NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F066291

Metagenome / Metatranscriptome Family F066291

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F066291
Family Type Metagenome / Metatranscriptome
Number of Sequences 126
Average Sequence Length 164 residues
Representative Sequence HVGINNNFYTSSPSPCCDYCDIQPGNHPQCMEMDIIENNGGCLAQTTWHTWPNRNGDCDEGGCWGQMYLPRGSFHVKAEFNTDGEMIVTINGNRVMVTNPTPSSNAKAYVMQTMQKLGAQFHSTQWQGWVPSGNCGGGGDLPNSVFAVHNVRVYGSVVQGQTPAGC
Number of Associated Samples 77
Number of Associated Scaffolds 126

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 1.59 %
% of genes near scaffold ends (potentially truncated) 95.24 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 71
AlphaFold2 3D model prediction Yes
3D model pTM-score0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (100.000 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(74.603 % of family members)
Environment Ontology (ENVO) Unclassified
(57.143 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(98.413 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 7.73%    β-sheet: 12.89%    Coil/Unstructured: 79.38%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.37
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 126 Family Scaffolds
PF04979IPP-2 0.79


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004789|Ga0007752_10216462All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans530Open in IMG/M
3300004796|Ga0007763_11355695All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans507Open in IMG/M
3300030528|Ga0210277_11018094All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans590Open in IMG/M
3300030529|Ga0210284_1139645All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans588Open in IMG/M
3300030531|Ga0210274_1045860All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans543Open in IMG/M
3300030532|Ga0210290_1372778All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans519Open in IMG/M
3300030532|Ga0210290_1548766All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans577Open in IMG/M
3300030535|Ga0210285_1283083All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans543Open in IMG/M
3300030535|Ga0210285_1356387All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans577Open in IMG/M
3300030543|Ga0210289_1008483All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans575Open in IMG/M
3300030548|Ga0210252_10410196All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans595Open in IMG/M
3300030549|Ga0210257_10346624All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans556Open in IMG/M
3300030549|Ga0210257_10787147All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans513Open in IMG/M
3300030551|Ga0247638_1192643All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans515Open in IMG/M
3300030553|Ga0247645_1184769All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans554Open in IMG/M
3300030564|Ga0210256_10043597All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans618Open in IMG/M
3300030564|Ga0210256_10175225All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans531Open in IMG/M
3300030570|Ga0247647_1284970All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans500Open in IMG/M
3300030572|Ga0210258_10034248All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans780Open in IMG/M
3300030572|Ga0210258_10476091All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans534Open in IMG/M
3300030572|Ga0210258_10921500All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans591Open in IMG/M
3300030573|Ga0210272_1255647All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans546Open in IMG/M
3300030574|Ga0247648_1212103All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans506Open in IMG/M
3300030575|Ga0210288_1130001All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans649Open in IMG/M
3300030575|Ga0210288_1218932All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans544Open in IMG/M
3300030581|Ga0210270_1570919All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans504Open in IMG/M
3300030581|Ga0210270_1856592All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans532Open in IMG/M
3300030586|Ga0265393_1172825All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans553Open in IMG/M
3300030586|Ga0265393_1205165All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans522Open in IMG/M
3300030588|Ga0210283_1403426All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans511Open in IMG/M
3300030589|Ga0210255_11076439All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans518Open in IMG/M
3300030595|Ga0210276_10437759All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans517Open in IMG/M
3300030595|Ga0210276_10905412All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans522Open in IMG/M
3300030596|Ga0210278_1082051All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans691Open in IMG/M
3300030597|Ga0210286_1205006All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans603Open in IMG/M
3300030597|Ga0210286_1263636All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans551Open in IMG/M
3300030598|Ga0210287_1223600All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans527Open in IMG/M
3300030598|Ga0210287_1233550All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans519Open in IMG/M
3300030605|Ga0210265_1135669All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans549Open in IMG/M
3300030614|Ga0247657_10282601All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans517Open in IMG/M
3300030615|Ga0257185_10284910All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans589Open in IMG/M
3300030622|Ga0265391_10354553All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans504Open in IMG/M
3300030625|Ga0210259_11299249All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans532Open in IMG/M
3300030627|Ga0210269_10350551All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans526Open in IMG/M
3300030630|Ga0210282_10388321All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans517Open in IMG/M
