | HTFQHYLTLADAFKGKEAPFDPKVIQLLTDWLTKEGVTHED |
Ga0209059_10943984 | 3300026527 | Soil | DANAYEVPQMGHTFQHYVSLVDAFKGKEAPFDPKVTGLLVDWLKKEGVTHED |
Ga0209806_12003693 | 3300026529 | Soil | YEIPKTGHTFQHYLSLADAFKGKRAKFDPKMIALLTDWLGNQAITHED |
Ga0307296_104084413 | 3300028819 | Soil | IPNTGHTFQHYLSLADAFKGKSAPFDPKVIALLADWLRNKAITHED |
Ga0307312_111591351 | 3300028828 | Soil | GHTFQHYLSLADAFNGKQAPFDSKVIGLLADWLRNKAITHED |
Ga0075386_119517681 | 3300030916 | Soil | GHTFQHYLSLADAFNGKSAPFDPKVIGLLADWIRNKTITHED |
Ga0073994_121794652 | 3300030991 | Soil | YEVPQMGHTFQHYLNFADAFKGKSAPFDPKVTGLVVDWLKHEAITRED |
Ga0170820_168314761 | 3300031446 | Forest Soil | EIPTTGHTFQHYLSLADAFKGKSAPFDPKVVGLLADWLRNKAITHED |
Ga0307469_119786503 | 3300031720 | Hardwood Forest Soil | LSLADAFKGKSAPFDPKVIALLADWLRNKAITHED |
Ga0310916_114260572 | 3300031942 | Soil | IPQTGHTFQHYLNLVDAFKGKSAPFDPKNIGLLAEWLNNKAITHED |
Ga0306922_1000731213 | 3300032001 | Soil | AFYEIPLTGHTFQHYLSLADAFKGKSAAFDPKVVGLITDWLRNNAIAHED |
Ga0306922_108152011 | 3300032001 | Soil | PNTGHTFQHYLSLADAFKGKSAPFDPKVIALLTDWLRNKAITHED |
Ga0310911_100385481 | 3300032035 | Soil | VPKMGHTFQHYLSLADAFKGKEAQFDSKVTQLLTDWLMKEGVTHED |
Ga0307471_1005472394 | 3300032180 | Hardwood Forest Soil | NRQLAFSYEVPQMGHTFQHYLSFADAFKGKSAPFDPKVTGLLVDWLKHEAITRED |
Ga0310810_105174101 | 3300033412 | Soil | HYLSLADAFKGKSATFDSKLIGLLADWLRNEAITHED |
⦗Top⦘ |