3300030631|Ga0210279_10330406All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans593Open in IMG/M
3300030738|Ga0265462_11952824All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans569Open in IMG/M
3300030738|Ga0265462_11974525All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans566Open in IMG/M
3300030738|Ga0265462_11975697All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans566Open in IMG/M
3300030738|Ga0265462_12324725All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans531Open in IMG/M
3300030740|Ga0265460_12112010All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans590Open in IMG/M
3300030740|Ga0265460_12768190All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans526Open in IMG/M
3300030743|Ga0265461_12805227All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans582Open in IMG/M
3300030743|Ga0265461_13416198All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans537Open in IMG/M
3300030743|Ga0265461_13796863All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans513Open in IMG/M
3300030743|Ga0265461_13827066All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans512Open in IMG/M
3300030748|Ga0074043_11350351All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans609Open in IMG/M
3300030748|Ga0074043_11440044All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans870Open in IMG/M
3300030779|Ga0075378_10908482All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans544Open in IMG/M
3300030800|Ga0074032_10869424All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans511Open in IMG/M
3300030803|Ga0074037_1807175All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans530Open in IMG/M
3300030803|Ga0074037_1824159All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans527Open in IMG/M
3300030841|Ga0075384_11461424All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans590Open in IMG/M
3300030842|Ga0075404_11042029All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans587Open in IMG/M
3300030842|Ga0075404_11188011All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans503Open in IMG/M
3300030842|Ga0075404_11405490All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans522Open in IMG/M
3300030843|Ga0075392_11189551All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans561Open in IMG/M
3300030843|Ga0075392_11280705All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans514Open in IMG/M
3300030845|Ga0075397_11002359All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans564Open in IMG/M
3300030848|Ga0075388_11446249All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans509Open in IMG/M
3300030849|Ga0075393_10723282All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans507Open in IMG/M
3300030850|Ga0075387_11753433All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans578Open in IMG/M
3300030851|Ga0075380_11484404All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans603Open in IMG/M
3300030852|Ga0075389_11100263All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans577Open in IMG/M
3300030852|Ga0075389_11229384All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans572Open in IMG/M
3300030853|Ga0075372_11289564All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans504Open in IMG/M
3300030854|Ga0075385_11484634All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans524Open in IMG/M
3300030909|Ga0074033_10467220All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans553Open in IMG/M
3300030934|Ga0075391_11209572All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans603Open in IMG/M
3300030935|Ga0075401_11599530All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans537Open in IMG/M
3300030938|Ga0138299_10763559All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans570Open in IMG/M
3300030939|Ga0138303_1059551All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans506Open in IMG/M
3300030939|Ga0138303_1360855All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans520Open in IMG/M
3300030946|Ga0075379_11460350All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans578Open in IMG/M
3300030949|Ga0074031_1064700All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans524Open in IMG/M
3300030970|Ga0075381_10879420All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans511Open in IMG/M
3300030970|Ga0075381_11107293All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans501Open in IMG/M
3300030970|Ga0075381_11556835All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans503Open in IMG/M
3300030980|Ga0074027_11196663All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans542Open in IMG/M
3300030996|Ga0074004_10511755All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans546Open in IMG/M
3300031008|Ga0074038_10094915All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans571Open in IMG/M
3300031022|Ga0138301_1054902All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans585Open in IMG/M
3300031022|Ga0138301_1571192All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans543Open in IMG/M
3300031023|Ga0073998_11673668All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans522Open in IMG/M
3300031031|Ga0074042_11387202All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans504Open in IMG/M
3300031035|Ga0074026_11021991All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans620Open in IMG/M
3300031049|Ga0074036_11081300All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans536Open in IMG/M
3300031057|Ga0170834_102585757All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans510Open in IMG/M
3300031057|Ga0170834_102596591All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans996Open in IMG/M
3300031057|Ga0170834_106596468All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans524Open in IMG/M
3300031057|Ga0170834_111076997All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans516Open in IMG/M
3300031057|Ga0170834_111079655All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans516Open in IMG/M
3300031057|Ga0170834_112187024All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans591Open in IMG/M
3300031057|Ga0170834_113360229All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans503Open in IMG/M
3300031122|Ga0170822_10183607All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans964Open in IMG/M
3300031122|Ga0170822_11428249All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans622Open in IMG/M
3300031122|Ga0170822_12592183All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans535Open in IMG/M
3300031122|Ga0170822_14954426All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans517Open in IMG/M
3300031122|Ga0170822_15444690All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans590Open in IMG/M
3300031122|Ga0170822_16287062All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans1036Open in IMG/M
3300031128|Ga0170823_11151606All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans521Open in IMG/M
3300031128|Ga0170823_13047336All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans573Open in IMG/M
3300031231|Ga0170824_112576143All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans716Open in IMG/M
3300031446|Ga0170820_14258332All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans716Open in IMG/M
3300031469|Ga0170819_10758371All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans501Open in IMG/M
3300031469|Ga0170819_17175672All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans528Open in IMG/M
3300031474|Ga0170818_103358738All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans561Open in IMG/M
3300031474|Ga0170818_105180449All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans565Open in IMG/M
3300031474|Ga0170818_105348740All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans503Open in IMG/M
3300031474|Ga0170818_106653969All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans544Open in IMG/M
3300031474|Ga0170818_111240220All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans520Open in IMG/M
3300032739|Ga0315741_11763328All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans548Open in IMG/M
3300032739|Ga0315741_11857977All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans531Open in IMG/M
3300032739|Ga0315741_11948236All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans516Open in IMG/M
3300032756|Ga0315742_12662387All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans573Open in IMG/M
3300032756|Ga0315742_12863592All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Noctilucales → Noctilucaceae → Noctiluca → Noctiluca scintillans555Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil74.60%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil23.02%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake1.59%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.79%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004789Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004796Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030528Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO084SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030529Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO740-VDE013SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030531Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO143-VCO038SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030532Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO410-VDE108SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030535Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO749-VDE026SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030543Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO410-VDE107SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030548Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR016SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030549Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO137-ANR102SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030551Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030553Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cnb10 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030564Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR020S0 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030570Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cnb12 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030572Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO137-ANR103SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030573Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO143-VCO036SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030574Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030575Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO747-VDE050SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030581Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO142-VCO031SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030586Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE041SO (Eukaryote Community Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300030588Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO740-VDE011SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030589Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR019SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030595Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO083SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030596Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO085SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030597Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO747-VDE046SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030598Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO747-VDE048SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030605Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE042SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030614Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb10 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030615Metatranscriptome of plant litter fungal communities from Pinus contorta in Bitterroot National Forest, Montana, United States - GP1-LITTER (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300030622Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE044SO (Eukaryote Community Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300030625Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO122-ANR120SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030627Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO153-ARE095SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030630Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO151-VCO115SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030631Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO141-VCO086SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030738Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assemblyEnvironmentalOpen in IMG/M
3300030740Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assemblyEnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300030748Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Litter C3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030779Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB1 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030800Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Mineral N1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030803Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Mineral C3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030841Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA9 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030842Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB3 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030843Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB2 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030845Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA7 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030848Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA8 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030849Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB4 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030850Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB1 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030851Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA9 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030852Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB2 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030853Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA8 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030854Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB2 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030909Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Mineral N2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030934Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB3 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030935Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA7 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030938Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_OS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030939Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A9_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030946Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA7 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030949Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Humus C3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030970Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB1 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030980Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Humus N2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030996Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Litter GP-3B (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031008Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Litter N1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031022Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031023Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil TCEFA (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031031Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Litter C2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031035Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Humus N1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031049Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Mineral C2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031122Oak Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300032739Forest Soil Metatranscriptomics Site 2 LB Combined AssemblyEnvironmentalOpen in IMG/M
3300032756Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined AssemblyEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0007752_1021646213300004789Freshwater LakeYVEFDMETSGAQGGINNNFYTSSPTGTFSYCDIQDGNHPTCMEMDIIENNGNCLAQTTWHTWPNKNGDCDQGGCWGQSYISGTFHVKATFSTDGWMQVSINGNNVNVVNPVPSNNAKDYVAQTINSLGVQFHSTQWQGWVPAGNCPGGGSLDSSRFSVRNLRVAGTVNHGPEATRC
Ga0007763_1135569513300004796Freshwater LakeCDIQDGNHPTCMEMDIIENNGNCLAQTTWHTWPNKNGDCDQGGCWGQSYISGTFHVKATFSTDGWMQVSINGNNVNVVNPVPSNNAKDYVAQTINSLGVQFHSTQWQGWVPAGNCPGGGSLDSSRFSVRNLRVAGTVNHGPEATRC*
Ga0210277_1101809413300030528SoilFDMNTTNAHVGINNNFYTSSPSPCCDYCDIQPGNHPQCMEMDIVENNGNCLSQTTWHTWPNKNGDCDEGGCWGQMYIPGSKSFHVRAAFSTDNGMIVTFNNNQVPVTNPTPSSNAKAYVIETMQKIGAQFHSTQWQGWVPGGNCGGGGNLDGSQFSVRNVRVYGTVVQGQTPAGC
Ga0210284_113964513300030529SoilTFNLIGGYVEFDMNTTFAHVGINNNFYATSPNTCCDYCDIQSGDHPQCMEMDIIENNGNCLAQTTWHTWANHNGDCDEGGCWGQMYQPGGSFHVRADFSTDSGMVVTINGNRVSVTNPTPSNNAKEYLVQTMQKLGAQFHSTQWQGWVPSGNCPGGGNLPNSVFAVRNVRVFGSVVQGPAPRGC
Ga0210274_104586013300030531SoilRRWISHLHNNNFYTSSPSPCCNYCDIQVGNHPQCMELDIIENNGDCLSQTTWHTWPNHNGDCDEGGCWGQMYQPGTHSFHVKAEWSTDGWMTVTIDGNVVQVTNPTPSNNARAYVAQIMQQLGVQFHSTQWQGWVPSGNCGGAGDLAGSVFSVDNVQVYGSVVQGQTPAGC
Ga0210290_137277813300030532SoilTSPSPCCNYCDIQQGDHPQCMEMDIIENNGNCLAQTTWHTWPNHNGDCDEGGCWGQMYHPGGSYHVKADFSADGWMTVTINGATVSVTHPVPSNNAKAYVQQTMSKIGAQFHSTQWQGWVPSGNCPGGGDLNSSVFSVQNVVVVGTVVQGQTPARC
Ga0210290_154876613300030532SoilLGGYVEFDMNTTHSHVNVNNNFYTTSPSPCCAYCDIQQGDHPQCMEMDIIENNGGCLGQTTWHTWPNHNGDCDEGGCWGQMYHSTGQYHVRADFSTDGWMTVTINGATVPVTNPTPSNNAKAYVMQTMQKLGAQFHSTQWQGWVPSGNCGGGGDLNSSQFAVMNVRVYGSVVQGQNPSGC
Ga0210285_128308313300030535SoilMNATTAHVGINNNFYTSSPTTCCDYCDIQPGNHAQCMDMDIIENNGGCLAQTTWHTWPNRNGDCDEGGCWGQMYLPRASFHVKAEFDTDGEMVVTINGNRVQVTNPTPSANAKAFVVQTMQKLGAQFHSTQWQGWVPSGNCGGGGDLPSSVFSVRNVRVYGSVLQGKVPAGC
Ga0210285_135638713300030535SoilYVEFDMNTTNAHVGINNNFYTSSPSPCCDYCDIQPGNHPQCMEMDIVENNGNCLSQTTWHTWPNKNGDCDEGGCWGQMYIPGSKSFHVRAAFSTDNGMIVTFNNNQVPVTNPTPSSNAKAYVIETMQKIGAQFHSTQWQGWVPGGNCGGGGNLDGSQFSVRNVRVYGTVVQGQTPAGC
Ga0210289_100848313300030543SoilGYVEFDMNTSAAHTNVNNNFYTSSPSPCCNYCDIQPGNHPQCMEMDIIENNGDCLSQTTWHTWPNNNGDCDEGGCWGQMYIPSGGNFHVKATFGNDGEMTVTINGNVVPVTNPTPSNNAKAYVAQTMQKIGAQFHSTQWQGWVPSGNCGGGGDLPSSVFGVHNVRVFASVVQGQTPAGC
Ga0210252_1041019613300030548SoilGYVEFDMNTTDAHVNVNNNFYTSSPSPCCNYCDIQPGNHPQCMEMDIIENNGGCLAQTTWHTWPNKNGDCDEGGCWGQMYIPGSKTFHVRADFSTDNGMIVSINNNRVPVTNPTPSGNAKAYVIQTMQQIGAQFHSTQWQGWVPSGNCGGGGNLDSSVFSVRNLRVYGSVVQGQVPAGC
Ga0210257_1034662413300030549SoilYVEFDMNTTNAHVGINNNFYTTSPSPCCDYCDIQQGNHPQCMEMDIIENNGNCLAQTTWHTWPNHNGDCDEGGCWGQMYHPAGSFHVKAEFSTDGWMTVTINGASVSVTHPVPSNNAKAYVMQTMTKIGAQFHSTQWQGWVPSGNCGGGGDLASSVFAVQNVVVYGSVVQGQTPARC
Ga0210257_1078714713300030549SoilHVGINNNFYTSSPSPCCDYCDIQPGNHPQCMEMDIIENNGGCLAQTTWHTWPNRNGDCDEGGCWGQMYLPRGSFHVKAEFNTDGEMIVTINGNRVMVTNPTPSSNAKAYVMQTMQKLGAQFHSTQWQGWVPSGNCGGGGDLPNSVFAVHNVRVYGSVVQGQTPAGC
Ga0247638_119264323300030551SoilYTSSPEVCCAYCDIQKNGSPQCMEMDIIENNGGCLAQTTWHTWPNHNGDCDEGGCWGQMKLPSSGSFHVKAEFSGDGWMTVTLNGNVVSVTNPVPSNNAKEYVAQTMARIGAQFHSTQWQGWVPGNCGGGGDLNSSIFAVRNVRVYGSVVQGKVPNRC
Ga0247645_118476913300030553SoilGINNNFYTSSPTTCCAYCDIQVGNYPQCMELDIIENNGNCVSQTTWHTWPNHNGDCDESGCMGHWTQTTHSFHVIAAFGTDGWMTVTIDGQVVDVNNPTPSNNARAYVAQQMESIGVQFHSTQWQGWVPSGNCGGNGDLNSSVFSVENVVVVGTVVQGQVPAGC
Ga0210256_1004359713300030564SoilGYVEFDMNTTRAHVNVNNNFYTTSPSPCCAYCDIQQRDHPQCMEMDIIENNGGCLGQTTWHTWPNHNGDCDEGGCWGQVYHSTGQYHVRADFSTDGWMTVSVNGATVPVTNPTPSNNAKAYVMQTMQKLGAQFHSTQWQGWVPSGNCGGGGDLNSSEFAVMNVRVYGSVVQGQNPAGC
Ga0210256_1017522513300030564SoilYTSSPSPCCDYCDIQPGNHPQCMEMDIVENNGNCLSQTTWHTWPNKNGDCDEGGCWGQMYIPGSKSFHVRAAFSTDNGMIVTFNNNQVPVTNPTPSSNAKAYVIETMQKIGAQFHSTQWQGWVPGGNCGGGGNLDGSQFSVRNVRVYGTVVQGQTPAGC
Ga0247647_128497013300030570SoilPCCDYCDIQPGNHPQCMELDIIENNGDCLSQTTWHTWPNKNGDCDESGCWGQMYQTSSHAFHVKAEWTTDGWMTVTINGDQVQVTHPVPSNNAKEYVAQIMQQLGAQFHSTQWQGWVPSGNCGGSGDLNSSVFGVHNVKVFASVVQGQTPAGC
Ga0210258_1003424813300030572SoilMTGAGGVHGKTSYNLLGGYVQFDMNTTESHVTVNNNFYTSSPSPCCNYCDIQVGNHPQCMELDIIENNGDCVSQTTWHTWPNHNGDCDEGGCWGKVDQPSSHSFHVKAEWSTDGHGTVTIDGNVVQVTNPTPSNNAVAYVAQIMQQLGVQFHSTQWQGWVPSGNCGGGG
Ga0210258_1047609113300030572SoilFYTTSPSPCCDYCDIQPGNHPQCMEMDIIENNGNCLAQTTWHTWPNRNGDCDEGGCYGQMSLPGGSFHVRADFNTDEGMVVSINGNRVAVTNPTPSGNAKAYVVSTMQKIGAQFHSTQWQGWVPGNCGGSGNLQNSVFGVHNLRVFGSVVQGQAPAGC
Ga0210258_1092150013300030572SoilGKTTYNLLGGYVEFDMNVTGAQAAINNNFYTSSPSPCCAYCDIQPNGSPQCMEMDIIENNGKCLAQTTWHTWPNKNGDCDEGGCWGQMKIPGGIFHMKAEWSTDGFMVVTMNGDRIWVTHPTPSNNAKDYVAQTMKSIGVQFHSTQWQGWVPAGDCPGGGNLGSSVFGVTNVRVSGTVVQGVTPTRC
Ga0210272_125564713300030573SoilYVEFDMNTSAAHVGINNNFYLSSPSPCCDYCDIQPGNHPQCMEMDIIENNGNCLAQTTWHTWPNRNGDCDEGGCWGQMYIPGNKVFHVRADFNTNEGMVVTINGNRVAVTNPTPSNNAKTFMVQTMQKIGAQFHSTQWQGWVPGGNCGGGGDLPGSFFGVHNLRVFADVVQGQTPSGC
Ga0247648_121210313300030574SoilSSPSPCCDYCDIQPGNHPQCMEMDIIENNGDCISQTTWHTWPNRNGDCDESGCMGQMSIPAGGNFHVKATFDPDGEMTVTINGNVVQVIHPVPSNNAKAYVAQTMQKIGAQFHSTQWQGWVPGGNCGGSGDLNSSVFGVHNVKVFASVVQGETPAGC
Ga0210288_113000113300030575SoilTTSPSPCCAYCDIQQGDHPQFMEMDIIDNNGNCLAQTTWHTWPNHNGDCDEGGCWGQMYHPAGSFHVKADFSTDGWMTVTINGATVAVTHPAPSNNAKAYVEQTMAKIGAQFHSTQWQGWVPSGNCPGGGDLASSVFAVQNVVVSGSVVQGQNTSEMLKKGL
Ga0210288_121893213300030575SoilHVNVNNNFYTTSPSPCCDYCDIQQGNHPQCMEMDIIENNGNCIAQTTWHTWPNHNGDCDEGGCWGNMYHPSGSYHVKADFSTDGWMTVTINGATVAVTHPAPSNNAKAYVMQTMAKIGAQFHSTQWQGWVPSGNCGGGGDLASSEFAVQNVVVYGSVVQGQTPALC
Ga0210270_157091913300030581SoilSSPSPCCDYGDIQPGNHPQCMEMDIIENNGGCLAQTTWHTWTNRNGDCDEGGCWGQMYIPGNKVFHVRADFDTNEGMTVTINGNRVAVTNPTPSNNAKTFMVQTMQKIGAQFHSTQWQGWVPGGNCGGGGDLPGSVFGVHNLRVFADVVQGQTPSGC
Ga0210270_185659213300030581SoilASSPSPCCNYCDIQVGNHPQCMELDIIENNGDCLSQTTWHTWPNHNGDCDEGGCWGQMYQPGTHSFHVKAEWSTDGWMTVTIDGNVVQVTNPTPSNNARAYVAQIMQQLGVQFHSTQWQGWVPSGNCGGAGDLAGSVFSVDNVQVYGSVVQGQTPAGC
Ga0265393_117282513300030586SoilYAHVGINNNFYTTSPSPCCAYCDIQQGDHPQCMEMDIIENNGNCLAQTTWHTWPNHNGDCDEGGCWGQMYHPAGSFHVKADFSTDGWMTVTINGATVAVTHPAPSNNAKAYVEQTMAKIGAQFHSTQWQGWVPSGNCGGGGDLASSVFSVQNVVVSGTVVQGQTPARC
Ga0265393_120516523300030586SoilMEMDIIENNGGCLGQTTWHTRPNHNGDCDEGGCWGQMYHSTGQYHVRADFSTDGWMTVTINGATVPVTNPTPSNNAKAYVMQTMQKLGAQFHSTQWQGWVPSGNCGGGGDLNSSQFAVMNVRVYGSVVQGQ
Ga0210283_140342613300030588SoilSSPSPCCNYCDIQVGDHPQCMELDIIENNGDCLSQTTWHTWPNHNGDCDEGGCWGQMYQPGTHSFHVKAEWSTDGWMTVTIDGNVVQVTNPTPSNNARAYVAQIMQQLGVQFHSTQWQGWVPSGNCGGAGDLAGSVFSVDNVQVYGSVVQGQTPAGC
Ga0210255_1107643913300030589SoilGVHGKTSYNLLGGYVQFDMNTTESHVTVNNNFYTSSPSPCCNYCDIQVGNHPQCMELDIIENNGDCVSQTTWHTWPNHNGDCDEGGCWGKVDQPSSHSFHVKAEWSTDGHGTVTIDGNVVQVTNPTPSNNAVAYVAQIMQQLGVQFHSTQWQGWVPSGNCGGGGDLAGSVFS
Ga0210276_1043775913300030595SoilPCCNYCDIQVGDHPQCMELDIIENNGDCLSQTTWHTWPNHNGDCDEGGCWGQMYQPGTHSFHVKAEWSTDGWMTVTIDGNVVQVTNPTPSNNARAYVAQIMQQLGVQFHSTQWQGWVPSGNCGGAGDLAGSVFSVDNVQVYGSVVQGQTPAGC
Ga0210276_1090541213300030595SoilTSPSPCCDYCDIQQGNHPQCMEMDIIENNGNCLAQTTWHTWPNHNGDCDEGGCWGQMYIGGSFHVKAEFSTDGWMTVTINGAAVSVTHPAPSNNAKEYVMQTMQKLGAQFHSTQWQGWVPSGNCNGGGDVGSSEFAVQNVVVVGSVVQGQTPALC
Ga0210278_108205113300030596SoilHPQCMEMDIIENNGNCLAQTTWHTWPNHNGDCDEGGCWGQMYHPAGSFHVKAEFSTDGWMTVTINGASVSVTHPVPSNNAKAFVMQTMEKIGAQFHSTQWQGWVPSGNCGGGGDLASSVFSVQNVVVSGSVVQGQTPARC
Ga0210286_120500623300030597SoilVEFDMNTTHAHVGINNNFYTTSPSPCCNYCDIQQGDHPQCMEMDIIENNGNCLAQTTWHTWPNHNGDCDEGGCWGQMYIGGSFHVKAEFSTDGWMTVTINGAAVSVTHPAPSNNAKEYVMQTMQKLGAQFHSTQWQGWVPSGNCNGGGDLGSSEFAVQNVVVVGSVVQGQTPALC
Ga0210286_126363613300030597SoilVEFHMNTTNAHVGINNNFYTSSPSPCCDYCDIQPGNHPQCMEMDIVENNGNCLSQTTWHTWPNKNGDCDEGGCWGQMYIPGSKSFHVRAAFSTDNGMIVTFNNNQVPVTNPTPSSNAKAYVIETMQKIGAQFHSTQWQGWVPGGNCGGGGNLDGSQFSVRNVRVYGTVVQGQTPAGC
Ga0210287_122360013300030598SoilPDVCCSYCDIQKGNYPQCMEMDIIENNGGCLEQTTWHTWPNHNGDCDEGGCWGQMKLPGGSFHVKAEFSGDGWMAVSINGNAVSVTNPVPSNNAKQYVAQTMARLGAQFHSTQWQGWVPGNCGGGGDLNFFIFAVRNVRVYGSVVKGKVPARC
Ga0210287_123355013300030598SoilVNNNFYTSSPSPCCNYCDIQVGNHPQCMELDIIENNGDCLSQTTWHTWPNHNGDCDEGGCWGQMYQPGTHSFHVKAEWSTDGWMTVTIDGNVVQVTNPTPSNNARAYVAQIMQQLGVQFHSTQWQGWVPSGNCGGAGDLAGSVFSVDNVQVYGSVVQGQTYSGC
Ga0210265_113566913300030605SoilINNNFYTSSPSTCCDYCDIQTGNHPQCMEMDIIENNGGCLAQTTWHTWPNKNGDCDEGGCWGQMYLPGGSFHVRAEFSADSGMVVTINGNRVSVTNPTPSNNAKAYVMQTMQKLGAQFHSTQWQGWVPSGNCGGGGNLANSVFAVRNLRVYGSVVQGQVPAGC
Ga0247657_1028260113300030614SoilNFYTSSPSTCCAYCDIQPGNHPQCMEMDIIENNGNCISQTTWHTWPNKNGDCDESGCWGQMYQPSSHSFHVKAEFTTDGWMTVTIDGNVVQVTNPTPSNNAKEYVAQQMQSIGAQFHSTQWQGWVPGGNCGGGGDLPTSVFSVENVVVVGTVVQGQTPAGC
Ga0257185_1028491013300030615Host-AssociatedYNLLGGYVEFDMNTSAAHVGINNNFYTSSPSPCCNYCDIQPGNHPQCMEMDIIENNGDCLAQTTWHTWPNKNGDCDEGGCWGQMEIPAGGNFHVKATFDPDGEMTVTINGNLVRVTNPTPSNNAKAYVAQTMQKLGAQFHSTQWQGWVPGGNCGGGGDLPSSVFGVHNVRVFASVVQGQTPAGC
Ga0265391_1035455313300030622SoilSPSPCCNYCDIQQGDHPQCMEMDIIENNGNCLAQTTWHTWPNHNGDCDEGGCWGQMYHPAGSFHVKAEFSTDGWMTVTINGASVSVTHPVPSNNAKAFVMQTMEKIGAQFHSTQWQGWVPSGNCGGGGDLASSVFAVQNVVVYGSVVQGQTPARC
Ga0210259_1129924913300030625SoilASSFSFCCNYCDIQPGNHPQCMEMDIIENNGGCFVQTTWHTWPNKNGDCDEGGCWGQMYIPGSKTFHVRADFSTDNGMIVSINNNRVPVTNPTPSGNAKAYVIQTMQQIGAQFHSTQWQGWVPSGNCGGGGNLDSSVFSVRNLRVYGSVVQGQTPAGC
Ga0210269_1035055113300030627SoilSSPSPCCDYCDIQPGNHPQCMEMDIVENNGNCLSQTTWHTWPNKNGDCDEGGCWGQMYIPGSKSFHVRAAFSTDNGMIVTFNNNQVPVTNPTPSSNAKAYVIETMQKIGAQFHSTQWQGWVPGGNCGGGGNLDGSQFSVRNVRVYGTVVQGQTPAGC
Ga0210282_1038832113300030630SoilSPCCAYCDIQQGDHPQCMEMDIIENNGGCLGQTTWHTWPNHNGDCDEGGCWGQMYHSTGQYHVRADFSTDGWMTVTINGATVPVTNPTPSNNAKAYVMQTMQKLGAQFHSTQWQGWVPSGNCGGGGDLNISECAGKNVRVYGSGGQGKNPAGC
Ga0210279_1033040613300030631SoilNFIGGYVEFDMNTSAAHVGINNNFYTSSPSPCCDYCDIQPGNHPQCMEMDIIENNGNCLAQTTWHTWPNRNGDCDEGGCWGQMYIPGNKIFHLRADFDTNEGMTVTINGNRVAVTNPTPSNNAKTFMVQTMQKIGAQFHSTQWQGWVPGGNCGGGGDLPGSVFGVHNLRVFADVVQGQTPSGC
Ga0265462_1195282413300030738SoilLAHVGINNNFYTSSPDVCCSYCDIQKGNHPQCMEMDIIENNGGCLEQTTWHTWPNHNGDCDEGGCWGQMKLPGGSFHVKAEFSGDGWMAVSINGNAVSVTNPVPSNNAKQYVAQTMARLGAQFHSTQWQGWVPGNCGGGGDLNSSIFAVRNVRVYGSVVQGKVPARC
Ga0265462_1197452513300030738SoilGYVEFDMNTSAAHTNVNNNFYTSSPSPCCNYCDIQPGNHPQCMEMDIIENNGDCLSQTTWHTWPNRNGDCDEGGCWGQMYIPSGGNFHVKATFDNDGEMTVTINGNVVPVTHPTPSSNAKAYVAQTMQKIGAQFHSTQWQGWVPSGNCGGGGDLNNSVFGVHNVKVFASVVQGQTPAGC
Ga0265462_1197569713300030738SoilNNGGCLGQTTWHTWPNHNGDCDEGGCWGQVYHSTGQYHVRADFSTDGWMTVSVNGATVPVTNPTPSNNAKAYVMQTMQKLGAQFHSTQWQGWVPSGNCGGGGDLNSSEFAVMNVRVYGSVVQGQNPSGC
Ga0265462_1232472513300030738SoilLGGYVEFDMNTTAAHVGLHTPFSPTSPNTCCDYCDIQVGNHPQGMERDISENNGGCLAQTTWHTWPNKNGDCDEGGCWGQMYISGTFHVRADFSADNGMSVTINGKSVSVTNPTPSGNAKAYLAQTMQKLGAQFHSTQWQGWVPSGNCGGGGDLPGSVFGVHNLRVFGSIVQGQTPS
Ga0265460_1211201013300030740SoilGGYVEFDMNTTDAHVNVNNNFYTSSPSPCCNYCDIQPGNHPQCMEMDIIENNGGCLAQTTWHTWPNKNGDCDEGGCWGQMYIPGSKTFHVRADFSTDNGMIVSINNNRVPVTNPTPSGNAKAYVIQTMQQIGAQFHSTQWQGWVPSGNCGGGGNLDSSVFSVRNLRVYGSVVQGQTPAGC
Ga0265460_1276819013300030740SoilTESHVTVNNNFYTSSPSPCCNYCDIQVGNHPQCMELDIIENNGDCLSQTTWHTWPNHNGDCDEGGCWGKVDQPSSHSFHVKAEWSTDGHGTVTIDGNVVQVTNPTPSNNAVAYVAQIMQQLGVQFHSTQWQGWVPSGNCGGGGDLAGSVFSVDNVQVYGSVVQGQTPAGC
Ga0265461_1280522713300030743SoilGGYVEFDMNTSAAHVNVNNNFYTSSPSPCCDYCDIQPGNHPQCMEMDIIENNGGCLAQTTWHTWANRNGDCDEGGCWGQMYIPGNKVFHVRADFNTNEGMVVTINGNRVAVTNPTPSNNAKSYMVQTMQKIGAQFHSTQWQGWVPGGNCGGGGDLPSSVFGVHNLRVYGDVVQGQTPSGC
Ga0265461_1341619813300030743SoilHVNVNNNFYTTSPSPCCNYCDIQQGDHPQCMEMDIIENNGNCLAQTTWHTWPNHNGDCDEGGCWGQMYHPGGSYHVKADFSTDGFMTVTINGATVSVTHPVPSNNAKAYVQQTMSKIGAQFHSTQWQGWVPSGNCPGGGDLNSSVFSVQNVVVVGTVVQGQTPARC
Ga0265461_1379686313300030743SoilDIQPGNHPQCMEMDIIANNGGCLAQTTWHTWPNKNGDCDEGGCWGQMYLTGGSFHVKAEFSADSGMVVTINGNRVSVTNPTPSTNAKEYVVQTMQKLGAQFHSTQWQGWVPSGNCGGGGNLANSVFAVRNLRVYGSVVQGQVPAGC
Ga0265461_1382706613300030743SoilDYCDIQPGNHPQCMEMDIIENNGGCLAQTTWHTWPNRNGDCDEGGCWGQMYLPGGSYHVKADFGTDGEMTVTINGKLVPVTNPTPSANAKAYVASTMAKIGAQFHSTQWQGWVPGGNCGGSGGLGNSVFGVHNVRVFASVVQGQTPAGC
Ga0074043_1135035113300030748SoilGGYVEFDMNTTRAHVGINNNFYTSSPNPCCEYCDIQQGNHPQCMEMDIIENNGNCIAQTTWHTWPNHNGDCDEGGCWGKMYHPSTSGNFHVKAEFATNGWMTVTINGNQVSVTNPVPSDNAREYVLQTMQKIGVQFHSTQWQGWVPSGNCGGDGDLNSSVFSVQNVMVYGSVVQGQVPAG
Ga0074043_1144004423300030748SoilLLGGYVEFDMNTTGAHVNVNNNFYTSSPSTCCNYCDIQPGNHPQCMEMDIIENNGNCILQTTWHTWPNRNGDCDEGGCWGKMNIPAGGSFHVKATFDTDGEMTVTINGNVVQVTNPVPSSNAKAYVAQTMEKIGAQFHSTQWQGWVPSGNCGGGGDLNNSVFGVHNVRVFASVVQGQTPAGC
Ga0075378_1090848213300030779SoilGGYVEFDMNTTAAHVSVNNNFYTSSPATCCGYCDIQNGDHPQCMEMDIIENNGGCLAQTTWHTWANHNGDCDQGGCWGQMYIPNGGSFHVKADFSSDQGMVVSINGNRVSVTNPTPSANAKAFLVQTMQKSGLQFHSTQWQGWVPSGNCGNARDLPSSVFGVHNVRVLGSVVQGQVPAGC
Ga0074032_1086942413300030800SoilNNNFYTSSPSPCCDYCDIQPGNHPQCMEMDIIENNGDCLSQTTWHTWPNRNGDCDEGGCWGQMYIPAGGNFHVKATFDTDGEMTVTINGNVVRVTNPTPSANAKAYVAQTMQKIGAQFHSTQWQGWVPGGNCGGGGDLASSTFGVHNVKVFASVVQGQTPAGC
Ga0074037_180717513300030803SoilSSPSPCCNYCDIQVGDHPQCMELDIIENNGDCISQTTWHTWPNHNGDCDEGGCWGNMYQPGTHSFHVKAEWSTDGWMTVTIDGTVVQVTNPTPSNNARAYVAQIMQQLGVQFHSTQWQGWVPSGNCGGAGDLAGSVFSVANVQVYGSVVQGQTPAGC
Ga0074037_182415913300030803SoilQPGNHPQCMEMDIIENNGGCLAQTTWHTWPNKNGDCDEGGCWGQMYLPGGSFHVRAEFSADSGMVVTINGNRVSVTNPTPSNNAKAYVMQTMQKLGAQFHSTQWQGWVPSGNCGGGGNLPNSVFAVHNLRVYGSVVQGQVPAGC
Ga0075384_1146142413300030841SoilSYNLLGGYVEFDMNTSAAHVNVNNNFYTSSPSPCCSYCDIQPGNHPQCMEMDIIENNGNCLSQTTWHTWPNKNGDCDEGGCWGQMYIPSGGNFHVKATFDTDGEMTVTINGNLVRVTNPTPSNNAKAYVAQTMQKIGAQFHSTQWQGWVPSGNCGGGGDLPSSIFGVHNVRVFASVVQGQTPAGC
Ga0075404_1104202913300030842SoilGKTSYNLLGGYVEFDMNVSGAQAAINNNFYTSSPSPCCAYCDIQPNGSPQCMEMDIIENNGKCLAQTTWHTWPNKNGDCDEGGCWGQMKIPGGTFHMKAEWSADGWMVVTMNGDRIWVTHPTPSTNAKDYVAQIMKSLGVQFHSTQWQGWVPGNDCPGGGNLAGSVFGVTNVRVSGTVVQGVTPTRC
Ga0075404_1118801113300030842SoilPCCAYCDIQQGDHPQCMEMDIIENNGNCLAQTTWHTWPNHNGDCDEGGCWGQMYHPSGSFHVKAEFSTDGWMTVTINGATVSVTHPVPSNNAKEYVMQTMGKLGAQFHSTQWQGWVPSGNCGGGGDLASSEFAVQNVVVSGSVVQGQTPARC
Ga0075404_1140549013300030842SoilNFYTSSPSPCCNYCDIQVGDHPQCMELDIIENNGDCLSQTTWHTWPNHNGDCDEGGCWGQMYQPGTHSFNVKAEWSTDGWMTVTIDGNVVQVTNPTPSNNARAYVAQIMQQLGVQFHSTQWQGWVPSGNCGGAGDLAGSVFSVANVQVYGSVVQGQTPAGC
Ga0075392_1118955113300030843SoilVEFDMNTSRAHVNVNNNFYTSSPNTCCDYCDIQVGNHPQCMEMDIIENNGGCLAQTTWHTWPNKNGDCDEGGCWGQMYLPGGSFHLRADFNTNDGMIVTINGNRVSVTNPTPSGNAKTFMVQTMQKIGVQFHSTQWQGWVPNGNCGGGGDLPSSVFGVHNLRVFGSVVQGQTPAGC
Ga0075392_1128070513300030843SoilVGINNNFYTSSPSPCCNYCDIQPGNHPQCMEMDIIENNGDCLSQTTWHTWPNRNGDCDEGGCWGQMYIPASKNFHVKASFDTDGVMTVTIDGNVVPVTNPVPSNNAKAYVAQTMQKIGAQFHSTQWQGWVPSGNCGGGGNLDNSVFGVHNVRVFASVVQGQTPAGC
Ga0075397_1100235913300030845SoilYNLLGGYVEFDMNTSAAHVNVNNNFYTSSPSPCCNYCDIQPGNHPQCMEMDIIENNGDCLSQTTWHTWPNRNGDCDEGGCWGQMYIPSGGNFHVKASFGTDGEMTVTINGNLVQVTHPTPSANAKAYVAQTMKSIGAQFHSTQWQGWVPSGSCGGGGDLNSSVFGVHNLKVFASVVQGQTPAGC
Ga0075388_1144624913300030848SoilSSPATCCGYCDIQNGDHPQCMEMDIIENNGGCLAQTTWHTWANHNGDCDQGGCWGQMYIPNGGSFHVKADFSADQGMVVSINGNRVSVTNPTPSANAKAFLVQTMQKSGLQFHSTQWQGWVPSGNCGNARDLPSSVFGVHNVRVLGSVVQGQVPAGC
Ga0075393_1072328213300030849SoilSSPSACCDYCDIQPGNHPQCMEMDIIENNGGCLAQTTWHTWPNRNGDCDEGGCWGQMYLPGGSFHVKAVFNPDGEMVVTINGNRVMVTNPTPSANAKAFVVQTMQKLGAQFHSTQWQGWVPGGNCGGGGDLQSSVFSVRNVRVFGSVVQGQVPAGC
Ga0075387_1175343313300030850SoilMNTTESHVTVNNNFYTSSPSPCCNYCDIQPGNHPQCMELDIIENNGDCISQTTWHTWPNRNGDCDEGGCWGQMYQPGSHSFHVKAEWSTDGWMTVTIDGNVVQVTNPTPSNNAKAYVAQIMQQLGVQFHSTQWQGWVPSGNCGG
Ga0075380_1148440413300030851SoilHGKTSYNLLGGYVQFDMNTTESHVTVNNNFYTSSPSPCCNYCDIQVGDHPQCMELDIIENNGDCISQTTWHTWPNHNGDCDEGGCWGNMYQPGTHSFHVKAEWSTDGWMTVTIDGTVVQVTNPTPSNNARAYVAQIMQQLGVQFHSTQWQGWVPSGNCGGGGDLPGSVFSVDNVQVYGTVVQGQTPAGC
Ga0075389_1110026313300030852SoilGGYVEFDMNTSAAHVGINNNFYTSSPSPCCSYCDIQPGGHPQCMEMDIIENNGGCLAQTTWHTWANRNGDCDEGGCWGQMYIPGKVFHVRADFSTDSGMLVSINGNRVSVTNPTPSANAKAYVVDTMQKLGAQFHSTQWQGWVPGGNCGGGGNLESSVFGVHNLRVFGSVVQGQVPAGC
Ga0075389_1122938413300030852SoilEFDMNTSAAHVNVNNNFYTSSPSPCCNYCDIQPGNHPQCMEMDIIENNGDCIAQTTWHTWPNRNGDCDEGGCWGQMYIPSGGNFHVKASFGTDGEMTVTINGNLVQVTHPTPSANAKAYVAQTMKSIGAQFHSTQWQGWVPSGSCGGGGDLNSSVFGVHNLKVFASVVQGQTPAGC
Ga0075372_1128956413300030853SoilMEMDIIENNGDCIAQTTWHTWPNRNGDCDEGGCWGQMYIPAGGNFHVKATFDTDGEMTVTINGNVVRVTNPTPSANAKAYVAQTMQKIGAQFHSTQWQGWVPSGNCGGGGNLDNSVFGVHNVRVFASVVQGQTPAGC
Ga0075385_1148463413300030854SoilCDIQQGDHPQCMEMDIIENNGNCLAQTTWHTWPNHNGDCDEGGCWGQMYHPSGSFHVKAEFSTDGWMTVTINGATVSVTHPVPSNNAKEYVMQTMGKLGAQFHSTQWQGWVPSGNCGGGGDLASSEFAVQNVVVSGSVVQGQTPARC
Ga0074033_1046722013300030909SoilTNAHVGINNNFYTTSPSPCCNYCDIQQGDHPQCMEMDIIENNGNCLAQTTWHTWPNHNGDCDEGGCWGQMYHPGGSYHVKADFSTDGWMTVTINGATVSVTHPVPSNNAKAFVMQTMQKIGAQFHSTQWQGWVPSGNCPGGGDLNSSVFSVQNVVVVGTVVQGQTPARC
Ga0075391_1120957213300030934SoilHGKTSYNLLGGYVQFDMNTTESHVTVNNNFYTSSPSPCCNYCDIQVGDHPQCMELDIIENNGDCISQTTWHTWPNHNGDCDEGGCWGNMYQPGTHSFHVKAEWSTDGWMTVTIDGTVVQVTNPTPSNNARAYVAQIMQQLGVQFHSTQWQGWVPSGNCGGAGDLAGSVFSVANVQVYGSVVQGQTPAGC
Ga0075401_1159953013300030935SoilYVEFDNNFYTSSPSPCCDYCDIQPGNHPQCMEMDILENNGGCLSQTTWHTWTNHNGDCDEGGCWGQMYIPGSKVFHVRADFDTTNGMTVSINGNRVAVTNPVPSANAKNYMVQTMQKLGAQFHSTQWQGWVPGGNCGGGGDLQSSVFGVHNLKVFGTVVQGQTPSGC
Ga0138299_1076355913300030938SoilMEMDIIENNGNCLAQTTWHTWPNKNGDCDENGCSGQMYHPSGSFHVRADFSNDGWMTVTIGGKVVAINNPAPSNNAKAYVMQQMGKIGAQFHSTQWQGWVPGGNCGGGGDLQSSVFSVQNVRVYGSVVQGQTPGGC
Ga0138303_105955113300030939SoilSSPATCCGYCDIQNGDHPQCMEMDIIENNGGCLAQTTWHTWANHNGDCDQGGCWGQMYIPNGGSFHVKADFSSDQGMVVSINGNRVSVTNPTPSANAKAFLVQTMQKSGLQFHSTQWQGWVPSGNCGNALDLPSSVFGVHNVRVLGSVVQGQVPAGC
Ga0138303_136085513300030939SoilSSPSPCCNYCDIQPGNHPQCMEMDIIENNGDCIAQTTWHTWPNKNGDCDEGGCWGQMYIPSGGNFHVKATFDTDGEMTVTINGNLVRVTNPTPSNNAKAYVAQTMQKIGAQFHSTQWQGWVPSGNCGGGGNLDNSVFWCAQFEGFCLSGARPNTSRVLMK
Ga0075379_1146035013300030946SoilGGYVEFDMNTTGAHVGINNNFYTTSPSPCCNYCDIQPGNHPQCMEMDIIENNGDCLSQTTWHTWPNRNGDCDEGGCWGQMYIPASKNFHVKASFDTDGVMTVTIDGNVVPVTNPVPSNNAKAYVAQTMQKIGAQFHSTQWQGWVPGGNCGGGGDLASSTFGVHNVKVFASVVQGQTPAGC
Ga0074031_106470013300030949SoilTSPSPCCNYCDIQQGDHPQCMEMDIIENNGNCLAQTTWHTWPNHNGDCDEGGCWGQMYHPGGSYHVKADFSTDGWMTVTINGATVSVTHPVPSNNAKAFVMQTMQKIGAQFHSTQWQGWVPSGNCPGGGDLNSSVFSVQNVVVVGTVVQGQTPARC
Ga0075381_1087942013300030970SoilGGYVEFDMNVSGAQAAINNNFYTSSPSPCCAYCDIQPNGSPQCMEMDIIENNGKCLAQTTWHTWPNKNGDCDEGGCWGQMKIPGGTFHMKAEWSADGWMVVTMNGDRIWVTHPTPSTNAKDYVAQIMKSLGVQFHSTQWQGWVPGNDCPGGGNLAGSVFGVTNVRVSGTV
Ga0075381_1110729313300030970SoilCCDYCDIQPGNHAQCMEMDIVENNGGCLAQTTWHTWPNRNGDCDEGGCWGQMYIPGNKVFHLRADFDTNNGMTVSINGNVVPVTNPVPSANAKAFMISTMQKLGAQFHSTQWQGWVPGGNCGGNGDLGSSVFGVHNLKVFGTVVQGKTPAGC
Ga0075381_1155683513300030970SoilGVHGKTSFNLIGGYVEFDMNTSAAHVNVNNNFYTSSPSPCCDYCDIQPGNHPQCMEMDIIENNGDCLSQTTWHTWPNRNGDCDEGGCWGQMYIPAGGNFHVKATFDTDGEMTVTINGNVVRVTNPTPSANAKAYVAQTMQKIGAQFHSTQWQGWVPGGNCGGGGDLA
Ga0074027_1119666313300030980SoilNNNFYTSSPSTCCDYCDIQTGNHPQCMEMDIIENNGGCLAQTTWHTWPNKNGDCDEGGCWGQMYLPGGSFHVRAEFSADSGMVVTINGNRVSVTNPTPSNNAKAYVMQTMQKLGAQFHSTQWQGWVPSGNCGGGGNLPNSVFAVHNLRVYGSVVQGQVPAGC
Ga0074004_1051175513300030996SoilIGINNNFYTSSPQVCCAYCDIQNNGSPQCMEMDIIENNGGCLEQTTWHTWPNHNGDCDEGGCWGQMKLPGGSFHVKADFSSDGWMTVSINGNVVSVTNPVPSNNAKEYVAKTMASIGAQFHSTQWQGWVPGNCGGGGDLNSSIFAVRNVRVYASVVQGKVPSRC
Ga0074038_1009491513300031008SoilIQQGDHPQCMEMDIIENNGNCLAQTTWHTWPNHNGDCDEGGCWGQMYHPGGSYHVKAEFSADGWMTVTINGGQVSVTHPVPSNNAKAYVMQTMSKIGAQFHSTQWQGWVPSGNCPGGGDLASSVFAVQNVMVYGSVVQGQTPAGC
Ga0138301_105490213300031022SoilTSYNLLGGYVEFDMNTSAAHTNVNNNFYTSSPSPCCNYCDIQPGNHPQCMEMDIIENNGDCVAQTTWHTWPNKNGDCDEGGCWGQMQIPAGGNFHVKATFDNDGEMTVTINGNLVSVTHPTPSSNAKAYVAQTMQKIGAQFHSTQWQGWVPSGNCGGGGDLPSSIFGVHNVRVFASVVQGQTPAGC
Ga0138301_157119213300031022SoilSHVTVNNNFYTSSPSPCCNYCDIQVGDHPQCMELDIIENNGDCISQTTWHTWPNHNGDCDEGGCWGNMYQPGTHSFHVKAEWSTDGWMTVTIDGTVVQVTNPTPSNNARAYVAQIMQQLGVQFHSTQWQGWVPSGNCGGAGDLAGSVFSVDNVQVYGSVVQGQTPAGC
Ga0073998_1167366813300031023SoilVNNNFYTSSPDTCCGYCDIQSGNHPQCMEMDIIENNGGCLAQTTWHTWPNHNGDCDQGGCWGQMYLPGGQFHVRADFSTDSGMVVSINGNRVSVTNPTPSSNAKAFLAQTMQKTGAQFHSTQWQGWVPSGNCGGGRDLPSSVFGVHNVRVYGSVVQGQTPAGC
Ga0074042_1138720213300031031SoilCNYCDIQPGNHPQCMEMDIVENNGNCLSQTTWHTWPNKNGDCDEGGCWGQMYIPGSKSFHVRASFSTDSGMIVTFNNNQVPVTNPTPSSNAKAFVIETMQKIGAQFHSTQWQGWVPGGNCGGGGNLESSQFSVRNVRVYGTVVQGQTPAGC
Ga0074026_1102199113300031035SoilVEFDMNTSIAHVGINNNFYLTSPTVCCDYCDIQPGNHPQCMEMDIIENNGGCLAQTTWHTWPNKNGDCDEGGCWGQMYLPGGSFHVRAEFSADSGMVVTINGNRVSVTNPTPSNNAKAYVMQTMQKLGAQFHSTQWQGWVPSGNCGGGGNLPNSVFAVHNLRVYGSVVQGQVPAGC
Ga0074036_1108130013300031049SoilAHVSVNNNFYTSSPATCCDYCDIQNGNHPICMEMDIIENNGGCLAQTTWHTWPNHNGDCDQGGCWGQMYIPGGAFHVKAEFSTDSGMIVSINGNRVSVTNPTPSTNAKEYLAQTMQKIGVQFHSTQWQGWVPSGNCGGGRDLASSVFGVYNLRVFGSVVQGQVPAGC
Ga0170834_10258575713300031057Forest SoilQCMEMDIIENNGGCLAQTTWHTWPNRNGDCDEGGCWGQMYLPRGSFHVKAEFNTDGEMIVTINGNRVMVTNPTPSSNAKAYVMQTMQKLGAQFHSTQWQGWVPSGNCGGGGDLQSSVFSVRNVRVYGSVVQGQAPAGC
Ga0170834_10259659123300031057Forest SoilQCMEMDIIENNGGCLAQTTWHTWPNRNGDCDEGGCWGQMYLPGGSFHVKAVFNPDGEMVVTINGNRVMVTNPTPSANAKAFVVQTMQKLGAQFHSTQWQGWVPGGNCGGGGDLQSSVFSVRNVRVFGSVVQGQVPAGC
Ga0170834_10659646813300031057Forest SoilTSSPSPCCGYCDIQPGNHPQCMEMDIIENNGGCLAQTTWHTWPNRNGDCDEGGCWGQMYIPGNKNFHLRADFDTNAGMTVRINGNVVPVTNPTPSGNAKTYMIQTMQKLGAQFHSTQWQGWVPGGNCGGNGDLGSSVFGVHNLKVFGSVVQGQTPARC
Ga0170834_11107699713300031057Forest SoilGVHGKTSFNLIGGYVEFDMNTSAAHVGINNNFYTSSPSPCCSYCDIQPGGHPQCMEMDIIENNGGCLAQTTWHTWANRNGDCDEGGCWGQMYIPGKVFHVRADFSTDSGMLVSINGNRVSVTNPTPSANAKAYVVDTMQKLGAQFHSTQWQGWVPGGNCGGGGNLESSVFG
Ga0170834_11107965513300031057Forest SoilGVHGKTSFNLIGGYVEFDMNTSAAHVGINNNFYTSSPSPCCNYCDIQPGNHPQCMEMDIIENNGGCLAQTTWHTWANRNGDCDEGGCWGQMYIPGKTFHVRADFSTDSGMLVSINGNRVPVTNPTPSANARAYVVDTMQKLGAQFHSTQWQGWVPGGNCGGGGNLESSVFG
Ga0170834_11218702413300031057Forest SoilKTSYNLLGGYVQFDMNTTESHVTVNNNFYTSSPSPCCNYCDIQVGDHPQCMELDIIENNGDCISQTTWHTWPNHNGDCDEGGCWGNMYQPGTHSFHVKAEWSTDGWMTVTIDGTVVQVTNPTPSNNARAYVAQIMQQLGVQFHSTQWQGWVPSGNCGGAGDLAGSVFSVANVQVYGSVVQGQTPAGC
Ga0170834_11336022913300031057Forest SoilTSYNFLGGYVEFDMNTTGAHVGINNNFYTTSPSPCCNYCDIQPGNHPQCMEMDIIENNGDCLSQTTWHTWPNRNGDCDEGGCWGQMYVPASKNFHVKATFDNDGVMTVTIDGNVVPVTHPVPSTNAIAYVAQTMQKIGAQFHSTQWQGWVPSGNCGGGGNLDNSVFG
Ga0170822_1018360713300031122Forest SoilPQCMEMDFIENNGNCLAQTTWHTWPNKNGDCDEGGCWGQMNQPGSHSFHVKAEFTTAGWMTVTIDGNQVQVTHPVPSTNAQNYVAQTMAKIGAQFHSTQWQGWVPGNCGGGDLPSSVFSVDNVRVYGTVVQGQTPSGC
Ga0170822_1142824913300031122Forest SoilQCMEMDIIENNGGCLAQTTWHTWPNHNGDCDQGGCWGQMYLPGGPFHVKAEFNADSGMVVSINGNVVSVTHPTPSSNAKAFLIQTMEKTGLQFHSTQWQGWVPSGNCGGARDLPSSVFGVHNVRVYGSVVQGQVPAGC
Ga0170822_1259218313300031122Forest SoilMTGAGGVHGKTSYNFLGGYVEFDMNTTGAHVGINNNFYTTSPSPCCNYCDIQPGNHPQCMEMDIIENNGDCLSQTTWHTWPNRNGDCDEGGCWGQMYVPASKNFHVKATFDNDGVMTVTIDGNVVPVTHPVPSTNAIAYVAQTMQKIGAQFHSTQWQGWVPSGNCGGGGNLDNSVFG
Ga0170822_1495442613300031122Forest SoilNNFYTSSPSSCCDYCDIQPGNHPQCMEMDIIENNGGCLAQTTWHTWANRNGDCDEGGCWGQMYLPRASFHVKAEFNTDGEMVVTLNGNRVMVTNPTPSANAKAYVVQTMQKLGAQFHSTQWQGWVPSGNCGGGGDLPSSVFSVRNVRVYGSVVQGQVPAGC
Ga0170822_1544469013300031122Forest SoilVHGKTSYNLLGGYVEFDMNTTESHVTVNNNFYTSSPNPCCAYCDIQPGNHPQCMELDIIENNGDCLSQTTWHTWPNKNGDCDEGGCWGQMYQPSTHAFHVKAEWTSDGWMTVTINGDQVQVTHPVPSNNAKEYVAQIMQQLGAQFHSTQWQGWVPSGNCGGNGDLNSAVFSVANVMVYGTVVQGQTPAGC
Ga0170822_1628706213300031122Forest SoilCCDYCDIQPGNHPQCMEMDIIENNGGCLAQTTWHTWPNRNGDCDEGGCWGQMYLPGGSFHVKAVFNPDGEMVVTINGNRVMVTNPTPSANAKAYVVQTMQKLGAQFHSTQWQGWVPGGNCGGGGDLQSSVFSVRNVRVFGSVVQGQVPAGC
Ga0170823_1115160613300031128Forest SoilNNFYTSSPSPCCNYCDIQPGNHPQCMELDIIENNGDCISQTTWHTWPNHNGDCDEGGCWGQMYQPSSHSFHVKAEWSTDGWMTVTIDGNVVQVTNPTPSNNAKEYVAQQMQALGVQFHSTQWQGWVPSGNCGGGGDLPTSVFSVDNVVVYGSVVQGQTPAGC
Ga0170823_1304733613300031128Forest SoilKTSYNLLGGYVEFDMNTSAAHVNVNNNFYTSSPSPCCNYCDIQPGNHPQCMEMDIIENNGDCLSQTTWHTWPNRNGDCDEGGCWGQMYIPSGGNFHVKASFGTDGEMTVTINGNLVQVTHPTPSANAKAYVAQTMKSIGAQFHSTQWQGWVPSGSCGGGGDLNSSVFGVHNLKVFASVVQGQTPAGC
Ga0170824_11257614313300031231Forest SoilMEMDIIENNGNCLSQTTWHTWPNKDGDCDEGGCWGQMYIQGGGVFHMRAEFSTDGWMTVSMNGQNIAVTNPVPSNNAKNYVQQQMGSKGAMIHSTQWQGWVPGGNCPGGGNLDSSSFSVSNVKVFGTVTSGQDPTRC
Ga0170820_1425833213300031446Forest SoilMEMDIIENNGNCLSQTTWHTWPNKDGDCDEGGCWGQMYIQGGGVFHMRTDFSTDGWMTVSMNGQNIAVTNPVPSNNAKNYVQQQMGSKGAMIHSTQWQGWVPGGNCPGGGNLDSSSFSVSNVKVFGTVTSGQDPTRC
Ga0170819_1075837113300031469Forest SoilSSPTTCCAYCDIQVGNYPQCMELDIIENNGNCVSQTTWHTWPNHNGDCDESGCMGHWTQTTHSFHVIAAFGTDGWMTVTIDGQVVDVNNPTPSNNARAYVAQQMESIGVQFHSTQWQGWVPSGNCGGNGDLNSSVFSVENVVVVGTVVQGQVPAGC
Ga0170819_1717567213300031469Forest SoilMDIIENNGDCIAQTTWHTWPNKNGDCDENGCEGQMSIPAGGSFHVKATFDTDGEMTVTINGNVVQVTHPVPSSNAKAYVAQTMQKIGAQFHSTQWQGWVPSGNCGGAGDLNSSTFGVHNVRVFASVVQGQTPAGC
Ga0170818_10335873813300031474Forest SoilLGGYVEFDMNTTESHVTVNNNFYTSSPNPCCDYCDIQPGNHPQCMELDIIENNGDCLSQTTWHTWPNKNGDCDEGGCWGQMYQPSNHAFHVKAEWTSDGWMTVTINGDQVQVTHPVPSNNAKEYVAQIMQQLGAQFHSTQWQGWVPSGNCGGNGDLNSAVFSVANVMVYGTVVQGQTPAG
Ga0170818_10518044913300031474Forest SoilSYNLLGGYVEFDMNTTAAHVGINNNFYTSSPSPCCSYCDIQVGNHPQCMEMDIIENNGDCLSQTTWHTWPNRNGDCDESGCMGQMSIPAGGNFHVKATFDTDGEMTVTINGNVVQVIHPVPSSNAKAYVAQTMQKIGAQFHSTQWQGWVPGGNCGGSGDLNSSVFGVHNVKVFASVVQGQTPAGC
Ga0170818_10534874013300031474Forest SoilPCCNYCDIQPGNHPQCMEMDIIENNGDCLSQTTWHTWPNRNGDCDEGGCWGQMYIPSGGNFHVKATFGTDGEMTVTINGNLVQVTHPTPSANAKAYVAQTMKSIGAQFHSTQWQGWVPSGSCGGGGDLNSSVFGVHNLKVFASVVQGQTPAGC
Ga0170818_10665396913300031474Forest SoilMLASTTIFYTSSPSPCCDYCDIQPGNHPQCMEMDIIENNGGCLAQTTWHTWPNRNGDCDEGGCWGQMYLPSKTFHVRADFSTDNGMIVTINGNRVSVSNPTPSGNAKTYLMQTMEKLGAQFHSTQWQGWVPGGNCGGGGDLPSSVFGVHNLRVFGSVVQGQTPSGC
Ga0170818_11124022013300031474Forest SoilAHPSVNNNFYSTSPSSCCAYCDIQPGNHPQCMEMDIIENNGNCLAQTTWHTWPNKNGDCDEGGCWGQMNQPGSHSFHVKAEFTTAGWMTVTIDGNQVQVTHPVPSTNAQDYVAQTMAKIGAQFHSTQWQGWVPGNCGGGDLPSSVFSVDNVRVYGTVVQGQTPSGC
Ga0315741_1176332813300032739Forest SoilRAHVGINNNFYTSSPNPCCEYCDIQQGNHPQCMEMDIIENNGNCIAQTTWHTWPNHNGDCDEGGCWGKMYHPSTSGNFHVKAEFATNGWMTVTINGNQVSVTNPVPSDNAREYVLQTMQKIGVQFHSTQWQGWVPSGNCGGDGDLNSSVFSVQNVMVYGSVVQGQVPAGC
Ga0315741_1185797713300032739Forest SoilYTTSPSPCCDYCDIQQGNHPQCMEMDIIENNGNCLAQTTWHTWPNHNGDCDEGGCWGQMYHPSGSYHVKAEFSTDGWMTVTINGAVVGVTHPTPSNNAKAYVMQTMSKIGAQFHSTQWQGWVPSGNCGGGGDLASSVFSVQNVVVSGSVVQGQQPARC
Ga0315741_1194823613300032739Forest SoilYTTSPSPCCAYCDIQQGDHPQCMEMDIIENNGGCLGQTTWHTWPNHNGDCDEGGCWGQVYHSTGQYHVRADFSTDGWMTVSVNGATVPVTNPTPSNNAKAYVMQTMQKLGAQFHSTQWQGWVPSGNCGGGGDLNSSEFAVMNVRVYGSVVQGQNPAGC
Ga0315742_1266238713300032756Forest SoilTSSPSTCCDYCDIQTGNHPQCMEMDIIENNGGCLAQTTWHTWPNKNGDCDEGGCWGQMYLPGGSFHVRAEFSADSGMVVTINGNRVSVTNPTPSNNAKAYVMQTMQKLGAQFHSTQWQGWVPSGNCGGGGNLANSVFAVRNLRVYGSVVQGQVPAGC
Ga0315742_1286359213300032756Forest SoilVGINNNFYTSSPSPCCDYCDIQPGNHPQCMEMDIIENNGNCLAQTTWHTWPNRNGDCDEGGCWGQMYIPGNKIFHLRADFDTNEGMTVTINGNRVAVTNPTPSNNAKTFMVQTMQKIGAQFHSTQWQGWVPGGNCGGGGDLPGSVFGVHNLRVFADVVQGQTPSGC

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.